8,088 Matching Annotations
  1. Oct 2023
    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary: The manuscript by Villaseca et al. analyzes the role of Gαi2 in cranial neural crest migration and reveals a novel mechanistic link to microtubule dynamics. The authors nicely demonstrate that Gαi2 is required for Xenopus neural crest migration and affects cell dispersion, cell polarity, focal adhesion turnover, and microtubule dynamics. They find that Gαi2-morphant neural crest cells are elongated, have larger, more stable protrusions, higher active Rac1 levels, and a concentration of microtubules at the leading edge. Using co-immunoprecipitation, the authors show that Gαi2 forms a complex with α-tubulin and the microtubule plus-end binding proteins EB1 and EB3, which are known regulators of microtubule dynamics. Time-lapse imaging shows that Gαi2 loss of function increases microtubule stability, which is further supported by an increase in acetylated tubulin levels. Consistently, treatment with nocodazole, which inhibits microtubule polymerization, as well as treatment with a Rac1 inhibitor, is able to rescue cell dispersion and morphology of Gαi2-morphant neural crest cells. The authors propose a model, whereby Gαi2 interacts with components of the plus-tip microtubule-binding complex to control microtubule dynamics and Rac1 activity to establish cell polarity, disassemble focal adhesion, and thereby facilitate neural crest migration.

      Major comments:

      1. The authors focus exclusively on the analysis of the subcellular levels of Rac1, which is probably related to the fact that they observe large extended protrusions with high Rac1 activity. However, as the authors note, a global fine-tuning of Rho GTPase activity is required for neural crest migration. One of the observed phenotypes of Gαi2-morphant neural crest cells is a decrease in cell dispersion, which may be caused by defects in contact inhibition of locomotion (CIL). This process involves a local activation of RhoA at cell-cell contact sites (Carmona-Fontaine et al., 2008). Furthermore, in fibroblast, RhoA/ROCK activity is required for the front-rear polarity switch during CIL (Kadir et al., 2011). Interestingly, similar to the Gαi2 loss of function phenotype, ROCK inhibition leads to microtubule stabilization, which can be rescued by nocodazole treatment, restoring microtubule dynamics and CIL. Therefore, it would also be interesting to know how RhoA activity is affected in Gαi2-morphant NC cells. At a minimum, this point should be be included in the discussion.
      2. The co-Immunoprecipitation data lack marker bands (larger images/sections of the blots would be preferable) and the labelling is not clear. What do the white arrows in Fig. 3H,I mean? What does "elu" and "non eluted" mean? Did the reverse IP work as well?
      3. The presentation of the Delaunay triangulations varies in quality. In Fig. 1 J/K the cells are clearly visible in the images, while this is not the case in Fig. 3 J-M and Fig. 4K-N. Conversely, the Delaunay triangulations in Fig. 1L are mainly black, while they are clear in Fig. 3 and 4. Perhaps the authors could find a more consistent way to present the data. Were the explants all approximately the same size at the beginning of the experiment? The Gαi2-morphant explant in Fig. 3K appears to be unusually small.
      4. Why was the tubulin distribution in Fig. 2F measured from the nucleus to the cell cortex? Would it not make more sense to include cell protrusions? This does not seem to be the case in the example shown in Fig. 2F.
      5. The immunostaining for acetylated tubulin (Fig. 3A,B) looks potentially unspecific and seems to co-localize with actin (for comparison see Bance et al., 2019). For imaging and quantification, it may be better to use tubulin co-staining to calculate the percentage of acetylated tubulin. Please also add marker bands to the Western blot in Fig. 3C. If this issue cannot be resolved it may be better to only include the Western blot data.
      6. The model in Fig.6 indicates that Gαi2 inhibits EB1/3. What is the experimental evidence and the proposed mechanism for this? In the discussion, the authors cite evidence that Gαi activates the intrinsic GTPase activity of tubulin, which would destabilize microtubules by removing the GTP cap. However, this mechanism would not directly affect EB1 and EB3 stability as the Fig. 6A seems to suggest. The authors also mention that EB3 appears to be permanently associated with microtubules in Gαi2-morphant cells. How would this work, given that end-binding proteins bind to the cap region? Are the authors suggesting that there is an extended cap region in Gαi2 morphants?

      Minor comments

      1. The citation of Wang et al. 2018 in the introduction does not seem to fit.
      2. Does the graph in Fig. 4S show average values for the three conditions? If so, what is the standard deviation?
      3. From the images in Fig. 2G and H, it is difficult to understand what the difference is between the four groups shown.

      Referees cross-commenting The concerns raised by my colleagues are entirely valid.

      Significance

      Overall, the study is well executed and significantly advances our understanding of the control and role of microtubule dynamics in cell migration, which is much less understood compared to the function of the actin cytoskeleton in this process. The strength of the study is the use of state-of-the-art (live imaging) techniques to characterize the role of Gαi in neural crest migration at the cellular/subcellular level. This article will be of interest to a broad readership, including researchers interested in basic embryonic morphogenesis, cell migration, and cytoskeletal dynamics, as well as translational/clinical researchers interested in cancer progression or wound healing.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary

      The manuscript by Villaseca et al. describes functional analysis of Gai2 in cranial neural crest (CNC) migration using the frog Xenopus as their model system. The authors performed the loss-of-function assay to knock down expression of endogenous of Gai2 and discovered that CNC migration was impaired in the absence of changes of CNC fate specification. Based on the literature on Gai2 activities in other cellular contexts, the authors speculated that Gai2 might regulate microtubule dynamics and Rac1 function. Their studies using immunofluorescence (IF) and live-cell imaging indeed showed that microtubules were stabilized in membrane protrusions with concurrent activation of Rac1 in Gai2 knockdown cells. In addition, focal adhesion turnover was reduced. They further demonstrated that the CNC migration defects could be partially rescued by destabilization of microtubules with chemical treatment. The authors conclude from the studies that Gai2 orchestrates microtubule dynamics and modulates Rac1 activation during neural crest migration.

      Major comments

      The authors aim to address two issues in this manuscript: a) the role of Gai2 in neural crest development; and b) the mechanism of Gai2 function. While they have done a good job demonstrating a role of Gai2 in NC migration both in vivo and in vitro as well as the effects of Gai2 knockdown on cytoskeleton dynamics, protein distribution of selected polarity and focal adhesion molecules, and Rac1 activation, the link between Gai2 and the downstream effectors is largely correlative. Because of this, the model suggesting the sequential events flowing from Gai2 to microtubule to Rac1 to focal adhesion/actin should be modified to allow room for direct and indirect regulation at potentially multiple entry points.

      Specific major comments are as the following:

      Strengths:

      -Determination of a role of Gai2 in neural crest migration is novel. -The effect of Gai2 knockdown on membrane protrusion morphology and microtubule stability and dynamics are demonstrated nicely. -Quantification of experimental perimeters has been performed throughout the manuscript in all the figures, and statistical analysis is included in the figures.

      Weaknesses:

      • The heavy focus of the study on microtubule is due to the previous publication on the function of Gai2 in regulation of microtubule during asymmetrical cell division. However, the activity of Gai2 is likely cell type-specific, as it has not been shown to control microtubule during cytokinesis in general. It is equally likely that Gai2 primarily regulates Rac1 or actin regulators to influence both microtubule and actin dynamics. The tone of the discussion should therefore be softened.
      • The effect of rescue of NC migration with Rac1 inhibitor is marginal and the result is hard to interpret considering the inhibitor also blocks control NC migration. Either lower doses of Rac1 inhibitor can be used or the experiment can be removed from the manuscript, as Rac1 is required for membrane protrusions and the inhibitor doses can be hard to titrate.
      • Since the defects seem to result partially from the inability of the NC cells to retract and move away, it may help to either include some data on Rho activation patterns in knockdown cells or simply add some discussion about the issue.
      • To consider focal adhesion dynamics, live imaging should be used in the analysis. The fixed samples are different from each other, and natural variations of focal adhesion may exist among the samples. This can obscure data collection and quantification.

      Minor comments

      • Fig. 2, the centrosomes in control cells are not always obvious. The microtubules simply seem to be more networked and more fluid in control cells. This should be clarified with either marking the centrosomes in the figure or modifying the wording in the manuscript.
      • In Fig. 3, a better negative control for co-IP should be using anti-V5 antibody to IP against tubulin/EB1/EB3 in the absence of Gai2-V5.
      • The data for cell polarity proteins Par3 and PKC-zeta seem to be out of place. It is unclear whether mis-localization of these proteins has anything to do with NC migration defects induced by Gai2 knockdown. The conclusion does not seem to be affected if the data are taken out of the manuscript.
      • In Suppl. Fig. 1, protrusion versus retraction should be defined more clearly. The retraction shown in this figure seems to be just membrane between protrusions instead of actively retracting membrane.
      • Discussion can be improved by better incorporating all the components to make a cohesive story on how Gai2 works to regulate migration in the context of the neural crest cells.

      Referees cross-commenting I agree with other reviewers' comments.

      Significance

      The authors demonstrate a role of Gai2 in regulation of neural crest migration in Xenopus by modulating microtubule dynamics. In addition, they show an effect of Gai2 knockdown on Rac1 spatial activation and focal adhesion stability. These are novel discoveries of the study. Some limitations exist in linking Gai2 with downstream effectors that directly or indirectly impact on cytoskeleton and Rac1 small GTPase.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary:

      This manuscript examines the role of a G protein, Gai2, in regulating the migration of cranial neural crest cells. Although previous literature has established that heterotrimeric G proteins are involved in cell migration, a central process during embryogenesis and adult homeostasis, the underlying cell biological mechanisms of their activities have not been elucidated. This manuscript rigorously examines the various aspects of Gai2 protein interactions to generate an exciting new paradigm in which Gai2 maintains normal microtubule dynamics by binding to tubulin and EB proteins. This normally dynamic microtubular intracellular environment then promotes cortical actin formation in the leading edge of the migrating cell as well as rapid focal adhesion disassembly by controlling Rac1 activity. Under conditions in which the levels of Gai2 are reduced by MO-mediated knockdown, cells display reduced microtubule dynamics and a decreased catastrophe rate, resulting in slower and more stable microtubules to which EB3 is more persistently associated. A stable microtubule environment leads to enhanced Rac1 activation at the leading edge and stable and larger focal adhesions, resulting in reduced migration. The authors utilize cutting edge approaches to examine the interactions between Gai2 and these other cellular components, taking advantage of the well characterized cell migration model - the cranial neural crest - both in embryos and in cultured explants of these cells.

      Major comments:

      The manuscript is mostly well written (it could use a few minor grammatical corrections), the significance of the problem is well described, and the results are clearly presented with adequate controls. The movies, provided as supplementary material, are of the highest quality and are essential additions to the stills provided in the figures. The data convincingly support the key conclusions of the manuscript.

      Should the authors qualify some of their claims as preliminary or speculative, or remove them altogether? No

      Would additional experiments be essential to support the claims of the paper? No additional experiments are essential.

      Are the experiments adequately replicated and statistical analysis adequate? The number of embryos/ explants per assay and the number of explant replicates for each assay and the statistical assessments are rigorous.

      Are the data and the methods presented in such a way that they can be reproduced? Mostly, however, the description of the MO used for Gai2 knockdown needs more detail:

      1. Does the MO knockdown both S and L homoeologs of X. laevis? Since the level of GAPDH in Figure 1H also looks reduced in Gai2 MO lane, it should be made clear that the apparent knockdown of Gai2 was normalized to GAPDH, rather than being the results of unequal loading of the gel. Yes, I recognize that Figure 1I says normalized, but this is not stated in the results or the methods. Also, was this experiment done with X. laevis or X. tropicalis? I could imagine that if done in X. laevis, the lack of complete knockdown might be due to only one homoeolog being affected.
      2. The knowledge of the efficacy of knockdown in each Xenopus species provided by the information requested in the previous point, would allow the reader to assess the level of knockdown in the remaining assays. To do this, the authors should tell us which assays were done in which species. I am not suggesting that each experiment needs to be done in each species, only that the information should be provided. If the MO is more effective in X. tropicalis - which assays used this species? If the knock down is partial, as shown in Figure 1H-I, which species this represents in the remaining assays would be useful knowledge.

      Minor comments:

      While prior studies are referenced appropriately, and the text and figures are mostly clear and accurately presented, the following are a few suggestions that would help the authors improve the presentation of their data and conclusions:

      1. The cell biological experiments convincingly demonstrate that knockdown of Gai2 causes cells to move more slowly. It would be a nice addition to bring the explant experimental data back to the embryo by showing whether the slower moving NC cells in morphants eventually populate the BA. DO they cease to migrate or are they just slower getting to their destination? This could be done by performing snail2 ISH at a later stage (34-35?)
      2. There are places in the manuscript where the authors use the terms "silencing" or "suppression" of Gai2, when they really mean reduced translation - their system is not a genetic knockout, as clearly demonstrated in Figure 1H-I. I suggest that more accurate wording be used.
      3. In Figures 1-5 there are scale of bars on the cell images, but these are not defined in any of the figure legends.
      4. The abstract is the weakest section of the manuscript, and would have greater impact if it were more clearly written.

      Referees cross-commenting

      The concerns are fair assessments. However, most can be addressed in the text and by clearer presentation of existing data rather than more experimentation.

      Significance

      The molecular regulation of cell movement is a key feature of a number of developmental and homeostatic processes. While many of the proteins involved have been identified, how they interact to provide motility has not been elucidated in any great detail, particularly in embryo-derived cells (as opposed to cell lines). The results obtained from the presented experiments are novel, in-depth and provide a novel paradigm for how G proteins regulate microtubule dynamics which in turn regulate other components of the cytoskeleton required for cell movement. The results will be applicable to many migrating cell types, not just neural crest cells.

      Because of the application of the data to many types of cells that migrate, the audience is expected to include a broad array of developmental biologists, basic cell biologists and those interested in clinically relevant aberrant cell migrations.

      Reviewer keywords: Xenopus embryology; neural crest gene expression; use of MO-mediated knockdown of gene expression. Not an expert in microtubule dynamics.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      This manuscript presents the cis-regulatory analysis of the enhancers controlling prox1a gene in zebrafish. Authors used both evolutionary conservation and existing single-cell ATAC data to highlight the major role of two elements. I feel that the transgenesis work is quite solid and the main conclusions interesting. However, I feel the authors need to provide some extra validations for some of the analysis.

      1. the authors did not discuss the fact that euteleosts underwent an extra whole genome duplication and that prox1a might have a paralogue. They also perform genome alignment using non-duplicated outgroups (gar, xenopus) without discussing. I am a bit skeptical about the use of mVISTA on relatively short expert of sequence aroudn a gene, as it is not able to capture the global molecular evolution parameters. I think the authors should also examine some of the precomputed phastCons / phylocons data performed and available on UCSC to confirm their findings. probably they should also examien a few more fish genome. I don't find this evolutioanry analysis extremely convinced and careful - which doesn't mean that the conclusions are wrong.
      2. I find the presentation, fairly obscure, the writing is quite convoluted, and the figures are very dense and not super explanatory, I would urge to improve (this is not helped by the fact that figure are their leged and presented at distinct places of this manuscript). For instance, I think having. a figure summarising signal from evolutionary conservation, scATAC and chromatin marks altogether would be quite essential.
      3. I also find the reanalysis of the single-cell ATAC described too scarcely: which are the genes used to identify the different cell populations?
      4. I feel the one additional experiment that the authors could have done would have been to use their construct to isolate the different cells population of interest and perform some regulatory profiling scuh as ATAC-seq or cut-and-tag on this population, to have a direct, in situ evidence of the activity of these regulatory elements.?

      I also feel that the evolutionary aspect could be discussed a bit more, what are the differences between the diffeerent vertebrate lineage, etc...

      (p7) active enhancer in a tissue: while ATAC gives a good indicated of accessibility it is not an indicate of activity as for instance H3K27Ac would be.

      Significance

      I think this is an interesting piece of work, which elaborates on previous studies on prox1a involvment in the lymphatic system but it doesn not bring essentially new perspective on the question.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary:

      Panara et al. identified the enhancer regions necessary for the tissue- and organ-specific expression of Prox1a, which is essential for lymphatic vessel development in zebrafish. The authors compared the sequences of eight species of osteichthyes, identified Conserved Non-Coding Elements (CNEs), and further predicted active enhancers by combining public databases. This sequence was analyzed using the ZED system. As a result, they confirmed that two out of ten sequences caused GFP expression in a subset of lymphatic endothelial cells. +15.2prox1a was required for the prox1a expression in the facial collecting lymphatics, while -2.1prox1a was required in the facial lymphatic valves. They also predicted transcription factor binding to these enhancer regions and identified enhancer regions of -14, -71, -87Prox1a based on chromatin state. Additionally, they identified a core element within -2.1Prox1a, performed its loss-of-function experiments, and analyzed its phenotype, revealing the functional importance of these enhancer regions. The paper is logically well-structured and informative concerning the expression control of Prox1a.

      Major comments:

      • Are the key conclusions convincing?

      I think so. - Should the authors qualify some of their claims as preliminary or speculative, or remove them altogether?

      No need to qualify. - Would additional experiments be essential to support the claims of the paper? Request additional experiments only where necessary for the paper as it is, and do not ask authors to open new lines of experimentation.

      Figure 4H is probably incorrect. Looking at the morphology of the valve, it's inferred that the lymph flow goes from right to left. In this case, if the valve function is abnormal, the lymph flow that entered from the right should reflux back to the left. Is the reviewer misunderstanding something here? Clarity on this point could be provided with video images, similar to echocardiograms in mice. - Are the suggested experiments realistic in terms of time and resources? It would help if you could add an estimated cost and time investment for substantial experiments.

      Yes, they are realistic. I would like further clarification to ensure the data is correct.

      Minor comments:

      • Specific experimental issues that are easily addressable.

      It's important where Prox1 is expressed in the lymphatic system, but if the identified enhancers also regulate Prox1 expression in other tissues like the myocardium, it would be a significant finding. Do these enhancers have a role in controlling Prox1 expression in lymphatics and non-lymphatics? - Are prior studies referenced appropriately?

      Yes. - Are the text and figures clear and accurate?

      Yes. - Do you have suggestions that would help the authors improve the presentation of their data and conclusions? 1. Regarding Figure 4G, the actual image is unknown due to the red shading. Can you discuss or clarify how knocking out the Prox1 enhancer affects valve formation? If Prox1 expression is reduced, does the normal extracellular matrix change? Why do these morphological changes occur? 2. In mice, Prox1 is expressed in the heart valve endothelium. Have they checked the enhancer activity in other valves (heart valves or venous valves, if they exist)? 3. -2.1prox1a is said to be important for Prox1 expression in the facial lymphatic valves. Are valves only formed in this part of the lymphatics in zebrafish at this stage? Why is it important to identify the enhancer for this particular valve? Are there no other lymphatic valves? Please explain in the text. 4. They seem to emphasize +15.2's role in facial lymphatic expression. Compared to the trunk, why is it significant that there is a unique enhancer acting in this area? Is there something functionally or anatomically unique about facial lymphatics? Please discuss why the enhancer region's conservation is high in facial lymphatics.

      Significance

      • Describe the nature and significance of the advance (e.g. conceptual, technical, clinical) for the field.

      In this paper, the authors have revealed previously unknown regulatory sequences of zebrafish Prox1a. They identified enhancer sequences that control Prox1a expression in the facial collecting lymphatics and lymphatic valves. The loss of the -2.1prox1a enhancer led to malformation in some lymphatic valves, suggesting the functional importance of this enhancer. - State what audience might be interested in and influenced by the reported findings.

      Readers interested in vascular development and those interested in transcriptional control during development. - Define your field of expertise with a few keywords to help the authors contextualize your point of view. Indicate if there are any parts of the paper that you do not have sufficient expertise to evaluate.

      Lymphatic development in mammals, cardiac development, cardiology, cardiovascular pathology.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Through the study of cis-regulatory element/enhancer activity in zebrafish, this study from Panara and colleagues provides insight into the transcriptional control of Prox1, a master regulator of lymphatic endothelial cell (LEC) fate. The authors used conservation of non-coding DNA, and chromatin accessibility data to identify enhancers that drive expression of a fluorescent reporter in anatomically distinct subsets of LECs. Analysis of transcription factor binding motifs in these enhancers suggests that differences in enhancer activity throughout the lymphatic vasculature may be due to binding of distinct transcription factors to these elements. Importantly, the authors identify a conserved 200 bp element within the -2.1kb enhancer that could drive expression in the lymphatic valve. Analysis of mutants carrying a 102 bp deletion in this region (including an Nfatc1 binding site), revealed reduced Prox1 expression and valve defects.

      Major comments

      • In the text it is suggested that sequence conservation was assessed across 8 species: "We aligned the region of the PROX1/prox1a locus in eight Osteichthyes species using mVISTA (Fig. 1A, Table S1)." Fig. 1A contains 7 species, and I am not able to find Table S1.
      • It would be important to discuss reasons that the +15.2kb enhancer is not clearly identifiable in the scATAC-seq analyses but drives expression. Is this due to the relatively limited activity in facial lymphatics? Furthermore, given the degree of conservation, it would be useful to mutate specific transcription factor binding motifs (e.g. Mafb, Sox18, etc) in the -15.2kb enhancer and assess activity in the FCLV.
      • OPTIONAL : Mutate Nr2f2 and Gata2 binding sites in -87kb enhancer to test for impact on activity. This would allow the authors to imply functional rather than sequence conservation. On a similar note, it would be interesting to understand if these enhancers are active in the context of mammalian lymphatic development.

      Minor comments:

      • It would be good to clarify in the following sentence that these enhancer marks are present at the whole embryo level and were not specifically identified in LECs : "Using zebrafish public databases for H3K4me1 and H3K27ac, we identified that ten of the selected prox1a CNEs were primed or active enhancers (Aday et al., 2011; Bogdanovic et al., 2012) (Fig. 1A, S1C)."
      • "....(Gupta et al., 2007) to determine the motifs and putative transcription factor binding sides." - should read "....(Gupta et al., 2007) to determine the motifs and putative transcription factor binding sites".
      • It might be more accurate to use zebrafish protein nomenclature for the transcription factor motifs in Fig1D, G and Fig2E (i.e. Gata2 not GATA2)

      Significance

      • While the roles of Prox1 in lymphatic vascular development and homeostasis are well established, relatively little is known about the cis-regulatory mechanisms governing it's expression; recent work has described an enhancer in the mouse Prox1 locus (Kazenwadel et al., 2023). This study from Panara and colleagues characterises numerous cis-regulatory elements in the zebrafish prox1a locus and demonstrates heterogeneous activity in anatomically distinct parts of the lymphatic vasculature. The imaging and characterisation of enhancer elements is of a high standard. Experiments that addressed the regulation of enhancers by upstream transcriptional or signalling cues would strengthen this study. Furthermore, to understand if there is functional conservation across evolution, analysis of activity in mouse embryos would be of interest.
      • This should be of broad interest to the vascular biology and developmental biology fields.
      • My expertise are in vascular biology, lymphatic development and developmental genetics.
    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We thank all the reviewers for positively evaluating our work and for their valuable comments and constructive suggestions. We will revise the manuscript in accordance with the raised points and ensure that all comments are addressed.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary:

      The study of the formation and maintenance of the blood-brain barrier (BBB) is a growing field of study, partly due to its strong link with neurological disorders. The BBB depends on the role of multiple cell types and mechanisms. Mutations in the conserved phospholipase NTE/SWS can lead to neurodegeneration, and previous work from the authors shows that SWS loss leads to abnormal glial morphology. In this work, authors use Drosophila to further study this phenotype, showing that SWS is mostly expressed in the BBB-related glia and that its loss leads to abnormal BBB permeability, increased inflammatory response and neural cell death. Interestingly, authors observed a dependence for the BBB-defective phenotype on aging, with important implications for SWS/NTE and neurodegeneration. Overall, the work represents a clear advance in the poorly explored role of NTE/SWS in neurodegeneration, with a broad impact on the understanding of BBB maintenance. This work shows a combination of multiple and appropriate experimental approaches, including confocal microscopy, EM, RT-qPCR, or gas chromatography-mass spectrometry among others.

      Major comments:

      The use of sws1 and sws1/sws4 transheterozygous animals, together with the use of sws RNAi is a solid approach to validate that the reported phenotypes are due to SWS loss. Using these models, the authors performed a convincing structural analysis of the subperineurial glia phenotype, and showed that it is accompanied by a defective BBB, inflammation and neuronal cell death. The key conclusions are properly supported by the data. However, there are some claims in the text that are not supported by any data in the Figures, but only qualifications. This needs to be fixed:

      • Page 6, third paragraph: "...we specifically downregulated sws in the nervous system using the double driver line that allows downregulation of sws in glia and neurons (repo, nSyb-Gal4, Suppl. Fig. 2C-Cʹ). Since these animals had the same disorganized structure of brain surface as the loss-of-function mutant..." Supp. Fig. 2C-C' only shows expression of CD8:GFP and nlacZ reporters by repo and nSyb-Gal4, but there is no data showing sws RNAi expression by these drivers.

      "...Moreover, downregulation of sws in all glial cells (repo>swsRNAi) resulted in the same phenotype. At the same time, upon sws downregulation in neurons,... (Suppl. Fig. 4)..." Suppl. Fig. 4 only shows nsyb>swsRNAi data but not repo>swsRNAi - Page 6, fourth paragraph: "Importantly, expression of Drosophila or human NTE in these glia cells rescued this phenotype (Fig. 2H)" In addition to the indicated quantifications, it is essential to show some representative data showing the phenotype when Drosophila or human NTE are expressed in glial cells of sws mutant animals. - Page 9, last paragraph: "We found that in moody mutants, the surface glia phenotype analyzed using CoraC as a marker could also be suppressed by NSAID and rapamycin (Fig. 5A)." In addition to the indicated quantifications, it is essential to show some representative data showing the phenotype with and without treatments.

      A more detailed analysis of two aspects of the data would clearly improve the manuscript, whose findings are a bit superficial in the current state:

      • The exact mechanism by which BBB permeability leads to brain inflammation remains unknown. Authors show that accumulation of polyunsaturated fatty acids (known to regulate inflammation) occurs in sws-depleted animals. However, they only observed a correlation between this phenotype and the inflammatory response, while is not clear whether the accumulation of polyunsaturated fatty acids causes inflammation in this model or is a consequence of it. An attempt to rescue the accumulation of polyunsaturated fatty acids (i.e., knocking down a required enzyme for their production) in sws mutants might help to understand this. Also, the fact that the defective BBB phenotype observed in either sws KO and glia-specific KD can only be partially rescued by the use of inflammation inhibitors, suggests that other pathways are involved.
      • While the differences between the phenotypes caused by sws or moody loss are well characterized, it would be key for this work to further study the mechanisms by which sws controls septate junctions. The authors propose the organization of lipid rafts, but some experiments in that direction to check this hypothesis. For example, can authors reproduce the septate junction phenotype of sws mutant (Fig. 6C) by using a different approach to induce defective lysosomes in subperineurial glia?

      The attempt of the proposed approaches above should require about 3-6 months of investment, with limited economic effort, given the availability and diversity of lines found in the existing stock centres such as Bloomington or Vienna.

      The data is presented very clearly, and the methods are adequately detailed, and the experiments and statistical analysis are adequate.

      Minor comments:

      Prior studies are referenced appropriately, but there is a case that should be addressed. On Page 3, first paragraph, regarding the sentence: "However, the molecular mechanisms underlying inflammaging remain unclear". I recommend specifying what is known and what is unknown in the field. Ideally describing (briefly) the knowledge about lipids, inflammaging and neurodegeneration, which are the specific topics of the research. Otherwise, the current sentence is too vague, while there is a lot of work published about it.

      The text and figures are clear and accurate. The logic of the experiments and the results are exposed very clearly (for example, the Suppl. Tables are very helpful). There are a few minor issues, however, that should be addressed:

      • Page 4, first paragraph: regarding the sentence: "For various obvious reasons, humans are not ideal subjects for age-related research.", I recommend specifying the main reasons (i.e. life cycle, ethical issues, etc.?).
      • I would recommend moving the text "For various obvious reasons...disrupted upon ageing." From its current position to just before "Drosophila melanogaster is an excellent...". This would keep a better logic in the text by explaining NTE first and later introducing the models to study its function. Presenting then Drosophila.
      • To support the sentence "Together, Drosophila satisfies...neurodegeneration during aging", instead of citing so many papers, I recommend citing just one current review about it, since the amount of literature supporting the claim is huge and should not be limited to a few "random" articles. An alternative might be indicating that the lab has used Drosophila for this aim before, and then citing the examples from the literature.
      • Page 4, second paragraph: if NTE/SWS is going to be used as a synonym for NTE/SWS loss of function (or other type) model, it needs to be specified. Otherwise, refers to the proteins and sentences like "NTE/SWS has been shown to result in lipid droplet accumulation..." are misleading.
      • Page 4, last paragraph: the first time that "BBB" is used, its meaning should be specified. And three lines below use "BBB" instead of blood-brain barrier.

      Referees cross-commenting

      I agree with the comments provided by the other reviewers. They are well reasoned and cover some aspects of the work that I did not see. Regarding the main issue, the three revisions point at the same direction, that is the limited analysis about the mechanism underlying the phenotypes.

      Significance

      • Describe the nature and significance of the advance (e.g. conceptual, technical, clinical) for the field.

      This work represents a substantial advance in the understanding of NTE/SWS function in the context of neurodegeneration, and opens potential approaches to treat related disorders (they successfully use anti-inflammatory compounds to ameliorate some of the key phenotypes). However, the findings are a bit superficial in terms of mechanisms, and further analysis (see major comments) would notably improve the significance of the manuscript. This should be realistic and suitable, given the advantages of the Drosophila model and the availability of tools. - Place the work in the context of the existing literature.

      The role of SWS in regulating lysosomal function is potentially supported by NTE-deficient mice data (Akassoglou et al., 2004; Read et al., 2009), where different types of neurons show similar dense bodies containing concentrically laminated and multilayered membranes than those observed in this work in Drosophila sws mutant. Potentially, the rest of the work has a translation to mammals, which is supported by the fact that ectopic expression of NTE rescues some of the key phenotypes described in the manuscript. - State what audience might be interested in and influenced by the reported findings.

      Neuroscience in general, since the study of BBB and neurodegeneration has a clear general interest in the whole field. - Define your field of expertise with a few keywords to help the authors contextualize your point of view. Indicate if there are any parts of the paper that you do not have sufficient expertise to evaluate.

      Drosophila; Neurodegeneration; Hereditary Spastic Paraplegia; Alzheimer's disease; Motor neurons; Microglia; Endoplasmic reticulum; Mitochondria.

      Lipid metabolism is the part of the manuscript where I have less expertise to evaluate, only having general knowledge about it.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      The manuscript by Tsap et al describes a role of NTE/SWS in forming the BBB in Drosophila. Disruption of the BBB in SWS mutants and knockdown flies results in morphological changes of the glia forming the BBB, increased brain permeability, altered lysosomes, and an upregulation of innate immune genes. The experiments to show a function of SWS in surface glia and the resulting changes in permeability are well supported by the experiments and the statistics appears appropriate. The authors also show changes in innate immune genes and some fatty acids and that similar changes are found in another mutant affecting the BBB. They discuss that these changes are a consequence of the disruptions of the BBB but also that these changes induce changes in the BBB. To address this and confirm that the changes in immune genes and fatty acids is a consequence of the altered BBB, they should include experiment expressing SWS in the surface glia and measure if that normalizes these changes. Another major aspect that should be addressed is the effect of aging. As the authors point out, loss of SWS causes age-dependent phenotypes (shown by the author and others) and with the exception of figure 3F, the age isn't even mentioned in any of the other figures. Furthermore, at least some of the experiments should be done at different ages to determine whether the phenotype is progressive; this includes the permeability assays and the measurements of immune genes (the latter could also support whether changes in the immune genes affect the BBB or vice versa the BBB changes cause the upregulation of immune genes). Lastly, the authors claim that septate junctions are defective in sws mutants. However, this should be confirmed by EM studies (which the authors have already done) besides immunohistochemistry which doesn't provide enough resolution.

      Significance

      A role of SWS in maintaining the BBB and what consequences this has provides another insight how this protein (and its homolog NTE) affects brain health. Although a function of SWS in glia (as well as in neurons) has previously been described, changes in the surface glia and the BBB is a novel aspect. However, the causative role of SWS on some of the described consequences (see above) should be confirmed. Although the manuscript can add to a better understanding of the connection between disruptions of the BBB and neurodegenerative diseases, which is of interest for a broader field of researchers, the discussion of the results is quite speculative.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary

      Elucidating the cellular and molecular mechanisms underlying age-related neurodegeneration remains a key challenge for neurobiologists. In this manuscript, Mariana Tsap and colleagues in the team of Halyna Shcherbata focus on the function of the neuropathy target esterase NTE/Swiss Cheese (Sws) in the Drosophila brain. The authors use an elegant combination of genetics, light and electron microscopy, RT-qPCR and GS-MS mass spectrometry to determine the complex role of Sws in cellular blood brain barrier (BBB) integrity, the brain inflammatory response and fatty acid metabolism. The study provides a detailed characterisation as to how the loss of sws affects glial cell morphology in the BBB revealing abnormal membrane accumulations and tight junctions, and in consequence causing permeability issues. Importantly, they observed the upregulation of antimicrobial peptides in the brain, indicative of neuroinflammation, as well as of fatty acids, equally connected with the inflammatory response.

      Major comments

      The study provides a detailed and comprehensive characterization of the sws mutant phenotype, and in particular the role of this gene in blood-brain barrier forming glia. - The study connects neurodegeneration and inflammation, but also makes a particular point about "inflammaging". However, the age contribution has not been studied in detail. Indeed, the flies analyzed are 15 days old (according to the Material and Methods section, with the exception of Figure 1 where flies are 30 days old), and hence have not been compared with younger or older flies to make a point of age as evoked in the abstract, introduction or discussion. The authors should either add experiments comparing differently aged flies or de-emphasize this point to a brief consideration in the discussion. Instead, it would be very helpful to provide concise information about the current knowledge concerning the inflammatory response in the Drosophila brain. - Related to this point, the authors convincingly show that sws is required in surface glia using rescue experiments. Nevertheless, all experiments rely on drivers and mutants that could cause the emergence of phenotypes during development. Thus, to strengthen the causative link between the breakdown of the BBB and the neuroinflammatory response, it would be helpful to consider an acute knock-down in adults after BBB formation has been completed. - To test the brain permeability barrier, the study uses a 10 KDa dextran permeability assay. Almost 25% of brain in controls show a leaky barrier. It would be helpful to describe the causes for this relatively high occurrence. - An important point in the study concerns the increase of free fatty acids as cause of the inflammatory response. The measurements were based on measurements of whole heads, which could include the hemolymph and fat body within the head in addition to brain. However, the causative relationship remains unclear and the question why a leaky blood brain barrier would increase the free fatty acid levels in the body or brain remains mainly an observation at the descriptive level. Here, it would be helpful to design an experiment, which could test the causative links or to modify the interpretation in scheme 6D and adjust the wording in the text. - Related to this, how do the levels of AMP caused by a leaky BBB would compare to an elicited neuroinflammation by the presence of bacteria? The neuroinflammatory response can be accompanied by macrophage entry into the brain following AMP induction. Could the authors detect this response (which could be envisioned as manipulations include pupal development, provided macrophages would persist into adulthood)? This would make a strong point regardless of the outcome. - Expression of sws is determined using sws-Gal4 driving membrane-tethered GFP. As sws is expressed very widely and classical Gal4 lines tend to be active in the BBB, it is important to provide the exact information about the nature of this driver. - The Material and Methods section should contain a proper Quantification and Statistical analysis section. In the Figures, it would be helpful to refer to the Table reporting sample numbers. - In Figure 5, it would be important to indicate sample numbers, the nature of the error bar, and show data points together with columns.

      Minor comments

      • On page 8, cell death is visualized using "the apoptotic marker Cas3". It should be Caspase-3. Moreover, it is not clear whether this antibody (directed against vertebrate Caspase-3) recognizes indeed Caspase-3 in Drosophila? This should be formulated more carefully.
      • On Page 9 (3rd paragraph), the authors report that they "want to understand what signaling pathway is activated." However, the described experiments do not lead to a signaling pathway, but conclude that an antiflammatory response is evoked. This should thus be reworded.
      • Figure 1 reports the expression pattern and phenotype of sws; thus, the title of the figure should be extended.
      • Concerning the description of phenotypes, the authors use the term "clumps", but it is not clear what this entails (e.g., Page 6, or Figure 6). For the reader, it is also necessary to refer to original studies of moody to understand the septate junction phenotype represented in the figure.

      Referees cross-commenting

      I fully agree with the comments of the other two reviewers, as they were complementary and overlapping with mine (e.g. the contribution of age).

      Significance

      This study provides a detailed cellular and functional characterization of the swiss cheese phenotype in the blood-brain barrier so far not reported in previous studies, including the team's own earlier publications (e.g., Kretzschmar et al., 1997; Melentev et al., 2021 and Ryabova et al., 2021). Furthermore, it uses cutting-edge technology to provide links to neuroinflammation and neurodegeneration, Previous studies explored neuroinflammation in the brain of Drosophila by challenging the organism with bacteria to mount an inflammatory response (Winkler et al., 2021). Intriguingly, this current study provides evidence, that a leaky blood brain barrier alone could lead to an inflammatory response, and that in turn, treatment with anti-inflammatory agents could reduce the cellular defects in glia and in consequence neurodegeneration. This represents an important conceptual advance that will be of wide interest to neurobiologists interested in glial biology, neuroinflammation and neurodegeneration in Drosophila and in vertebrates. One possible limitation of the study may be that while complex cellular processes have been pinpointed, some of the causative links of the BBB with neuroinflammation remain unexplored, in particular the aspect of elevated free fatty acids/antimicrobial peptides.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In the manuscript entitled "The long non-coding RNA LINC00941 modulates MTA2/NuRD occupancy to suppress premature human epidermal differentiation", Morgenstern and colleagues describe a novel mechanism by which Nur complex interacting with a ncRNA LINC00947 represses expression of a late differentiation transcription factor EGR3 in the skin. These findings are novel and will be of interest in the field. Of note, the authors use a plethora of biochemical and cell biology techniques such as chromatin occupancy, transcriptomics and organotypic skin culture. Both the Introduction and Discussion outline a necessary background in the field of ncRNAs and skin biology as well as clearly state and discuss the scientific problem. The Methods are comprehensive and accurate. Importantly, any possible ethical issues are discussed. The Results are clear and support the data shown. Also the Figures are well organised and easy to follow. Overall, the manuscript is well prepared and will be of interest for broad readership. Before publication, however, the authors should address some points to further enhance their work:

      Major points:

      1. It is peculiar that there is no evident K10 and FLG staining in the organotypic skin from siControl cells in Fig 2E but it is present on the Fig 5C. The authors should explain these inconsistences. Ideally the authors should provide a western blot analysis of these proteins which would help to give a more quantitative picture of the phenomenon.
      2. There iare no evidences at protein level of an efficiency of MTA2 and EGR3 knock-down. The authors use an MTA2 for western blot, so it should not be difficult to confirm. For EGR3, it is essential, as EFR3 is expected to increase only during late differentiation, while experiments from Fig 5B are performed only at 3 days of differentiation. Is it enough to induce EGR3 expression? Is the knock-down efficient at protein level at that time point? This is important as the work by Kim et al 2019 shows a detectable expression of EGR3 only after 7 days of differentiation.
      3. The authors should demonstrate an increase of EGR3 at protein level after LINC00947 knock-down (by western blot in vitro and/or in epidermal organotypic tissue).
      4. A key experiment to confirm the proposed model should be a double knock-down of both LINC00941 and EGF3. Will it rescue the observed increase of pro-differentiation genes?

      Minor points:

      1. 4E - EGR3 or LINC00941 knock-down?
      2. 4E - The RNA seq label states "RNA seq (siLINC00941 d3)" but apparently shows both scr and siLINC00941
      3. Please add the recipe of the lysis buffer used for western blot analysis of keratinocytes lysates.
      4. Page 10 - Fig 4D description - is it "chromatin conformation state" or just "chromatin state"?

      Significance

      These findings are novel and will be of interest in the field.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      In this manuscript, the authors investigate the role of LINC00941 epidermal differentiation. Specifically the authors show interaction with MTA2 and other NuRD subunits. Next, the authors show that LINC00941 and MTA2 restricts premature keratinocyte differentiation, where KD of either results in increased differentiation marker expression. To understand molecular impacts, the authors perform ChIPseq of MTA2 in control and LINC00941 depletion. Curiously, MTA2 binds in a trend differing from other cell types with predominant binding over active promoters. Upon LINC00941 KD, MTA2 binding is changed at 33 locations, where the majority show reduced binding. Overlapping binding changes with gene expression changes, the authors identify EGR3 as the only direct candidate upregulated upon LINC00941 KD and upregulated during differentiation. KD of EGR3 results in opposite trends of LINC00941 KD, suggesting the proposed mechanism of LINC00941 repressing EGR3 until appropriate time in differentiation. I have the following suggestions for this work:

      1. While data support MTA2 acting in NuRD, beyond Fig 1, the authors exclusively use MTA2 as a proxy for NuRD. Of course there are some subunits that are within other complexes and should not be used, others are options. While I do not expect the authors to perform all experiments on an additional subunit of NuRD, I do think there are a few things the authors should consider:
        • a. Be more precise with language to point out only MTA2 rather than say NuRD complex throughout many aspects of the paper, and only assume the complex in limited settings and when it is clear it is speculative
        • b. Perform a subset of experiments on another subunit. For example, the Mass Spec in Fig 1A/B shows an interaction with other subunits, but the verification was only done for MTA2 (Fig 1C/D). This could easily be blotted (or another Western performed) and/or primers for other subunits for the qPCR for a couple additional subunits. Similarly straightforward, looking at MTA2 RNA expression changes during differentiation (Fig 2A): if additional primers were used to other subunits, these additional subunits could be used to verify.
      2. Related to the above comment, does MTA2 KD (or LINC00941 KD for that matter) result in loss of NuRD complex formation? If so, this would be sufficient to address point 1.
      3. Finally, in relation to NuRD complex here, it is important to note that mutually exclusive NuRD complexes (MBD2/NuRD and MBD3/NuRD) have been documented. Because the Mass Spec did not show interaction to MBD2 or MBD3, it is not clear if this is limited to one of these complexes. Related to this, the authors show by Mass spec that LINC00941 interacts with CHD4, but not CHD3. Is this because Chd3 is not expressed in these cells, or because there is some mutual exclusivity to CHD4 and LINC00941 is acting through this subcomplex?
      4. Immunofluorescence images showing increased Keratin 10 and Filaggrin in LINC00941 or MTA2 KD (Fig 2E) and decreased Keratin 10 and Filaggrin in EGR3 KD (Fig 5C) are curious as the control look very different. In 2E, the control shows barely detectable levels, whereas in 5C the levels look similar to what is seen in Fig 2E KDs. Is this variability? If so, more representative images as well as quantification to the changes are necessary to make these two points.
      5. In Figure 4, the authors present ChIPseq data for MTA2 in LINC00941 KD. One interesting trend is that the KD alters binding of MTA2 at mostly bivalent/repressed locations, rather than at active locations which is the majority of MTA2 binding (from Fig 3). It would be nice to show then these data rather than only stating it. The authors include a browser track for 2 genes (Fig 4D and S4C), but for the other 31 locations, a heatmap or something to show the level of K27me3 vs K27ac/K4me3 would be helpful to support this claim. Notably saying "Most of the differential MTA2/NuRD occupied sites were marked by repressive histone modification H3K27me3..." is the point that doesn't seem to be shown, and also a precise number should be included. a. Related to this, I believe the authors performed K27me3 ChIPseq in the KD, and if so, it would be nice to see more genome wide effects here.
      6. This is perhaps beyond the scope of the paper, but the obvious question to me is if EGR3 is relocalized in LINC00941 KD. Specifically, we would anticipate that EGR3 localization in the KD would mimic that of a more differentiated cell (binding to differentiated genes). A quick ChIPqPCR experiment for a few locations would be sufficient to support this model.

      Minor points:

      1. Importantly, CHD5 can also be incorporated in NuRD, in place of CHD3 or CHD4.
      2. The authors use heatmaps and metaplots in Fig S3 to show reproducibility of the ChIPseq datasets. Importantly, the PCA does show some variation. XY scatterplots for replicates vs one another would be a more robust QC.
      3. In figure 4D, the authors present nice data showing changes in histone mods during differentiation, but it is very hard to see the color changes and the tracks as presented. (same point for Fig S4C)
      4. it is unclear from the methods or the figure legend if RTqPCR data are biological or technical replicates.

      Significance

      In this manuscript, the authors present a molecular function for LINC00941 in epidermal differentiation, where it interacts directly with NuRD subunit MTA2. LINC00941 has been previously described but this activity was not described. LINC00941 seems to specifically help target or maintain MTA2 localization to EGR3 to promote repression of this gene. Then, the model suggests that during differentiation, LINC00941 and MTA2 levels decrease, permitting activation of EGR3 during epidermal differentiation and subsequent activation of appropriate genes. These findings will be of interest to individuals interested in NuRD function, lncRNA activity and/or epidermal cell fate.

      My expertise is in chromatin biology, chromatin remodelers, epigenomics, and cell identity.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      In this manuscript, Morgenstern et al investigated the molecular mechanism by which LINC00941 regulates keratinocyte differentiation. They found the LINC00941 interacts with the NuRD chromatin remodeling complex in human primary keratinocytes. Furthermore, LINC00941 silencing by RNAi results in changes in the genomic occupancy of MTA2, a core NuRD subunit, especially near a number of bivalent genes. In particular, they showed that LINC00941 depletion resulted in reduced MTA2 occupancy at the EGR3 gene, increased EGR3 expression, and increased expression of EGR3-regulated epidermal differentiation genes. Together, they propose that LINC00941 prevents premature differentiation of human epidermal tissue by repressing EGR3 expression in non-differentiated keratinocytes via NuRD. The interaction between LINC00941 and NuRD is a novel finding and will likely provide new insights for the function of LINC00941, which has been implicated in keratinocytes, tissue homeostasis and cancer. It will also shed light on the role of lncRNAs in epigenetic gene regulation and cell fate transition in general. The conclusion of this study can be much strengthened if the authors can identify LINC00941-occupied genomic regions by ChIRP (PMID: 21963238) or RAP (PMID: 23828888). In addition, the authors are also encouraged to address the following questions and comments to further improve the manuscript.

      Fig 1C: Since multiple NuRD subunits were identified in the LINC00941 pull-down (Fig 1B), can the authors validate at least one other subunit? CHD4 is also a NuRD-specific subunit and appears to be a strong hit based on supplemental Fig 1.

      Fig 1D: Can the authors also try RNA-IP on MTA2 and endogenous LINC00941?

      Fig 2B: It seems that MTA2 protein level still remains reasonably high at day-4.

      Fig 3C: How many bivalent promoters are there in keratinocytes? How many of those are bound by MTA2?

      Fig S3A: Can the authors examine MTA2 occupancy at TSS and bivalent TSS in control vs. siLINC00941 cells (by meta-gene analysis)? This will show whether LINC00941 KD affects MTA2 occupancy at bivalent TSS in general.

      Fig 4B: Does LINC00941 KD only affect 33 out of the 3613 MTA2 peaks? If yes, can the authors comment on why only such a small fraction of MTA2 occupied regions are affected?

      Fig 4C: The authors only examined a small number of MTA2-associated genes. To provide a more complete view of the potential involvement of LINC00941-regulated genes in keratinocytes differentiation, can the authors provide the total number of differentially expressed genes (DEGs) in LINC00941 KD, the total number of DEGs during keratinocytes differentiation, and the overlap between the two (maybe using a venn diagram)? In addition, among all the overlapping DEGs from above, how many of them have MTA2 peaks nearby? Finally, in the overlapping DEGs occupied by MTA2, can the authors compare MTA2 occupancy at up- vs. down-regulated DEGs caused by LINC00941 KD, to see whether reduced MTA2 occupancy associates with increased expression after LINC00941 KD?

      Fig 4D: Can the authors add the H3K4me3 track to the figure? Can the authors provide ChIP-qPCR result to validate the changes in MTA2 occupancy near EGR3 after LINC00941 KD?

      Fig 5A: Some of the EGR3 target genes (eg., GJB4, SERTAD1) appear to be expressed before EGR3 up-regulation in siCtrl, and some of them (eg. HMOX1, ESYT3, SMPD3) appear to show stronger up-regulation than EGR3 in siLINC00941. This is not entirely consistent with the idea that they are regulated by LINC00941 via EGR3.

      Significance

      The interaction between LINC00941 and NuRD is a novel finding and will likely provide new insights for the function of LINC00941, which has been implicated in keratinocytes, tissue homeostasis and cancer. It will also shed light on the role of lncRNAs in epigenetic gene regulation and cell fate transition in general. The conclusion of this study can be much strengthened if the authors can identify LINC00941-occupied genomic regions by ChIRP (PMID: 21963238) or RAP (PMID: 23828888). In addition, the authors are also encouraged to address the above-mentioned questions and comments to further improve the manuscript.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      [The “revision plan” should delineate the revisions that authors intend to carry out in response to the points raised by the referees. It also provides the authors with the opportunity to explain their view of the paper and of the referee reports.

      1. General Statements [optional]

      In this paper we describe the new finding that the epicardial deposits the extracellular matrix component laminin onto the apical ventricular surface during cardiac development. We identify a novel role for the apicobasal polarity protein Llgl1in timely emergence of the epicardium and deposition of this apical laminin, alongside a requirement for Llgl1 in maintaining integrity of the ventricular wall at the onset of trabeculation.

      We thank the reviewers for their very positive appraisal of our manuscript, and for their helpful suggestions for useful revisions. In particular we would like to highlight the broad interest they feel this manuscript holds, not only contributing conceptual advances to our understanding of multiple aspects of cardiac development, but also to cell and developmental biologists working in epithelial polarity and extracellular matrix function. We also note their positive appraisal of the rigor of the study and quality of the manuscript.

      2. Description of the planned revisions

      Reviewer 1

      1a) It is mentioned that llgl1 CRISPR/Cas9 mutants are viable as adults on pg. 3 of the Results section. Have the authors examined heart morphology in these mutants in juvenile or adult fish?

      We have some historical data on adult llgl1 mutant survival that we plan to include in the study.

      Reviewer 2

      2a) The authors note an interesting observation with apical and basal laminin deposition dynamics surrounding cardiomyocytes, and that Llg1 has a role in apical Laminin deposition (however, highly variable at 80 hpf as Figure 3M shows). They carry out a very nice study in which they overexpress Llgl1 tagged with mCherry in the myocardium and show that there is no rescue of the extruding cardiomyocyte defect or Laminin deposition. However, there is still a possibility that the tagged Llgl1 in the transgene Tg(myl7:Llg1-mCherry)sh679 might not be functional due to improper protein folding or interference by the mCherry tag. The authors should supplement their approach with a transplantation experiment to generate mosaic llgl1 mutant animals and assess whether llgl1 mutant cardiomyocytes extrude at a higher rate than the control. This would provide definitive evidence that Llg1l acts in a cell non-autonomous manner.

      We agree with the reviewer, and propose to perform transplant experiments, transplanting cells from llgl1 mutants into wild type siblings, and quantify cell extrusion to determine whether llgl1 mutant cells are extruded more frequently than wild type.

      2b) The data in this manuscript appears to point that Llgl1 regulates Laminin deposition mainly in epicardial cells to regulate their dissemination/migration across the ventricular myocardial surface. It would be important to test this cell-autonomous function with the transplant experiment (above point) and examine whether llgl1 mutant epicardial cells fail to migrate and deposit Laminin. It might be possible to perform a rescue experiment through overexpression of Llgl1 in epicardial cells (if possible, there is a tcf21:Gal4 line available).

      Similar to above, we propose to perform transplant experiments, transplanting cells from llgl1 mutants or wild type siblings into wild type siblings or llgl1 mutants, respectively, and in this instance quantify contribution of transplanted cells to epicardial coverage.

      2c) In the Discussion, the authors propose that Llgl1 acts in two ways: Laminin deposition in epicardial cells that suppress cell extrusion and polarity regulation in cardiomyocytes to promote trabeculation. It would be important to test the second hypothesis on trabeculation and polarity regulation by using the myocardial-specific overexpression/rescue of Llgl1 in llgl1 mutants, and then quantifying the trabeculating cardiomyocytes and analyze Crb2a localization. This experiment can distinguish whether this trabeculation phenotype is rescued independently of the apical Laminin deposition that has been included in Figure S5.

      To help address the second part of our hypothesis laid out in the discussion, we propose to quantify trabecular organisation and Crb2a localisation in llgl1 mutants either carrying the myl7:llgl1-mCherry construct, or mCherry-negative controls.

      2d) The potential mis-localization of Crb2a in the llgl1 mutants is interesting, but this effect appears to be quite mild, and as the authors note, resolve by 80 hpf. Considering the role of Lgl in Drosophila in shifting Crb complex localization during early epithelial morphogenesis, it would be worth performing the analysis at earlier timepoints (between 55 and 72 hpf) to determine whether Llgl1 is indeed important for the progressive apical relocalization of Crb2a.

      We will expand our description of this in the mutants by performing analysis of Crb2a at earlier timepoints in the llgl1 mutant (55hpf and 60hpf).

      2e) OPTIONAL: It might be worth testing other antibodies that could mark the apical (particularly aPKC which is known to phosphorylate and regulate the Crb complex) and basolateral domains (Par1, Dlg) of the cardiomyocytes to definitively conclude that the epithelial integrity of the cells is affected. Although there are no reports of working antibodies marking the basal domain in zebrafish, there is at least a Tg(myl7:MARCK3A-RFP) line published (Jimenez-Amilburu et al. (2016)) - which the authors can inject to examine the localization in mosaic hearts.

      We plan to assess localisation of aPKC (see section 4 for response to other suggested polarity protein analyses).

      2f) Have the authors quantified the numbers of total cardiomyocytes in llgl1 mutants to correlate how many cells are lost as a consequence of extrusion? What is the physiological impact of this extrusion (ejection fraction, total cardiac volumes, sarcomere organization)?

      We have some of this data already which we will include in the manuscript (cell number, myocardial volume). We agree that the analysis of cardiac function could be more extensive, and we will perform more detailed analysis of cardiac function, including e.g. ejection fraction. Sarcomere organisation has been previously described in llgl1 mutants by Flinn et al, 2020, so we do not plan to replicate this data.

      2g) The lamb1a and lamc1 mutant phenotypes were nicely analyzed. However, there is basement membrane deposition on both the apical and basal sides of the cardiomyocytes. Therefore, it is unclear whether the cardiomyocyte extrusion is completely caused by loss of apical basement membrane, or whether the loss of basal basement membrane could compromise the myocardial tissue integrity. The authors should clarify this conclusion in the text.

      We will address this further in the text, but will also include 55hpf Laminin staining data for llgl1 mutants to reinforce our message.

      2h) The authors note that Llgl1-mCherry in the Tg(myl7:Llg1-mCherry)sh679 line localizes to the basolateral domain of the cardiomyocytes, which is valuable confirmation that Llgl1 protein is spatially restricted. However, only 1 timepoint (55 hpf) is noted. It would be important to perform Llgl1 localization across different developmental timepoints (at least until 80 hpf) to examine the dynamics of this protein during trabeculation and apical extrusion, and potentially correlate it with Crb2a localization for a better understanding of the apicobasal machinery in cardiomyocytes.

      We already have some of this data and will include extra timepoints in a revised version of the manuscript

      2i) The phenotypes of llgl1 mutants described here differ compared to the previous study by Flinn et al. (2020). In particular, whereas the mutants generated in this study have only mild pericardial edema and are adult viable, approximately one third of llgl1mw3 (Flinn et al. (2020)) died at 6 dpf. Is this caused by the different natures of the mutations in the llgl1 gene? Is there a possibility that the llgl1sh598 is a hypomorphic allele since the targeted deletion is in a more downstream sequence (in exon 2) compared to the llgl1mw3 (deletion in exon 1) allele?

      We thank the reviewer for noticing these subtle differences between the two llgl1 mutants. Indeed, while we occasionally see llgl1sh598 mutants with the severe phenotype described by Flinn et al, this is a small minority which we did not quantify. Our mutation is indeed slightly further downstream than that described by Flinn et al, however we believe that this will have a neglible effect on Llgl1 function. Our llgl1sh589 mutation results in truncation shortly into the WD40 domain, and importantly completely lacks the Lgl-like domain, which is responsible for the specific function of Llgl1 likely through its ability to interact with SNAREs to regulate cargo delivery to membranes (Gangar et al, Current Biology 2005).

      Interestingly, Flinn et al report no increased phenotypic severity in their maternal-zygotic llgl1 mutants when compared to zygotic mutants. Conversely, we often observed very severe phenotypes in MZ llgl1sh589 mutants, including failure of embryos during blastula stages, apparently through poor blastula integrity. We did not include this information in the manuscript due to space constraints. However, we argue that together these differences between the two alleles may not be due to hypomorphism of our llgl1sh589 allele, but rather differences in genetic background that may amplify specific phenotypes. We plan to include a short sentence summarising the above in combination with planned experiments described below to address the reviewer’s next comment.

      2j) Suggested experiment: qPCR of regions downstream of the deletion to make sure that the transcript is absent/reduced in the llgl1sh598 mutants. Alternatively, immunostaining or Western blot would be an even better option to ensure there is no Llgl1 protein production - there is an anti-Llgl1 antibody available that works for Western blots in zebrafish (Clark et al. (2012)).

      We plan to analyse llgl1 expression in llgl1 mutants using qPCR.

      Reviewer 3

      3a) Major - the authors describe that llgl1 mutants exhibit transient cardiac edema at 3 dpf, which is resolved by 5 dpf, and claim that the mutants are viable. This statement needs to be better supported - What is the proportion of mutants that survive to adulthood? The embryonic phenotypes are pretty variable - are the mutants that survive the ones with a less severe phenotype? Is there a gross defect in the adult heart of these animals?

      In line with comments from Reviewers 1 and 2 above, we will include a description of the data we have from adult animals (historical data, not generation of new animals).

      3b) Major - Many of the phenotypes described here -most importantly, the defects on epicardial development- could result from hemodynamic defects in llgl1 mutants. The authors claim that function is unaffected in these animals, but this has only been addressed by measuring heartbeat. The observation that the cardiac function in these animals is normal would conflict with a previous description (PMID: 32843528) that demonstrates that llgl1 mutant animals show significant hemodynamic defects, which would cause epicardial defects. Thus, this aspect of the work needs to be better addressed.

      In line with our comments to point 2f) from Reviewer 2, we will perform a more in-depth functional analysis on llgl1 mutant larvae.

      3c) The phenotypes related to forming multiple layers in the heart (Fig. 1) could be more convincing. In some figures, the authors use a reporter that labels the myocardial cell membrane, but in Figure 1 this is not used. Showing a myocardial membrane marker (for example, the antibody Alcama, Zn-8) would significantly strengthen this observation.

      We will describe trabecular phenotypes in more detail using the suggested antibody to highlight membranes.

      3d) The analysis of Crumbs redistribution (Fig. 2) is quite interesting. Still, given that the authors have a transgenic model to rescue llgl1 expression in cardiomyocytes, they could move from correlative evidence to experimental demonstration of the role of llgl1 in Crumbs localization.

      Similar to our response to comment 2c) from Reviewer 2, we plan to address this

      3. Description of the revisions that have already been incorporated in the transferred manuscript

      Reviewer 1:

      Although information is provided in the introduction and discussion on the role of the Llgl1 homolog in Drosophila and speculation on LLGL1 contributing to heart defects in SMS patients in the discussion, have Llgl1 homologs been examined in other vertebrate animal models during heart development or regeneration?

      With the exception of the Flinn et al paper, we find no published studies assessing the role of Llgl1 in heart development or regeneration in other vertebrates, and have updated the introduction to highlight this fact:

      ‘Zebrafish have two Lgl homologues, llgl1 and llgl2, and llgl1 has previously been shown to be required for early stages of heart morphogenesis (Flinn et al. 2020). However, although Llgl1 expression has also been reported in the developing mouse heart and both adult mouse and human hearts (Uhlén et al. 2015; Klezovitch et al. 2004), whether llgl1 plays a role in ventricular wall development has not been examined.’

      In Fig. 4J-M', there is no Cav1 signals after wt1a MO but still laminin signals. Where these laminins come from?

      The residual laminin staining observed in wt1a morphants is located at the basal surface of cardiomyocytes (while the apical laminin signal is lost, in line with the epicardial deposition of laminin at the apical ventricle surface). This basal laminin is likely deposited earlier during heart tube development by either the myocardium, endocardium or both, and thus unaffected by later formation of the epicardium. We reason this since a) it is present at the basal cardiomyocyte surface at 55hpf (see Fig 2); b) we have previously identified both myocardial and endocardial expression of laminin subunits at 26hpf and 55hpf (Derrick et al, Development, 2021); c) sc-RNA-seq analysis of hearts at 48hpf demonstrates that laminin subunits, e.g. lamc1 are expressed in myocardial and endocardial cells (Nahia et al, bioRxiv, 2023), also in line with our previous ISH analysis. We have included a sentence to reflect this in the results section:

      Conversely, *wt1a* morphants retain deposition of laminin at the basal CM surface, likely from earlier expression and deposition of laminin by either myocardial or endocardial cells (Derrick et al. 2021; Nahia et al. 2023), which is unaffected by later epicardial development.

      On page 3 of the manuscript, Fig. 1A should be included with Fig. 1B in the first sentence of paragraph 2 of the Results subsection "Llgl1 regulates ventricular wall integrity and trabeculation".

      Amended

      It would be beneficial to readers to briefly describe what cell type the transgenic reporters label when mentioned in the Results section to help readers unfamiliar with zebrafish.

      We have updated the text to read:

      We further analysed heart morphology using live lightsheet microscopy of *Tg(myl7:LifeActGFP);Tg(fli1a:AC-TagRFP)* double transgenic wild-type and *llgl1* mutant embryos, allowing visualisation of myocardium (green) and endocardium (magenta) respectively. Comparative analysis of overall heart morphology between 55hpf and 120hpf when looping morphogenesis is complete, revealing that *llgl1* mutants continue to exhibit defects in heart morphogenesis (Fig S1S-X).

      Reviewer 3

      (Optional) There is laminin in the luminal side of the heart before there is any epicardial invasion. What is the source of this laminin? The techniques the authors have used (i.e., chromogenic ISH) are fine, but a more detailed analysis using fluorescent ISH (i.e., RNAScope) would be much more definitive.

      This is related to our response to Reviewer 1 (above) – where we have included the following text included in manuscript: Conversely, *wt1a* morphants retain deposition of laminin at the basal CM surface, likely from earlier expression and deposition of laminin by either myocardial or endocardial cells (Derrick et al. 2021; Nahia et al. 2023), which is unaffected by later epicardial development. We hope this clarifies our proposed origins for the earlier laminin deposition.

      4. Description of analyses that authors prefer not to carry out

      Reviewer 1:

      As pan-epicardial transgenes like tcf21 reporters have been widely used, the authors should use such reporters to verify the expression of laminin gene expression in epicardial cells, and the efficacy and efficiency of depleting epicardial cells after wt1 MO injection.

      Several studies have demonstrated that the epicardium is not a heterogeneous population – for example, tcf21 is not expressed in all epicardial cells and thus not a pan-epicardial reporter (Plavicki et al, BMC Dev Biol, 2014, Weinberger et al, Dev Cell, 2020) – the suggested analysis would not necessarily be conclusive, and more detailed study would require acquisition of three new transgenic lines. Furthermore, we believe the evidence we present in the paper supports our claim: 1) We show expression of two laminin subunits in a thin mesothelial layer directly adjacent to the myocardium, specifically in the location of the epicardium; 2) sc-RNA seq analyses have also identified laminin expression in epicardial cells at 72hpf (where lamc1a is identified as a marker of the epicardium); 3) We demonstrate 100% efficacy of our wt1a knockdown as assayed by Cav1 expression, an established epicardial marker (Grivas et al, 2020, Marques et al, 2022) which in sc-RNA seq data is expressed at high levels broadly in the epicardial cell population (Nahia et al, 2023), representing a good assay for presence of epicardium. However, we propose to perform ISH analysis of laminin subunit expression in wt1a MO to investigate whether the mesothelial laminin-expressing layer we observe adjacent to the myocardium is absent upon loss of wt1a.

      Reviewer 2:

      The data in this manuscript appears to point that Llgl1 regulates Laminin deposition mainly in epicardial cells to regulate their dissemination/migration across the ventricular myocardial surface. It would be important to test this cell-autonomous function with the transplant experiment (above point) and examine whether llgl1 mutant epicardial cells fail to migrate and deposit Laminin. It might be possible to perform a rescue experiment through overexpression of Llgl1 in epicardial cells (if possible, there is a tcf21:Gal4 line available).

      We do not propose to perform this experiment using a tcf21:Gal4 line, as this would likely require at least 6 months to either import and quarantine, or generate the necessary stable lines. Furthermore, as mentioned above, tcf21 is not a pan-epicardial marker, and the extent and timing of the Gal4:UAS system may make this challenging to determine whether llgl1 has been expressed early or broadly enough. We will instead attempt transplantation experiments.

      OPTIONAL: It might be worth testing other antibodies that could mark the apical (particularly aPKC which is known to phosphorylate and regulate the Crb complex) and basolateral domains (Par1, Dlg) of the cardiomyocytes to definitively conclude that the epithelial integrity of the cells is affected. Although there are no reports of working antibodies marking the basal domain in zebrafish, there is at least a Tg(myl7:MARCK3A-RFP) line published (Jimenez-Amilburu et al. (2016)) - which the authors can inject to examine the localization in mosaic hearts.

      We will assess localisation of aPKC, but we do not plan to analyse the other components. Analysis of basolateral domains (Par1, Dlg, Mark3a-RGP), will not necessarily assess epithelial integrity, as suggested, but rather apicobasal polarity – which we already assess using Crb2a, and additionally plan to assess aPKC to accompany the Crb2a analysis. Since the reviewer suggests this as an optional experiment we prioritise their other suggested experiments that we think more directly address the main messages of the manuscript.

      OPTIONAL: Gentile et al. (2021) found that reducing heartbeat led to decreased cardiomyocyte extrusion in snai1b mutants. The authors could look into the contribution of mechanical pressure through contraction in the apical cardiomyocyte extrusion, and test whether reducing contraction (tnnt2 morpholino, chemical treatments) partly rescues the llgl1 mutant phenotypes.

      The relationship between cardiac function and myocardial wall integrity appears to be complex. The paper referred to by the reviewer indeed finds that reduction in heartbeat leads to decreased CM extrusion upon loss of the EMT-factor Snai1b. Previous studies have also found that endothelial flow-responsive genes klf2a/b are required to maintain myocardial ventricular wall integrity at later stages in a contractility-dependent manner (Rasouli et al, 2018). However, contractility is also required early for pro-epicardial emergence, but plays a lesser role in expansion of the epicardial layer on the myocardial surface (Peralta, 2013). Unpicking the relationship between the forces induced by mechanical contraction of the ventricular wall, contractility-based induction of e.g klf2 expression, and the impact of contractile forces on proepicardial development or epicardial expansion will be complex. We therefore think the proposed experiment will be difficult to interpret whatever the outcome, and argue that dissecting this relationship is beyond the scope of revisions for this paper.

      Reviewer 3

      How llgl1 relates to epicardial biology is left entirely unexplored in this work. Do proepicardial cells show any defect in cell polarization related to llgl1 absence?

      We agree with the reviewer that we do not delve into the mechanisms underlying regulation of epicardial development by llgl1, and that this is an interesting question. Our scope for this manuscript was to understand the mechanisms by which llgl1 regulates integrity of the ventricular wall, and feel that uncovering the molecular mechanisms by which llgl1 regulates timely epicardial emergence is a larger question that would require substantial investigation (for example, if and when llgl1 PE cells do exhibit apicobasal defects, how this impacts timing of cluster release etc). We think these are important questions that would be better answered in detail in a separate manuscript.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      This manuscript from Pollitt and colleagues analyzes the role of lethal(2) giant larvae homolog 1 (llgl1) in cardiac development in zebrafish. Llgl1 has been previously involved in regulating epithelial polarity, which raises the possibility that this gene might play a role during the trabeculation of the zebrafish heart. To examine the role of llgl1 in this phenomenon, the authors generated a new loss of function mutant using CRISPR/Cas9. Animals lacking llgl1 initially exhibited abnormal cardiac development, manifested by defects in cardiac looping and pericardial edema. This phenotype, however, was transient. A detailed analysis of the developing heart showed, albeit with significant variability, defects in trabeculation and an interesting cardiomyocyte extrusion phenotype, described before in mutants that lack epicardium. During their analysis, the authors discovered a switch in the localization of the extracellular matrix protein laminin from the luminal to the apical side of the cardiomyocytes that temporally correlates with the process of trabeculation. The accumulation of laminin in the epicardial side was affected in llgl1 mutants, which also showed a defect in epicardial development. Coincidentally, the epicardial cells appear to be the primary source of laminin. This work suggests that llgl1 acts in epicardial cells to maintain ventricular wall integrity during heart development.

      Major Comments:

      1. Major - the authors describe that llgl1 mutants exhibit transient cardiac edema at 3 dpf, which is resolved by 5 dpf, and claim that the mutants are viable. This statement needs to be better supported - What is the proportion of mutants that survive to adulthood? The embryonic phenotypes are pretty variable - are the mutants that survive the ones with a less severe phenotype? Is there a gross defect in the adult heart of these animals?
      2. Major - Many of the phenotypes described here -most importantly, the defects on epicardial development- could result from hemodynamic defects in llgl1 mutants. The authors claim that function is unaffected in these animals, but this has only been addressed by measuring heartbeat. The observation that the cardiac function in these animals is normal would conflict with a previous description (PMID: 32843528) that demonstrates that llgl1 mutant animals show significant hemodynamic defects, which would cause epicardial defects. Thus, this aspect of the work needs to be better addressed.
      3. The phenotypes related to forming multiple layers in the heart (Fig. 1) could be more convincing. In some figures, the authors use a reporter that labels the myocardial cell membrane, but in Figure 1 this is not used. Showing a myocardial membrane marker (for example, the antibody Alcama, Zn-8) would significantly strengthen this observation.
      4. The analysis of Crumbs redistribution (Fig. 2) is quite interesting. Still, given that the authors have a transgenic model to rescue llgl1 expression in cardiomyocytes, they could move from correlative evidence to experimental demonstration of the role of llgl1 in Crumbs localization.
      5. (Optional) There is laminin in the luminal side of the heart before there is any epicardial invasion. What is the source of this laminin? The techniques the authors have used (i.e., chromogenic ISH) are fine, but a more detailed analysis using fluorescent ISH (i.e., RNAScope) would be much more definitive.
      6. How llgl1 relates to epicardial biology is left entirely unexplored in this work. Do proepicardial cells show any defect in cell polarization related to llgl1 absence?

      Significance

      General Assessment. Overall, this is an interesting manuscript put together with rigor. The strongest aspect of this work is the discovery of a switch in the localization of laminin in the developing heart and the potential implications of this process in regulating correct trabeculation versus cardiomyocyte extrusion. Although the text itself is very well written, with clear statements of the hypotheses and the findings that led the authors to each experiment, I found myself wondering what the unifying theme and central message of the manuscript is and whether this has been appropriately supported with experimental data. Specifically, although the authors included a very detailed analysis of the myocardium, their results (including the last supplementary figure) suggest that these phenotypes might be secondary to a defect in epicardial development. Still, it is entirely unclear how the loss of llgl1 would affect epicardial development.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary: The manuscript by Pollitt et al. explores the functions of llgl1, which encodes a critical component of the basolateral domain complex, during cardiac development in zebrafish. The authors observed that llgl1 mutants exhibited compromised myocardial tissue integrity with significantly higher numbers of apically extruding cardiomyocytes. Llgl1 appears to primarily function during epicardial cell spreading on the myocardial tissue, as myocardial-specific overexpression of llgl1 did not rescue llgl1 mutant phenotypes. llgl1 mutants exhibited impaired epicardial coverage and subsequently Laminin deposition on the apical side of the cardiomyocytes. Functional linkage between Laminin/the basement membrane was identified, as extruding cardiomyocytes were also observed in mutants of two core laminin genes, lamb1a and lamc1. The epicardial defects were transmitted to myocardial tissue defects, marked by mis-localization of the apical polarity protein Crumbs2a during early heart development. Overall, the authors provide a nice study that strengthens the role of apicobasal factors in myocardial tissue morphogenesis and that sheds light on the role of epicardial-derived basement membrane in maintaining myocardial tissue integrity.

      Major comments

      • The authors note an interesting observation with apical and basal laminin deposition dynamics surrounding cardiomyocytes, and that Llg1 has a role in apical Laminin deposition (however, highly variable at 80 hpf as Figure 3M shows). They carry out a very nice study in which they overexpress Llgl1 tagged with mCherry in the myocardium and show that there is no rescue of the extruding cardiomyocyte defect or Laminin deposition. However, there is still a possibility that the tagged Llgl1 in the transgene Tg(myl7:Llg1-mCherry)sh679 might not be functional due to improper protein folding or interference by the mCherry tag. The authors should supplement their approach with a transplantation experiment to generate mosaic llgl1 mutant animals and assess whether llgl1 mutant cardiomyocytes extrude at a higher rate than the control. This would provide definitive evidence that Llg1l acts in a cell non-autonomous manner.
      • The data in this manuscript appears to point that Llgl1 regulates Laminin deposition mainly in epicardial cells to regulate their dissemination/migration across the ventricular myocardial surface. It would be important to test this cell-autonomous function with the transplant experiment (above point) and examine whether llgl1 mutant epicardial cells fail to migrate and deposit Laminin. It might be possible to perform a rescue experiment through overexpression of Llgl1 in epicardial cells (if possible, there is a tcf21:Gal4 line available).
      • In the Discussion, the authors propose that Llgl1 acts in two ways: Laminin deposition in epicardial cells that suppress cell extrusion and polarity regulation in cardiomyocytes to promote trabeculation. It would be important to test the second hypothesis on trabeculation and polarity regulation by using the myocardial-specific overexpression/rescue of Llgl1 in llgl1 mutants, and then quantifying the trabeculating cardiomyocytes and analyze Crb2a localization. This experiment can distinguish whether this trabeculation phenotype is rescued independently of the apical Laminin deposition that has been included in Figure S5.
      • The potential mis-localization of Crb2a in the llgl1 mutants is interesting, but this effect appears to be quite mild, and as the authors note, resolve by 80 hpf. Considering the role of Lgl in Drosophila in shifting Crb complex localization during early epithelial morphogenesis, it would be worth performing the analysis at earlier timepoints (between 55 and 72 hpf) to determine whether Llgl1 is indeed important for the progressive apical relocalization of Crb2a. OPTIONAL: It might be worth testing other antibodies that could mark the apical (particularly aPKC which is known to phosphorylate and regulate the Crb complex) and basolateral domains (Par1, Dlg) of the cardiomyocytes to definitively conclude that the epithelial integrity of the cells is affected. Although there are no reports of working antibodies marking the basal domain in zebrafish, there is at least a Tg(myl7:MARCK3A-RFP) line published (Jimenez-Amilburu et al. (2016)) - which the authors can inject to examine the localization in mosaic hearts.
      • Have the authors quantified the numbers of total cardiomyocytes in llgl1 mutants to correlate how many cells are lost as a consequence of extrusion? What is the physiological impact of this extrusion (ejection fraction, total cardiac volumes, sarcomere organization)?
      • The lamb1a and lamc1 mutant phenotypes were nicely analyzed. However, there is basement membrane deposition on both the apical and basal sides of the cardiomyocytes. Therefore, it is unclear whether the cardiomyocyte extrusion is completely caused by loss of apical basement membrane, or whether the loss of basal basement membrane could compromise the myocardial tissue integrity. The authors should clarify this conclusion in the text.

      Minor comments

      • The authors note that Llgl1-mCherry in the Tg(myl7:Llg1-mCherry)sh679 line localizes to the basolateral domain of the cardiomyocytes, which is valuable confirmation that Llgl1 protein is spatially restricted. However, only 1 timepoint (55 hpf) is noted. It would be important to perform Llgl1 localization across different developmental timepoints (at least until 80 hpf) to examine the dynamics of this protein during trabeculation and apical extrusion, and potentially correlate it with Crb2a localization for a better understanding of the apicobasal machinery in cardiomyocytes.
      • The phenotypes of llgl1 mutants described here differ compared to the previous study by Flinn et al. (2020). In particular, whereas the mutants generated in this study have only mild pericardial edema and are adult viable, approximately one third of llgl1mw3 (Flinn et al. (2020)) died at 6 dpf. Is this caused by the different natures of the mutations in the llgl1 gene? Is there a possibility that the llgl1sh598 is a hypomorphic allele since the targeted deletion is in a more downstream sequence (in exon 2) compared to the llgl1mw3 (deletion in exon 1) allele? Suggested experiment: qPCR of regions downstream of the deletion to make sure that the transcript is absent/reduced in the llgl1sh598 mutants. Alternatively, immunostaining or Western blot would be an even better option to ensure there is no Llgl1 protein production - there is an anti-Llgl1 antibody available that works for Western blots in zebrafish (Clark et al. (2012)).
      • Closeups needed for Figure 3I-L' - difficult to assess mis-localization or differences in Laminin staining. Contrary to the quantification or conclusion, the Laminin staining appears stronger in llgl1 mutants compared to wild types in Figure 3I' and J'.
      • OPTIONAL: Gentile et al. (2021) found that reducing heartbeat led to decreased cardiomyocyte extrusion in snai1b mutants. The authors could look into the contribution of mechanical pressure through contraction in the apical cardiomyocyte extrusion, and test whether reducing contraction (tnnt2 morpholino, chemical treatments) partly rescues the llgl1 mutant phenotypes.

      Significance

      As someone with expertise in cardiac development and cellular behaviours, I find this study provides strong and convincing quantitative data on the role of Llgl1 in suppressing cardiomyocyte extrusion and promoting epicardial dissemination on the ventricular surface. The genetic experiments, including mutant analysis and myocardial-specific rescue, were carefully performed in a region-specific manner, which provides much insight into the non-uniformity of myocardial tissue integrity. The generation of Tg(myl7:llgl1-mCherry) line is also a valuable tool for researchers in the field interested in understanding apicobasal polarity and cardiomyocyte development and regeneration.

      A limitation of the study is the unclear link between epithelial polarity and basement membrane deposition, and how they synchronize to regulate cardiomyocyte integrity. The llgl1 mutant phenotype in increasing cardiomyocyte apical extrusion and Crb2 localization is interesting; however, the authors note that this appears to be a phenotype induced by epicardial defects. Epicardial cells are not known to exhibit apicobasal polarity and are fibroblastic by nature. Thus, the cellular mechanisms by which Llg1 regulates epicardial cell morphology or behaviours, and how it functions to regulate polarity in cardiomyocytes are not clearly defined in this work. In addition, clarification of the cell autonomous functions of Llgl1 in epicardial cells and/or cardiomyocytes would strengthen the findings.

      Overall, the findings of this study would be of interest to cell and developmental biologists in the fields of epithelial polarity, cardiac morphogenesis, and extracellular matrix function. It provides nice conceptual advance in further elucidating the mechanisms that underlie myocardial tissue integrity and epicardial-myocardial interactions.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Pollitt et al. investigated the role of Llgl1 in maturation of the ventricular wall in zebrafish. They examined zebrafish heart morphology with microscopy analysis of fluorescent reporter lines crossed with their CRISPR/Cas9 llgl1 line and observed apically extruding CMs in llgl1 mutant embryos, implicating a role for llgl1 in ventricular wall integrity. Further, they examined apicobasal polarity in the ventricular wall through quantification of Crb2a distribution at the apical membrane surface, with enhanced Crb2a retention at CM junctions in llgl1 mutant embryos in comparison to WT at 72 hpf but similar levels at 80 hpf. Further analyses indicated a requirement for llgl1 for the temporal establishment of the apical laminin sheath, llgl1 is required for the timely dissemination of epicardial cells which deposit laminin to maintain the integrity of the ventricular wall. This work is written well and provides new information on heart development in zebrafish, and provides additional information on the role of the epicardium in supporting the integrity of the ventricular wall during trabeculation.

      Major:

      1. Although information is provided in the introduction and discussion on the role of the Llgl1 homolog in Drosophila and speculation on LLGL1 contributing to heart defects in SMS patients in the discussion, have Llgl1 homologs been examined in other vertebrate animal models during heart development or regeneration?
      2. In Fig. 3I-O: The authors described the spatial dynamics of laminin in llgl1 mutants at 72 and 80m hpf. However, it is hard to say the schematic depicting of laminin for llg1 mutant in Fig. 3O reflect the real laminin staining signals in Fig. 3J' and 3L'.
      3. It is mentioned that llgl1 CRISPR/Cas9 mutants are viable as adults on pg. 3 of the Results section. Have the authors examined heart morphology in these mutants in juvenile or adult fish?
      4. In Fig. 4J-M', there is no Cav1 signals after wt1a MO but still laminin signals. Where these laminins come from?
      5. As pan-epicardial transgenes like tcf21 reporters have been widely used, the authors should use such reporters to verify the expression of laminin gene expression in epicardial cells, and the efficacy and efficiency of depleting epicardial cells after wt1 MO injection.

      Minor:

      1. On page 3 of the manuscript, Fig. 1A should be included with Fig. 1B in the first sentence of paragraph 2 of the Results subsection "Llgl1 regulates ventricular wall integrity and trabeculation".
      2. Fig. 2E: Is Fig. 2E from WT or llgl1 embryos? This information isn't indicated in the image panels or the figure legend. It might also be beneficial to include a similar representative image for the WT or llgl1 mutant embryo as this was used for quantification.
      3. Fig. 3G: As the entirety of Fig. 3 used violet coloring to depict Laminin, it would be more consistent to change the blue coloring used to depict Laminin in panel G to the same violet coloring used for Laminin in the other panels of Fig. 3.
      4. It would be beneficial to readers to briefly describe what cell type the transgenic reporters label when mentioned in the Results section to help readers unfamiliar with zebrafish.

      Significance

      This work is written well and provides new information on heart development in zebrafish, and provides additional information on the role of the epicardium in supporting the integrity of the ventricular wall during trabeculation.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary:

      In this paper, Hama et al look to address ongoing questions regarding the recruitment of core autophagy factors to protein aggregates during aggrephagy. Using cells that lack all known aggrephagy receptors (PentaKO HeLa cells) provides the authors with a 'blank canvas' with which to cleanly dissect a process otherwise fraught with mechanistic redundancy. By this approach, the authors isolate a previously unidentified mechanism by which TAX1BP1 recruits ATG9A vesicles to ubiquitin-positive aggregates. Using mass spectrometry, the authors identify SCAMP3 as a component of ATG9 vesicles that is responsible for recruiting the vesicles to cargo. Moreover, they provide additional mechanistic insight through the subsequent identification and mutagenesis of a putative interaction interface between TAX1BP1 and SCAMP3.

      Major comments:

      1. Statistics:
        • a) The description of the statistical methods is sparse. In the methods section, the authors' state that statistical methods are described in each figure legend. However, for most figures they were excluded.
        • b) Where statistics are discussed, Mann-Whitney was used. However, this appears to be the incorrect test in many cases. Per GraphPad (the author's preferred statistical package) "Use Mann-Whitney test only to compare two groups. To compare three or more groups, use the Kruskal-Wallis test followed by post tests. It is not appropriate to perform several Mann-Whitney (or t) tests, comparing two groups at a time."
      2. Rigor and reproducibility - The authors report n=~30 cells in most experiments. However, it's unclear if these 30 cells represent more than a single experimental replicate. While the trends in the data are quite convincing, this a significant limitation of this study.
      3. Puncta identification - it's unclear how the authors called puncta. The quantification of these images (i.e. the box and whiskers plots) makes compelling points that support the authors' interpretation. However, in many cases the authors are calling puncta amidst a fairly speckled image. How were puncta distinguished from speckles? When did something rise to the level of a puntum? If it was computationally called, please provide the methods and pipeline. If data were manually scored, then the lack of replicates rises to a more significant concern - would other investigators have scored the data similarly? Is it possible that the data were scored with implicit bias based on expected outcomes of the investigator? Where data scored in a blinded fashion?
      4. Do the findings presented here have functional implications? While the data on recruitment of ATG9A to TAX1BP1 is clear, it's unclear whether the SCAMP3/TAX1BP1 interaction is functionally important for lysosomal delivery of cargo. In part, this is because the authors must work in autophagy-deficient cells (ATG9AKO or FIP200KO) to observed many of their effects. One way to address function might be to ask whether lysosomal delivery of TAX1BP1 is affected upon SCAMP3KO (e.g. in PentaKO cells to remove the effects of other receptors).

      Minor comments:

      1. The authors IP TAX1BP1CC1 and SCAMP3, but an IP between full length TAX1BP1 (WT and K248E) and SCAMP3 would more fully demonstrate the sufficiency of this binding site.
      2. Optional: Is the TAX1BP1 and SCAMP3 interaction direct?. The data are suggestive, but this question is not fully resolved due to the in vivo nature of the assays. Formally, there could be an adapter that facilitates TAX1BP1/SCAMP3 interaction. This could be formalized by testing binding between purified soluble domains of SCAMP3 and TAX1BP1CC1.
      3. Figure 4F - the y axis has a typographical error

      Significance

      This is a crisply written manuscript with a generally clean experimental approach. While there are many directions the authors could take this work in the future, the data largely stand on their own as a short, concise advance. The work adds to our current understanding of the regulation of ATG9A recruitment during selective autophagy, which is under-explored in comparison to starvation-induced autophagy. Mechanistic insights are provided in the form of a new interacting protein SCAMP3, which is present in ATG9A vesicles and is required for the recruitment of ATG9A vesicles to TAX1BP1. The data are predominantly convincing, albeit with significant caveats. Limited sample sizes and lack of functional effects (see 'major concerns') limit the impact of this work. However, the data have merit on their own. This is a specialized study that will be appreciated by those interested in selective autophagy and the mechanism of autophagosome formation.

      Reviewer expertise: selective autophagy and autophagosome formation

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Ubiquitin-binding adaptors are a group of autophagy adaptor proteins that facilitates the formation of isolating membrane around a specific substrate during selective autophagy. At least two ubiquitin-binding adaptors, NBR1 and OPTN, have previously been demonstrated to recruit ATG9-positive vesicles to ubiquitin-positive biomolecular condensates. It is postulated that this recruitment mediates the formation of the isolating membrane around the ubiquitinated biomolecular condensates. In this manuscript, the authors utilized the HeLa cells deficient in the expression of five ubiquitin-binding adaptors, p62, NBR1, OPTN, NDP52 and TAX1BP1, to show that expressing TAX1BP1 colocalizes with ATG9A. The authors interpreted this observation to suggest that TAX1BP1 can recruit ATG9A vesicles independent of other adaptors. Interestingly, the TAX1BP1 positive structures differ from that of OPTN and NBR1 because they do not contain ubiquitin, suggesting a difference in substrate specificity. They further show that TAX1BP1 differs from OPTN and NBR1 because ATG9 recruitment required SCAMP3 to recruit ATG9A. Based on these observations, the authors propose that TAX1BP1 recruits ATG9A via SCAMP3.

      Major comments

      • The work presented in this manuscript is of high quality, however, the reliance on a single experimental assay (colocalization microscopy studies) limits the relevance of its findings. The conclusions are based on colocalization studies in wild-type and CRISPR/cas9 knockout HeLa cell lines. Therefore, it is not certain that their findings are restricted to these PentaKO cell lines. Given that these adaptors are required for selective autophagy, the pentaKO cells may have adapted. Unfortunately, the current study lacks additional systems physiologically relevant models or systems. Such experiments are needed to validate their findings in the HeLa pentaKO cell. (Optional) Alternatively, identify the substrate(s) specific to the TAX1BP1-SCAMP3-ATG9A mediated autophagosome vs. that of NBR1 and/or OPTN in these cell lines.
      • There are several issues with the immunofluorescence data throughout the manuscript. For example, in Figure 1C, the authors quantify 30 cells per condition and perform a Mann-Whitney test, presumably using each cell as a data point, as this is not specified in the legend. There are two problems with this approach, the first being there is only one indicated independent trial performed, and the second that treating each cell as a data point for statistical analysis overinflates the power. These experiments should instead be performed across at least 3 independent trials (especially given the wide range of values seen in some conditions such as Fig. 2b) with 30 cells counted per trial, and statistical analysis should be performed using the means from each trial. See Lord, S.J. et al. (JCB 2020, PMID: 32346721) for a detailed explanation. Further, how each statistical test is performed (using means vs. all points) and the number of independent trials conducted should be communicated in the figure captions. Finally, beyond Fig. 1, the statistical test used is not reported. If a Mann-Whitney test was used for all statistical analyses, this should be revisited as with two or more variables (cell type, treatment, etc.), this is not the appropriate test.

      Minor Points

      • The experimental design rationale is not clear throughout the manuscript. For example, why FIP200 KO cells are used in Fig. 3c and Fig. 4 is not apparent, and only in Fig. 6 (Lines 211-213) is it clearly stated. The authors should revisit the results section and ensure the experimental rationale is clearly explained.
      • It is curious that condensates formed in muGFP-NDP52 and muGFP-TAX1BP1 cells lack ubiquitin (Fig. 3c). Is this image representative of most cells? if so it should be discussed.
      • The authors are missing some relevant citations:
        • Lines 57-58, the authors may consider citing more recent literature (Olivas, T.J. et al., JCB 2023; Broadbent, D.G. et al., JCB 2023; Nguyen, A. et al., Mol Cell 2023) investigating ATG9 vesicles in autophagosome biogenesis.
        • In lines 58-66, the authors do not mention that NBR1 was also shown to bind FIP200 (Turco, E. et al., Nat Communications 2021, PMID: 34471133).
      • Some minor changes are recommended for clarity:
        • In lines 106-110, the authors may consider explaining that "growing" conditions are cells grown in regular culture conditions, as it is a bit unclear whether these cells are treated with a drug, etc., to induce p62-condensate formation. Something as simple as "...p62-double-positive structures under normal culture conditions, hereafter referred to as growing conditions," would help the reader.
        • The general axis labelling of "Ubiquitin-positive rate of FIP200 puncta (%)" (Fig 1D) is confusing wording. The authors may consider changing to "% of ubiquitin-positive FIP200 puncta" for readability.
        • The axis title in Fig. 4F has a typo.
      • Several figure legends include data interpretation, which should generally be excluded from figure legends. For example, the first line of Fig. 4B should be removed.
      • The authors may consider how ATG9A is recruited to ubiquitin-independent selective autophagy cargoes that are degraded independently of NBR1, p62, OPTN, NDP52, and TAX1BP1 in their discussion.
      • Supplementary figure S2-right side blot. For best practice in publications, I encourage the authors to provide a single blot of FIP200, ATG13, and ATG9A immunoblot for Penta KO and its KO derivatives. Presently, the blot appears to have been spliced together

      Significance

      Although different ubiquitin-binding adaptor proteins have been shown to have some substrate specificity, how they mediate the selective degradation of a substrate remains unclear. This manuscript provides evidence that TAX1BP1, like NBR1 and OPTN, can also recruit ATG9A positive structures independent of the autophagosome initiation complex ULK1-complex. However, they do show that the mechanism of ATG9A vesicles differs from the other two adaptors in that it requires SCAMP3, a membrane protein found in endosomes. The data provided by the authors are of high quality. However, the study relies on only one experimental system/assay, which limits the relevance of its findings and could benefit from testing these findings using additional systems and/or physiologically relevant models, as well as increasing the rigor of the quantitative analysis.

      Besides these two major shortcomings, the finding is novel and adds to our current understanding of autophagy adaptor proteins. The difference in the mechanism of ATG9 vesicles compared to NBR1 and OPTN may contribute to the selective nature of these autophagy adaptors.

      This manuscript is most appropriate for specialized basic researchers in the field of selective autophagy.

      Our expertise is in selective autophagy regulation and substrate selectivity of selective autophagy.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Macroautophagy is a catabolic pathway for various intracellular components mediated by the formation of autophagosomes followed by lysosomal degradation. ATG9 vesicles provide the initial autophagosomal membrane source and thereby recruitment of ATG9 vesicles to the autophagosome formation sites serves as a critical step for autophagy induction. However, the precise molecular mechanism of the ATG9A recruitment is not fully understood. In this study, Hama et al. report two distinct pathways; ULK complex-dependent ATG9 vesicle recruitment during starvation-induced autophagy, and selective autophagy receptor TAX1BP1-dependent ATG9 vesicle trafficking through the binding to SCAMP3, which was identified as an ATG9 vesicle component by the authors. Unfortunately, the authors were unable to demonstrate the impact of the TAX1BP1-SCAMP3-ATG9 vesicle axis on cellular physiology, presumably due to the existence of compensatory mechanisms mediated by other selective autophagy receptors and ULK complex, which limits the impact of the findings presented. Having said that, the study is technically well executed and provides a new insight into the regulation of cargo/receptor-mediated ATG9 vesicle recruitment. This reviewer has a few comments that should be addressed to strengthen the authors' conclusions.

      1. In the Co-IP experiments (Fig 5A-C), binding of TAX1BP1 to SCAMP3 is assessed by using the CC1 domain fraction of TAX1BP1, which may yield an artificial binding to SCAMP3. Could the authors confirm binding of full length TAX1BP1 wild-type and K248E mutant to SCAMP3?
      2. In Fig 5D, the authors showed that SCAMP3 localises to immuno-isolated ATG9A-positive vesicles. Is it a direct interaction between the two proteins? Could the authors provide the evidence that the interaction is retained in the presence of a detergent by immunoprecipitation? If the interaction is indirect, can the authors discuss candidate proteins that mediate binding of SCAMP3 to ATG9 vesicles?
      3. Related to the comment #2, it is interesting that the knockout of ATG9A does not affect SCAMP3-positive "ATG9 vesicle" formation. What is the nature of "ATG9 vesicles" lacking ATG9A?
      4. Could the authors confirm that K284E mutation in TAX1BP1 abrogates the localisation of SCAMP3 to the TAX1BP1 condensates as in Fig 6E? This will reinforce the claim that TAX1BP1 binding to SCAMP3 facilitates ATG9 vesicle recruitment.
      5. Could the authors discuss the potential reasons differentiating TAX1BP1 from other CC-domain containing autophagy receptor proteins (NDP52, OPTN and NBR1), which enables it to bind to SCAMP3. For instance, does TAX1BP1 have charged residues facing outwards in its CC domain that could be responsible for this specificity?
      6. In Fig 3C and 6E, no colocalisation of TAX1BP1 and ubiquitin was observed in TAX1BP1 condensates. In the context of "cargo-driven recruitment" of ATG9 vesicles, what cellular component(s) could trigger TAX1BP1-mediated SCAMP3/ATG9 vesicle recruitment? In the Discussion, authors mentioned that ferritin-NCOA4 was not the target of the TAX1BP1-SCAMP3 axis. Could the authors test if any of the other known TAX1BP1 cargo proteins localise to TAX1BP1 condensates in Penta KO/FIP200 KO/muGFP-TAX1BP1 cells?

      Minor:

      1. Fig 4F: Typo in y axis.

      Significance

      General assessment: provide a summary of the strengths and limitations of the study. What are the strongest and most important aspects? What aspects of the study should be improved or could be developed?

      The main finding of the study is a new pathway of ATG9 vesicle recruitment through the interaction of TAX1BP1 with SCAMP3, which provides a novel insight into molecular mechanisms of autophagosome biogenesis. However, the axis is implied to be redundant for functional autophagy in wild-type cells, and lack of data providing a biological function of the axis in cellular physiology will limit impact attracting broader readers outside of molecular mechanism of autophagy.

      Advance: compare the study to the closest related results in the literature or highlight results reported for the first time to your knowledge; does the study extend the knowledge in the field and in which way? Describe the nature of the advance and the resulting insights (for example: conceptual, technical, clinical, mechanistic, functional,...).

      Interaction between ATG9A and selective autophagy receptors OPTN and NBR1 has been reported (doi: 10.1083/jcb.201912144; 10.15252/embr.201948902). This study provides an additional mechanistic insight into the regulation of ATG9 vesicle recruitment through another autophagy receptor TAX1BP1 interacting with SCAMP3 which was newly identified as an ATG9 vesicle component in this study. Given the predominant functions of ATG9A in TNF cytotoxicity and plasma membrane integrity as well as TAX1BP1 in neuronal proteostasis and iron homeostasis (doi: 10.1126/science.add6967; 10.1038/s41556-021-00706-w; 10.1016/j.molcel.2020.10.041; 10.15252/embr.202154278), the interaction between TAX1BP1 and ATG9A would potentially have uncovered but important role in mammals. Autophagy-independent lysosomal degradation regulated via ULK component, ATG9 and TAX1BP1 might be related in this context (10.1016/j.celrep.2017.08.034).

      Audience: describe the type of audience ("specialized", "broad", "basic research", "translational/clinical", etc...) that will be interested or influenced by this research; how will this research be used by others; will it be of interest beyond the specific field?

      This study will be of interest to the basic researchers working on molecular and structural mechanisms of bulk and selective macroautophagy. Unfortunately, the lack of data demonstrating the relevance of the findings for cellular physiology will limit the impact on researchers in broader fields such as pathology and drug discovery.

      Please define your field of expertise with a few keywords to help the authors contextualize your point of view. Indicate if there are any parts of the paper that you do not have sufficient expertise to evaluate.

      Molecular cell biology of autophagy; neurodegenerative and lysosomal storage disorders.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary:

      The article describes a study on two effector nucleases, V2c and V2a, encoded by the T6SS cluster in Agrobacterium tumefaciens 1D1609. The study shows that V2c is a DNase belonging to the Tox-SHH clade of His-Me finger superfamily, exhibiting DNase activity in vivo and in vitro. The SHH and HNH motif of V2c were found to be involved in DNase activity. The study also demonstrates that V2c induces DNA degradation and cell elongation, which can be neutralized by its cognate immunity protein V3c. Furthermore, V2a, also exhibits DNase activity-dependent cell elongation phenotype. Both V2a and V2c nucleases function synergistically for antibacterial activity against Dickeya dadantii, resulting in elongated and lysed cells. The study suggests that 1D1609 uses V2a and V2c DNase effectors with synergistic antibacterial activity against Dickeya dadantii.

      Major issues:

      1. The cell elongation phenotype was an important focus of the paper and the authors did a solid job quantifying this phenotype. However, cell elongation does not seem to be associated with the mechanism of toxicity. Just a small part of the cells are elongated while you have more than one log of killing (Figure 5C and 5D).<br /> Many stresses can result in cell elongation, such as cell-wall targeting antibiotics. The signal narrows down to the very well-known mechanism of SulA activated by SOS response. There is no evidence "cell elongation independent of nuclease activity may represent a new mechanism of stress response #339". I strongly suggest the authors to use an SOS like pPrecA-gfp from ref 17 if they want to invest in the cell elongation phenotype. As it is, cell elongation is a distraction from the most exciting things in the manuscript. One potential hypothesis is that the catalytic mutants may bind DNA without cleaving, and while bound to the DNA, the mutants may interfere with DNA metabolism, replications, transcription, etc... This interference could create breaks in the DNA and cause cell wall elongation.
      2. The manuscript does not have biological replicates in many experiments. At first glance, the tiny error bars in many graphs raised a red flag. It is very difficult, if not impossible, to have the date so tight when working with bacterial cultures. Many of these graphs have "independent experiments", but in Fig 5 the authors mention " 6 repeats from three independent experiments". My understanding is that the independent experiments are from the same cultures, which makes them technical and not biological replicates. The authors need to have replicates from independent cultures. I ask the authors to explain better what they mean by replicates and their rationale.

      Minor issues:

      1. Many figures have all the data with conditions with and without arabinose. This makes the figure very polluted and difficult to follow. I suggest the authors keep only the data from induced cultures and move the figures with all the data to supplement. This is a big issue with Fig 3
      2. The entire "V2c V2a nucleases function synergistically for antibacterial activity against the soft rot phytopathogen, Dickeya dadantii" #212 section is difficult to follow because the name of the toxins are not in the name of the strains. The reader should be able to associate the toxin with the strain.
      3. The in vitro essay #427 should have information about the amount of enzyme used.
      4. The competition essay #474 method does not have enough information to allow reproducibility and must be expanded.
      5. Figure 2B Y-axis needs one log increase between marks, and not two.
      6. 256 is difficult to understand and not very scientific. DNses are potent because they target essential molecules, the same for lipases and muramidases. This is not related to the origin of life.

      Significance

      Strengths:

      Data is clear about the toxicity and DNA degradation phenotypes The synergy of toxins is a very exciting topic; it helps to explain why some strains have redundant toxins

      Weakness:

      Cell elongation claims are not supported Replicates are inadequate Methods needs to be more specific

      The manuscript provides incremental data about bacteria-to-bacteria toxins. The major finding of predicted nuclease acting as nuclease toxins is not particularly innovative. This work will benefit a smaller audience in the field of toxins.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Santos et al demonstrate the activity and confirm predictions of the mechanism of action of SHH nuclease toxin encoded in auxiliary T6SS cluster of Agrobacterium tumefaciens. Study includes demonstration of nuclease activity in vitro and its manifestation in vivo, mutational analysis of the predicted catalytic site, and assessment of its role in inter-bacterial competition using strains deleted for the T6SS effector(s).

      Major comments: major issues affecting the conclusions

      Lines 159 and further - I am not sure that large deletion as an entire region between residues 380-409 is a very healthy approach. Without showing that such protein can be produced and fold, it can be very risky to draw any conclusions. While expression of other mutants are shown in Figure 2D, this construct is not included. Also, it is not clear (starting from line 160) what is the utility of double catalytic mutant if single mutants are already inactive. Was there residual activity of single mutants after all?

      Line 187 and Figure 3 - cell elongation of CR mutant and HAHA mutant seems to be independent of expression of the construct. It is therefore incorrect to write that "E. coli expressing ...", since theoretically it should not express anything in the absence of arabinose. Also, how do would authors interpret these findings? Again, at Line 211 - in the same paragraph authors say "V2c shows DNase activity-independent cell elongation" and then conclude "cell elongation phenotype may be specific to toxicity of nuclease effectors". These two phrases seem to contradict each other.

      Line 272 on - authors speculate about dependency on the metals, which is a hallmark of the his-me finger nucleases. A simple test could have been adding the EDTA control to chelate the metal in the in vitro experiment such as one presented in figure 2D. (OPTIONAL)

      Minor comments

      Figure 1 - Auxiliary cluster with accession numbers, in addition to the domain composition of the toxin could be demonstrated. This would help the readers to identify which effector is studied and link it to other studies.

      Line 127 and Figure 1 C and line 303 - the last option, named "FIX RhsA AHH HNH-like" seems to be a mix of multiple things, First, FIX domain is already included as a first option; AHH HNH-like corresponds to toxic domain (although it often ends up in annotation of the entire protein). All His-Me finger nucleases at some point were annotated as HNH-like and thus HNH, AHH, SHH, ... all belong to the same clade of nuclease domains; RhsA is probably a correct domain/protein detected here and to be represented here as a separate option. I would call it "Rhs", not RhsA, since RhsA,B,C,... is part of an historical systematics from E.coli, but is probably true for one strain only, since Rhs ends (C-terminal toxic domains) are highly variable between species and even strains. To my knowledge, Rhs do encode AHH-like domains and quite often. In conclusion, this is just a mess of protein naming that was picked up from databases, I would correct this name for "Rhs".

      Line 181-182 - text is speaking about v2c H383A v2c H384A, but in figure 3, it is v2c HAHA. It might be just naming differences, but it should be consistent.

      Line 246 - expression "detoxify D. dadantii" is unclear and a little confusing here, did authors mean kill or eliminate?

      Line 263 - "that consisting of" should be "that comprise" or "that possess"

      Referees cross-commenting

      I agree with the reviewer #1 that the text could be improved by better explaining the nomenclature, and reasoning behind certain experiments such as choice of prey cells. Regarding the novelty, to my opinion it is a choice of authors - either limit their study as it is now and it does not stand out by neither approach nor subject, or as suggested by the reviewers explore the mode of action, specificity and the reason behind the cell filamentation.

      I agree with the reviewer #3 that the cell elongation seems to be central interest but it is not investigated properly. I do think, that the SOS reporter would strengthen the study and would help to support (or not) some of the statements. I appreciate the scrutiny of reviewer #3 and I agree that the replicates seem to have extremely low variation and authors should provide precise explication on the reproducibility.

      Overall, I agree with the two other reviewers that the weakness of this manuscript is lack of innovation and to some extent lack of support for certain claims. The study could be improved by making it more profound, but a lot of additional work will be needed to bring it to another level.

      Significance

      Overall, this study is rather detailed, but not very novel - SHH and other HNH nucleases have been already assessed in literature using very similar methods, even by the same authors (Santos et al., Front Microbiol 2020). On the other hand, the study presents in depth investigation of auxiliary toxin, but shows that it is fully functional and has a role in killing, which is important and interesting for the field of Agrobacterium.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      This study characterised one of the four previously identified T6SS effectors of Agrobacterium tumefaciens strain 1D1609. The effector, named V2c, is a His-Me finger nuclease likewise the previously characterised V2a, although V2c has a distinct SHH motif. V2c was found to induce growth inhibition, plasmid degradation, and cell elongation in E. coli. The cognate immunity protein V3c can neutralise the DNase activity of V2c. V2a and V2c are found to function synergistically to exhibit stronger antibacterial activity against a phytopathogen, Dickeya dadantii.

      Although the manuscript provides a decent characterisation of the T6SS effector V2c of strain 1D1609 of A. tumefaciens, there are several areas where the authors could make significant improvements to their work.

      • The introduction section of the manuscript would benefit from a more detailed background of the research to situate the reader in the appropriate context for a better understanding of the results of this study. Specifically, the authors could provide more information regarding the four effectors of A. tumefaciens 1D1609, their domains, their genetic context, and their immunity proteins. In fact, three of the effectors are, to a different extent, named in the manuscript, whereas the fourth one is not mentioned at all. The authors should also aim to provide more context and explanation of the nomenclature of the effectors. This will make the paper more understandable for readers unfamiliar with the terminology of Agrobacterium effectors. In addition, the authors should consider giving more attention to the phenotype of previously described nucleases, such as cell elongation, so that the reader would better understand the result section when encountering this phenotype. The authors only explain this in the discussion, and it would be helpful to have more clarification in the Introduction as well. The authors should also explain the reasoning behind using that prey cell (Dickeya) and not E. coli or another organism for the antibacterial activity experiments.
      • The novelty of the study could be improved by providing a better explanation of the specific mechanism or mode of action through which V2c works. For example, the authors could study more deeply the puzzling fact that the elongation phenotype is independent of the nuclease activity for this effector but not for V2a. Another interesting approach would be to study the putative specificity of these nuclease effectors, as not all of them are effective against bacterial targets. This is an unexplored area of great interest for a more innovative study because nucleases do not seem to be specific, they all degrade nucleic acids, and somehow they have different capacities to kill different prey cells.
      • In Figure 1B, it would be convenient to include in the alignment the two nucleases of the same family as V2c that have been already described in the literature and are named in the main text (Tke4 and Txe4) to better illustrate their similarities and differences. In Figure 1C, it would be convenient to add the PAAR-RHS domain to the list of N-terminal domains found with Tox-SHH nucleases.
      • When it comes to the microscopy experiments (Figure 5), the authors should work to improve the relevance and quantification of the data they present. This could involve using more rigorous analysis techniques, such as statistical analysis, to support their findings more convincingly. In fact, the authors could enhance the rigour of their analysis (Dickeya cell lysis) by gathering more supporting evidence before drawing their conclusions. The authors should explain why they are using two identical strains (attackers) in the competition assays (Fig 5C) d3EIbcd 1 and 2.
      • Regarding the inter-bacterial competition settings between Agrobacterium and Dickeya, the authors should explain why they used TssB-GFP prey cells when this is not necessary for the assays they performed. Furthermore, the authors should clarify the statement in the discussion (lane 353-355) regarding the absence of antibacterial activity of V2c against E. coli, while the results of this work show inhibition of E. coli cells (Fig. 2). The authors should rethink whether the video is necessary for this section, as it does not provide additional relevant information.
      • To ensure that the paper is easily comprehensible and effectively conveys its message, the authors should meticulously examine all aspects of their writing, including language usage, grammatical accuracy, and syntax structure. The authors should also ensure consistency in their writing style and language usage throughout the paper. As one example of writing style inconsistency, the authors used both Gram-negative and gram-negative in the manuscript.

      Significance

      The study expands the knowledge in the specific field of SHH nucleases and T6SS effectors. This could be of interest to T6SS researchers and more broadly to researchers in the field of bacterial toxins.

      The novelty of the study is very limited since the authors functionally characterised a T6SS effector with a well-described function, a DNAse (DNA degradation) and a recognised structure (SHH domain). As expected for a nuclease, it degrades DNA and provokes cell elongation, which has also been described before.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary:

      The authors provide insight into the gaps within BRAFi research in an effort to further understand how elements such as mechanisms of resistance and clinically observed adverse events in melanoma patients occur. This manuscript more specifically highlights the effects of BRAFi treatment on endothelial cells in the context of vasculature. The authors begin to explore how traditional BRAFi therapies may lend to such adverse events due to the role they play alongside that of targeting melanoma cells such as off-target effects, paradoxical endothelial signaling, and inducing a pro-tumorigenic microenvironment. The conducted studies demonstrate simple and effective methodology, focusing on proteomic and phosphoproteomic analysis, to elucidate the endothelial consequences of BRAFi treatment. The authors provide sound conclusions from the presented data and validate their in vitro findings with clinical observations using patient tissue. The analysis within this manuscript is just scratching the surface and leaves the authors with much to explore in future manuscripts.

      Major comments:

      The authors provide a solid story outlining the pitfalls in BRAFi therapy research and the consequences on endothelial vasculature in the treatment of BRAF mutant melanoma. The manuscript details clinical relevance of the research, functional impact to the field, and a thorough discussion on the scope of this work and where it may be lacking, which allows for the opportunity for future directions.

      Minor comments:

      The authors may consider revising minor errors within the Discussion as indicated below. Discussion - Paradoxical MAPK activation Missing comma between cells and the; "For endothelial cells, the concentration of BRAFi measured in the patient circulation is critical." Discussion - Off targets in endothelial cells Missing comma between range and it; "At concentrations in the low µM range, it inhibits numerous other kinases." Missing commas around apart from MAPK; "This suggests that, apart from MAPK, other signaling pathways would also be affected by BRAFi treatment"

      Significance

      This manuscript poses a key discussion in the importance of expanding research of molecular targeted therapies on more than just the target cells as the consequences to surrounding cell types can give vital insight into potential adverse effects in the clinic. The authors note that while this is not a novel concept, there are still gaps that prove vital in understanding clinical impact, which they hope to fill with this manuscript. They provide support to their conclusions using primarily proteomic approaches with the addition of some comparative analysis of a publicly available dataset, and patient tissue samples in order to validate their findings. Whether in the context of treating melanoma or any other disease. this manuscript serves as a helpful reminder to pre-clinical and clinical researchers alike in how important it is to factor in the patient as a whole, not just the disease when identifying effective treatment options.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary:

      The author Bromberger and colleagues have submitted a MS # RC-2023-02152 entitled "Off-targets of BRAF inhibitors disrupt endothelial signaling and differentially affect vascular barrier function" for review via Review Commons. In the MS they have investigated four BRAF inhibitors with different pharmacodynamics; Vemurafenib, Dabrafenib, Encorafenib and PLX8394 and their specific effect on vascular endothelial cells but also on melanoma cells. The study is composed of in vitro studies using in-house isolated human dermal endothelial cells. Also, melanoma cells and skin biopsies from 5 melanoma patients were analysed. The authors conclude that the BRAF inhibitor Vemurafenib caused strong effect on the endothelial cells' barrier function in comparison to the other three BRAF inhibitors.

      Major comments: major issues affecting the conclusions:

      In general; a major issue that is affecting the whole story is the rather high concentration of Vemurafenib (100 uM) used in the study. The authors do not provide any data describing the viability and function of the endothelial cells after exposure to 100 uM of Vemurafenib. Instead they have chosen two concentrations with a large (10X) difference. Where the cells viable at 100 uM of Vemurafenib? If the endothelial cells were suffering from 100 uM Vemurafenib, they will immediately loose the cell-cell contacts/junctions and thereby any performed permeability assay would be pointless. Furthermore, isolation of skin endothelial cells is at risk to be accompanied with lymphatic endothelial cell contamination. The authors should provide data ensuring that the cells are of >90% endothelial cell purity by checking for PROX1-positive cells together with endothelia cells markers (CD31, VE-cadherin, uptake of AcLDL etc).

      The work is of importance in understanding consequences for endothelial cells exposed to BRAF inhibitors used in the clinic using clinically relevant concentrations of the drugs investigated in vitro. If the authors provide with a major revision, the work could be acceptable for publication.

      1. The Western blots in this manuscript are in general overexposed (saturated) and therefore differences between treatment conditions are not possible to be clearly defined. Therefore, quantifications of the experiments should be done and combined with representative Western blots.
      2. Figure 1A-C n=?, notice no standard deviations in 1C. Does this mean that in 1C n=1?
      3. Figure 1D, no significant differences? If there is no significant difference, then there is no difference between the treatments.
      4. Regarding concentrations of Vemurafenib; it is needed that the authors define endothelial cell viability (proliferation, Caspase-9 staining or LIVE/DEAD fixative stains) at this high concentration. Then 10 uM is probably a too low concentration (see data in figure 2 where 10 uM gives no data of relevance). Cell toxic effects could be the reason of increased passage of N-Fluorescein upon 100 uM Vemurafenib treatment or the cause of cell-cell gaps (Figure 5). If 100 uM truly shows that the cells are viable without any signs of toxicity, the paper would be more clear if main figures contain only 100 uM Vemurafenib. It is recommended that cell cytotoxicity is tested for all compounds in this short- and long-term treatments
      5. Figure 5; the authors should demonstrate the effect of BRAF inhibitors using a different approach. Trans-endothelial migration (trans-well), or similar methods would enforce the main message. Furthermore, migration defects could be evaluated by scratch-wound assay. Comment: the imaging in figure 5A is not clear enough to truly show the cell morphology and to define the cell status (see point 4 related to cell viability). We also advice that figure 5A also contains stainings for all other treatment conditions (or included in a supplement figure). What´s the mechanism behind junctional rearrangement? Internalization, degradation or actin cytoskeleton-dependent mechanisms? Figure 5A, stainings should be quantified. Figure 5C; with three asterisks in the figure, what is the actual significance and is it compared to DMSO? With the large SD the significance can hardly fit with three asterisks (<0.001).
      6. Valuable skin biopsies of patients before and after treatment have been used for figure 6. The authors should pay more careful attention to what vasculature they are investigating in the biopsy material. The authors mainly focus on large arteries (large vascular lumens with a thick layer of ASMA-positive cells). We recommend that they investigate capillaries (5-10 um in diameter) which are more plastic and susceptible towards treatment. Claudin-5 is a vascular marker but the antibody chosen clearly provides with high autofluorescence stains detecting blood cells in the vascular lumen and not only the endothelial cells. We therefore recommend to use another claudin-5 antibody that will stain dermal vasculature better. Which patient is imaged in figure 6? Please prepare a supplement figure with patient 1-4 to show representative images of the main differences. Do the authors expect that Vemurafenib 100µM will also decrease VE-cadherin and claudin-5 total protein levels?
      7. Table 2: The quantification is not clear. The authors should describe the data in a more descriptive way. For example, what does it means to have more than 100% (181.41% of claudin-5 for patient 5) of the vascular markers? Also, it is not realistic to describe percentage data with 2 decimals. The authors should also classify their quantification based on vessel type (large caliber vessels vs capillaries), cancer and pseudo-normal tissue. As a way to validate their in vitro findings (permeability and junctional disruption in these patient tissue biopsies), the authors should check for leakage by staining for serum proteins like IgG, fibrinogen or serum albumin.

      Minor comments: important issues that can confidently be addressed:

      1. The authors want to fill a gap in knowledge related to BRAF inhibitors effect on endothelial cells, which a limited number of publications are available.
      2. Why are the authors using CellTracker for visualize cell morphology. It would be better if cells were stained for VE-cadherin and beta-actin including nuclear stain with DAPI. This would far better define the cell morphology after treatments.
      3. Please in Material & Methods describe KinSwing activity predictions index to help the reader to follow the results better.
      4. Table 1 could be reformatted to be more easily to read.
      5. Figure 1, is ERK= ERK1/2?
      6. The discussion text should be shortened and more focused towards their findings and with conclusions of performed experiments. How is the paradoxical effect of Vemurafenib (figure 1) related to their later findings (Figure 2 and 3)? In other words, what is the relation between figure 1 and figure 2 and 3?
      7. For the discussion; is the result in figure 5C supported by data that patients on Vemurafenib treatment would be exposed to a higher risk of metastasis?
      8. Figure 3B, resolution of text needs to be improved and the full compound names could be written in figure 3A.
      9. Figure 4A are any of the results statistically significant? If not, then there is no difference.
      10. The authors should elaborate a hypothesis based on their phosphoproteomics data. Which of the off-targeted molecule(s) could impact endothelial barrier?

      Referees cross-commenting

      With our deep knowledge in endothelial cell biology, we would like to emphasize the need of Bromberger et al to reply to our comments. Additional experiments and verifications will improve the impact of the performed research. With reviewer 2 demanding far less additional work to be done there is a discrepancy between the two reviewers of the estimated time needed for performing a revision (1-3 months for reviewer 1 versus 1 month for reviewer 2). I (reviewer 1) believe that at least three (3) moths will be needed to collect additional data to reply to the questions.

      Significance

      This manuscript addresses an important question; how is the vasculature affected by cancer treatments? It is not unusual that the vascular status is neglected in clinical treatment studies. The manuscript provides valuable phosphoproteomics data of great interest related to this topic. The major weakness of the work is the lack of data verifying the chosen concentrations for the BRAF inhibitors used in the study. There is a great risk that several results based on the 100 uM Vemurafenib treatment (of high impact for the story) are based on cell toxicity due to a high concentration treatment in vitro. Also, the link between the strategy of performed in vitro experiments isn't clear and there is a lack of connecting the in vitro data to the validation performed on melanoma patient tissue biopsies. It is a great strategy to investigate skin biopsies before and after treatment. The precious biopsy material should be more carefully investigated and evaluated.

      Audience: after improvement of the manuscript by better presentation of existing data and by additional experiments the work presented would be of interest to a pre-clinical and clinical audience investigating cancer treatments.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Please see below for the detailed description of the changes made in response to the reviewers’ comments.

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      The manuscript investigated the composition of the plastid proteomes of seven distantly-related kareniacean dinoflagellates, including newly-sequenced members of three genera (Karenia, Karlodinium, and Takayama). Using a custom plastid-targeting predictor, automatic single-gene tree building and phylogenetic sorting of plastid-targeted proteins for plastid proteome construction, the authors suggest that the haptophyte order Chrysochromulinales is the closest living relative of the fucoxanthin plastid donor. Interestingly, the N-terminal targeting sequences of kareniacean plastid signal peptides, reveal a high sequence conservation. Moreover, ecological and mechanistic factors are suggested that may have driven the endosymbiotic acquisition of the fucoxanthin plastid. Overall, this is a comprehensive and interesting analysis.

      Other comments.

      1. For analyses of N-terminal targeting sequences, why did the authors not consider to employ Predalgo as an additional tool? Author response: We thank the reviewer for their suggestion. To our understanding, PredAlgo is a targeting predictor trained on primary green algae, which have two-membrane bound plastids and purely hydrophilic N-terminal plastid targeting sequences. It thus would be expected to perform poorly for the prediction of N-terminal targeting sequences in complex plastids such as those of the Kareniaceae bound by three or more membranes, who are located within endomembrane-derived compartments and which utilise plastid-targeting sequences based on an N-terminal hydrophobic signal peptide for ER import.

      We considered the application of PredAlgo for the identification of downstream hydrophilic transit peptide regions in Kareniacean presequences, but note that the specific residue positioned after the signal peptidase cleavage site is typically a much better predictor than transit peptide hydrophobicity for identifying plastid-targeting sequences (Gruber et al., Plant J 2015, and citing references). We found that other targeting prediction tools based primarily on hydrophobicity (e.g., HECTAR) performed poorly in identifying probable plastid-targeting sequences in our control Kareniacean dataset, and therefore chose to prioritise a modified version of ASAFind that takes into account the residue context of Kareniacean signal peptidase cleavage site for our targeting predictor, which works with high sensitivity and specificity on our control dataset. We summarise these observations in Fig. S15.

      Given the fact that peridinin or fucoxanthin pigment binding is in the focus of the paper, a more detailed introduction of the peridinin and fucoxanthin light-harvesting systems should be given.

      Author response: A brief introduction to the pigment-binding proteins in dinoflagellates was added, “These include a unique carotenoid pigment… massively paralogized and synthesized as polyproteins” (lines 86-89).

      The authors state "It is also possible that there has been a direct niche competition between the peridinin and fucoxanthin plastid that may have coexisted in the same host for a period of time with possibly different selective pressure on retention of their respective proteins based on their interaction with plastid-encoded components, e.g., extrinsic photosystem subunits not assembling correctly with their intrinsic haptophyte-like counterparts." It is tempting to ask, whether peridinin light-harvesting systems have left traces in the fucoxanthin plastid, possibly due to mistargeting of peridinin light-harvesting systems into the fucoxanthin plastid? Are some photosynthetic subunits "in-between" peridinin and fucoxanthin plastids?

      Author response: We did not identify any other peridinin-like photosystem subunits than the ones visualized in the map schematic (i.e., ferredoxin/PetF in both Karenia and Karlodinium and PsaD of Karlodinium micrum) and discussed in the supplementary text. PetF is the only consistently retained peridinin-like photosystem protein, likely due to the fact that it is not strictly linked to photosynthesis: it is expressed in plant leucoplasts, and plastid-encoded in some non-photosynthetic chrysophytes. We have added a sentence in Supporting Text 6.4 that “we detect no possible homologues of peridinin-chlorophyll binding proteins (PCP) in any kareniacean transcriptome” (line 91).

      Figure 3 is difficult to understand, e.g. for PSI and PSII which subunits are shown, why has PSI "more" contribution from dinoflagellates as compared to PSII?

      Author response: The photosystem subunits are ordered numerically in the schematic, and detailed information on each protein and the corresponding sequences with their origin are included in the supplementary table S3. A single subunit of photosystem I (PsaD) was determined to be of plastid-early (peridinin-like) origin in Karlodinium (while the same protein is plastid-encoded in Karenia and undetermined in Takayama). We believe this may be simply due to an evolutionarily neutral differential loss / non-adaptive retention of photosynthesis-related proteins in a secondarily non-photosynthetic host before the acquisition of a replacement plastid. We note that there are only two (incomplete) kareniacean plastid genomes available so we cannot rule out the possibility of this subunit being plastid-encoded in Karlodinium as well (which would mean that both plastid-late and plastid-early homologs co-occur in this genus).

      Fig. 3 is necessarily complex due to the size and multiplicity of the dataset considered. To facilitate reader navigation, we have added the following text to the figure legend (lines 1128-1140) text “Plastid proteins are arranged by major metabolic pathway or biological process, with each protein shown as rosettes … Proteins of plastid-late (haptophyte) origin, such as are concentrated in photosystem and ribosomal processes, are coloured red; and proteins of plastid-early (dinoflagellate) origin, such as are concentrated in carbon and amino acid metabolism are coloured blue. … In certain cases (shown as rosettes with multiple colours), homologues from different species have different evolutionary origins, e.g. Karenia possessing plastid-late and Karlodinium/ Takayama plastid-early”.

      Data shown in figure 4, is there experimental evidence for signal peptide cleavage site(s). Could these data been used to predict mature plastid targeted protein sequence?

      Author response: We were able to determine the conserved motives in signal peptide, including its cleavage site (GRR) which we exploited in the design of kareniaceae-specific matrix for ASAFind. We show these residues in Fig. 4. We note that these motifs were identified based on homology to known signal processing peptidase recognition sites, as opposed to experimentally determined protein N-termini.

      Consistent with previous studies (e.g. Yokoyama et al., J Phycol 2011) we see limited evidence for consensus plastid transit peptide cleavage motifs in kareniacean presequences, and do not discuss this further as a result.

      The authors state "Partial Least Square (PLS) analysis shows a set of environmental variables (salinity, silicate, iron) positively correlated with abundances of both Karenia and Takayma and also haptophytes as a whole, but at the same time negatively correlated to Karlodinium (Figure S8), further illustrating that the latter genus is quite distant from the rest in its biogeographical pattern." How could this be interpreted in the light of the plastid proteomes

      Author response: We believe that this may be due to the more cosmopolitan distribution of Karlodinium, and possibly also a result of bias stemming from our strategy of grouping the organisms at the genus level (as not enough data was available at species level) which may obscure the potential outlier status of only some species/ subpopulations. This is particularly true for the haptophytes, where in the absence of specific ancestry for individual kareniacean plastids we are only able to consider distributions at the levels of entire orders. We now acknowledge this in the Discussion: “specific ecological interactions between the progenitors … via ancestral niche reconstruction for each lineage” (lines 473-475).

      Please note, that the results might have changed slightly from the previous version due to the re-calculation following additional normalization of the data (see below).

      Reviewer #1 (Significance (Required)):

      The current manuscript gives insights into the endosymbiotic acquisition of the fucoxanthin plastids.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      This is a well done, detailed bioinformatic analysis of genomic and transcriptomic data from an important lineage of dinoflagellates that have undergone serial substitution of their plastid. On the whole I am enthusiastic about the paper; it presents valuable new insights, and is rigorously performed. However, I have to object to the way the term "proteome" is used in the paper; the manuscript is talking about the predicted proteome, not a measured proteome. This is something of a technical distinction, but it is an important one because the transcriptome and the proteome don't necessarily track each other, and there is little or no actual proteomic data available from dinoflagellates. We assume that transcript abundance has something to do with proteome abundance, but this is often violated. What this paper is really addressing is the potential proteome, because if a given gene is completely absent from the genome and the transcriptome we can be confident it will not be present in the proteome. The converse is not true. For this reason I feel it is important to be clear on the distinction. I would be satisfied in this regard by minor modifications, using the term "predicted proteome" in the title, and being more direct in the introduction about the distinction.

      Author response: We agree that the usage of the word proteome for in silico predictions is not entirely correct, and have used the term “predicted proteome” where possible in the text to clarify this.

      We have also, as described in our response to Reviewer 1 above, included a statement in the Discussion that our largely bioinformatic results will be transformed by an experimentally realised kareniacean plastid proteome, which we nonetheless feel goes beyond the scope of our manuscript.

      Overall the analyses are impressive. I do have to squirm a little when I see automated analyses generating alignments where the threshold is less than 75% gaps and at least 100 nucleotides aligned. I looked at the supplementary data and the figshare files and could not find the alignments themselves, so I don't know what fraction of the sequences are in that territory. Because phylogenetic analysis (as performed here) treats the alignments as an observation, and because the alignments include sequences with more than 50% gaps, it is entirely possible that some taxa, or even whole segments of the tree, are based on non-overlapping data.

      Author response: We thank the reviewer for their comment and have added in three new supplementary figures (S16-S18) providing statistics on alignment size, length, and average gap percentage distribution. We report that most of the alignments contained relatively little gaps: 90% of the alignments contained between 1.1 and 24.5% of gaps with median value of 6.6%.

      Mind you, we have done similar analyses, and I don't think this invalidates the results, but it does open up the possibility of some dramatic artifacts. Consequently, I would recommend a) making the alignments available (or more obvious where to find them), and b) providing more detail on the alignments, including, if possible, to add a figure (probably in the supplementary data) that visualizes them. It is not given in the text itself, but according to the figure 2 caption there are 22 sequences thought to be "plastid late", and 241 in the pan-eukaryotic dataset. This is a scale that is feasible to put in a figure showing, for example, each aligned residue as a color and indels as grey. Such a figure is readable even when the individual residues are only a few pixels in size (less than a millimeter when printed). I also recommend describing the final alignments more fully in the text. Most of the summary statistics are presented in normalized form, and that can obscure patterns that come from poorly sampled taxa. Better clarify on the characteristics of the alignments will make it easier to interpret the findings overall. Although this is critical to interpreting the results, gappy alignments are not uncommon in analyses of this sort, and setting that aside the analyses presented are comprehensive and thorough. The discussion does a good job of addressing the significance of the work, and potential causes of error are addressed adequately (aside from the matter of the alignments).

      Author response: We thank the reviewer for their comment and have provided alignments for all single-gene trees, in a dedicated online supporting repository (https://figshare.com/articles/dataset/all-automatically-generated-alignments_rar/24347032). The datasets and alignments used for PhyloFisher and plastid-encoded gene trees are included directly in the supplementary files (phylofisher_files.tar, plastid_genome_phylogeny_files.tar and plastid_protein_phylogeny_files.tar).

      We have additionally included three new supporting figures (S16-S18) showing the distributions of lengths, gaps and homologues in each single-gene tree. These data project largely completion of individual alignments, with only 5% containing > 20% gapped positions (see Fig. S18), for example. We have additionally clarified in the Methods that “The trimmed alignments were then filtered by a custom python script that discarded sequences comprising of more than 75% gaps and then rejected alignments shorter than 100 positions or containing fewer than 10 taxa.” (lines 571-573).

      For the two concatenated trees presented, we have clarified in the Methods the alignment lengths (PhyloFisher: 72, 162 positions; plastid genes: 2,404 positions), and that we removed sequences containing >66% of gaps from the final alignment. Reflecting on the congruency assumptions required to concatenated alignments, we have chosen to replace the plastid-late concatenated tree (which may group proteins with multiple phylogenetic signals) with a new main text figure 2 providing an overview of the plastid signals we observe across the entire dataset (see comments below to Reviewer 3).

      Reviewer #2 (Significance (Required)):

      I find the paper to be exciting and important. These organisms are economically important, particularly as potential nuisance organisms, but also because of their role in primary productivity. They also have extremely complex evolutionary histories and similarly complex genomes. performing any bioinformatic analysis of these organisms is a substantial challenge because almost every gene exists in high copy number and with complex and often obscure patterns of homology. The manuscript brings forward these challenges, and makes a substantial step forward in elucidating the evolution of a group that is fascinating and important, but remarkably difficult to work with. I feel that it is an important analysis, and should be of interest to a broad audience.

      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      Summary

      This manuscript entitled "Divergent and diversified proteome content across a serially acquired plastid lineage" by Novak Vanclova et al. proposes the origin and evolution of plastids in kareniacean dinoflagellates. The authors generated new transcriptome data from Karenia mikimotoi, Karenia papilionacea, Karlodinium micrum, Karlodinium armiger, and Takayama helix. Combining them to the previously published transcriptome data from kareniacean dinoflagellates, they constructed the pan-kareniacean transcriptome library. They surveyed plastid-targeted protein-coding transcripts in the dataset, and consequently they estimated ~14.5% of the transcriptome data were of plastid-targeted ones. Of them, 65-80% were derived from a peridinin-containing dinoflagellate ancestor while ~15% were derived from EGTs from a haptophyte endosymbiont of the current plastid origin. By using the plastid-targeted transcript dataset, they investigated 1) origins of the plastid-targeted protein-coding transcripts by single gene-trees, 2) the plastid origin and evolution by the multigene dataset of 22 conserved plastid-targeted protein-coding transcripts and of 3) plastid genome-derived transcripts, 4) plastid functions, 5) diversity of plastid-targeted signals in kareniacean dinoflagellates, and 6) the distributions of kareniacean species by using the Tara Oceans database. On the basis of their results, they proposed many hypotheses regarding kareniacean dinoflagellate evolution, such as i) the chrysochromulinales-origin of the plastids, ii) more recent acquisition of the plastid than previously thought, iii) a plastid replacement within kareniaceae evolution, iv) the strict selection of signal peptides but non-conserved transit peptides in the kareniacean plastid-targeted proteins, and v) correlated or non-correlated distribution patterns of kareniaceaen dinoflagellates to specific haptophyte lineages.

      Although their proposals are interesting, I have many concerns to be addressed. Especially, their analyses on which the above proposals are based seem to be still preliminary and inconclusive. To support their proposals more confidently, I also suggest some additional analyses.

      Major comments

      1. seemingly inconsistency between the authors' claims The most striking is inconsistency of the authors' claims proposed in this manuscript. Their proposals include a) the common ancestor of kareniaceans has not possessed a fucoxanthin plastid but the plastid has been acquired more recently, b) an ancestor of Takayama and Karlodinium has gained a fucoxanthin plastid from a (chrysochlomulinales) haptophyte, c) an ancestor of Karenia has gained a fucoxanthin plastid from Karlodinium. However, they also demonstrate a higher proportion of plastid-late proteins in Karenia than Karlodinium and Takayama. If I understand correctly, "a higher proportion of plastid-late proteins in Karenia than Karlodinium and Takayama" would seemingly be inconsistent to and challenge two of the authors' claims: no haptophyte-derived plastid in the common ancestor of kareniacean dinoflagellates and a Karlodinium-to-Karenia plastid transfer (Fig. 7). If the Karenia plastid is derived from Karlodinium, I have no idea why haptophyte-derived plastid proteome of Karenia is larger than that of Karlodinium. After the plastid acquisition in Karenia, Karenia might have gained more genes for plastid-targeted proteins from haptophytes by LGTs. If this is true, many single gene trees would suggest different origins of plastid-targeted proteins between Karenia and Karlodinium/Takayama. Can we see it in the single gene analyses? I would like authors to rationalize the inconsistency in the main text.

      Author response: We agree with the reviewer that the evolutionary origins and dynamics of the kareniacean plastid proteome are complex, and thank them for their suggestion.

      First, to take into account the different evolutionary scenarios that could explain the present-day distribution of the kareniacean plastids, including the new plastid genome sequences identified in response to the reviewer’s suggestions, we have made a revised version of Fig. 8 evaluating three different hypotheses (see below). Nonetheless, we feel that the Karlodinium-to-Karenia model we propose is plausible, based on the following observations:

      • We identify 1,418 plastid protein gene trees in which at least two of the three studied genera (Karenia, Karlodinium, Takayama), and 748 in which all three resolve as monophyletic, and with a haptophyte sister-group (i.e., a common plastid-late origin; Fig. S2). This points to a common haptophyte ancestry in all three groups, as opposed to independent endosymbiotic consumptions of free-living haptophytes in Karenia and Karlodinium micrum.

      • We see no such shared signal with the RSD, which shares only 42 proteins with at least two other kareniacean genera (Fig. S4). Thus, and consistent with previous studies (Hehenberger et al., PNAS 2019) we cannot invoke an ancestral presence of a fucoxanthin plastid shared with the RSD in the last common kareniacean ancestor. This discrepancy thus likely points to a serial transfer of the kareniacean plastid from either Karlodinium into Karenia or vice versa (Fig. 8).

      • Concerning the direction of this transfer, among 1,059 gene trees of plastid-late origin found in both Takayama, Karenia and Karlodinium, 873 place Takayama as basal to a monophyletic clade of Karenia and Karlodinium, i.e. support a specific plastid transfer between the latter two genera. The most parsimonious explanation for this is the origin of the fucoxanthin plastid in the common Takayama/ Karlodinium ancestor, which was subsequently transferred into Karenia. It is true that Karenia contains both a greater absolute proportion of predicted plastid-targeted proteins (Fig. 1) and greater number of unique KO number annotations (Table S4) of plastid-late origin than either Karlodinium or Takayama. That said, this signal may be influenced by multiple other factors beyond how old the given endosymbiosis is (i.e., longer coexistence implies more EGT). For example, the number of plastid-late gene in a host genome may depend on the frequency of duplication of plastid-late genes and the receptiveness of the host nuclear genome to incoming horizontally derived genes. It may further be influenced by the presence and relative selective advantage or disadvantage of competing genes of host nuclear origin (i.e. plastid-early genes) that may be differentially selected over plastid-late genes, which might vary between Karenia and Karlodinium due to differential retention of the ancestral peridinin-type plastid in each lineage.

      We have elaborated on this point in the Discussion, noting that there may have been “a direct niche competition between the peridinin and fucoxanthin plastid … with possibly different selective pressure on retention of individual imported proteins” (lines 370-372), “relatively recent origin and spread throughout the kareniacean genome, e.g., via gene duplications” (line 459), and finally that precedent for divergent evolutionary trajectories in different Kareniaceae exists from the Karenia and Karlodinium plastid genomes that “contain partially non-overlapping sets of genes that suggest independent post-endosymbiotic plastid genome reduction” (lines 403-404). Nonetheless, we acknowledge that the evolutionary model we propose is not definitive, and that alternative explanations may find more favour with increased genome data.

      Signal peptide prediction I think the modified ASAFind would be greatly helpful for future studies on automatic prediction of plastid proteomes in kareniacean dinoflagellates. However, I found no data on selection criteria for the signal peptide prediction program SignalP5.0 used. I believe such data would be very important to interpret the previously published paper by Gruber et al. in which prediction methods for plastid-targeting sequences are compared to each other to see how sensitively and specifically they can capture the plastid proteomes.

      Gruber et al. 2020. Comparison of different versions of SignalP and TargetP for diatom plastid protein predictions with ASAFind.

      According to Gruber et al. (2020), signalP5.0 is not suitable for prediction of signal peptides for diatoms, in consistent with the authors' claim for kareniacean dinoflagellates. This inconsistency would be difference of the nature in signal peptides between diatoms and kareniacean dinoflagellates. Even if so, it would be useful to see quantitatively how much different their signal peptides are in terms of their suitable prediction programs.

      Author response: In our preliminary benchmarking using only the previously published transcriptomes (see additional sheet in Supplementary tables), SignalP 5.0 performed substantially better in terms of specificity than SignalP 3.0 (i.e., 22 versus 34/ 728 retrieved positive hits of proteins with uniquely non-plastidial functions), with comparable sensitivity in the correct prediction of positive control proteins. Given the size of our dataset, and the substantial risk of false positive detection in the highly expanded and redundant dinoflagellate transcriptomes we have used, we feel that the greater specificity of SignalP 5.0 is important to integrate in our model selection. We have clarified this position in the Methods, stating “First, the relative effectiveness of two SignalP versions … SignalP 5.0 was used for all subsequent analysis.” (lines 525-529).

      I also have a concern about use of the combination of PrediSI and ChloroP, combination which is suitable for the plastid proteome prediction in Euglena gracilis. The authors should rationalize why the method for Euglena plastids can be applicable without any modification to the plastid proteome prediction in kareniacean dinoflagellates. Although Euglena plastids are enclosed by three membranes, kareniacean plastids are by four. Therefore, from the side of molecular mechanisms in protein import, the method suitable for Euglena plastids is not necessarily suitable for kareniacean dinoflagellate plastids.

      By using PrediSI and ChloroP, they detected additional "candidate plastid proteomes" including several proteins not detectable by SignalP5.0 and the modified ASAFind. That seems great. However, they did not seem to consider false positives since there is no mention on it. Although the additional candidates predicted by PrediSI and ChloroP included true plastid proteins of kareniacean dinoflagellates, many might not be. Nevertheless, the authors suggest 7.5 to 14.5% in K. micrum and K. brevis, respectively, are of plastid-targeted ones. I am so afraid if the proportions would be highly overestimated due to false positives by PrediSI and ChloroP. To rationalize the use of PrediSI and ChloroP, the authors should show sensitivity and specificity by quantitative analyses with a benchmark dataset.

      Author response: We thank the author for this comment. The reasoning behind using the parallel PrediSI+ChloroP strategy was the previously reported similarity of the plastid signal structure between euglenids and peridinin dinoflagellates (c.f., Lukes et al., PNAS, 2009) and the previous observation that some kareniaceae posses plastid-targeting sequences resembling those of peridinin dinoflagellates (c.f., Hehenberger et al., PNAS, 2019). Per the reviewers’ suggestion, we present a modified sensitivity/ specificity testing PrediSI+ChloroP, alongside other alternative targeting predictors in Figure S15. While the PrediSI+ChloroP sensitivity is very low, its specificity is comparable with the modified ASAFind, and in this regard outperforms other targeting predictor tools, thus rationalising the use of both targeting prediction tools together.

      Origin and evolution of kareniacean plastids The authors suggest the chrysochromulinales origin of the kareniacean dinoflagellate plastids and the Karlodinium-to-Karenia plastid transfer, on the basis of phylogenetic analyses using the concatenated datasets with the 22 conserved plastid-targeted proteins and with plastid-genome derived transcripts. It is very interesting that those plastid-targeted proteins in kareniacean dinoflagellates might be phylogenetically closely related to chrysochromulinales haptophyte I have suggestions on the analyses and interpretation

      As the 22 analyzed genes are nuclear-encoded plastid targeted genes, they are a quite small portion of entire plastid proteins. I am not convinced by that evolution of the small number of genes reflects evolution of fucoxanthin plastids of which proteomes are comprised of >1000 proteins. How many genes for haptophyte-derived plastid-targeted proteins suggest the monophyly of kareniaceaen dinoflagellates and chrysochromulinales haptophytes should be investigated by, for example, a coalescence-based analysis such as Astral for all the detected haptophyte-derived plastid-targeted proteins including the 22 genes. This is because the monophyly could be reconstructed only by one or few, limited number of proteins even if the concatenated dataset is analyzed.

      Relevant to this, plastid-targeted proteins derived from a peridinin-containing ancestor might still have phylogenetic signals of host evolution. I am interested in whether such analyses with peridinin plastid-derived plastid-targeted proteins reconstruct Takayama and Karlodinium as monophyletic but separate Karenia from them, as suggested in the phylogenomics with non-plastid proteins.

      Author response: We agree with the reviewer concerning the problematic nature of concatenations with small numbers of genes, particularly if the underlying gene trees are not phylogenetically congruent to one another, and have chosen to replace the concatenation with a more global evaluation of the different plastid protein origins across our entire dataset. Using automated sorting approaches, we have evaluated the support for our evolutionary model across hundreds of gene trees. We feel that this approach supercedes coalescence-based techniques, as it enables us to treat each gene topology as an independent event, and to consider multiplicity in the origin of the kareniacean plastid proteome. We present these data in a new Fig. 2 and S2.

      As stated above, these data strongly support monophyly of all three Kareniacean genera. Concerning the potential Chrysochromulinalean plastid signal in our dataset, we have reanalysed our data and quantify a substantial number of trees (220/ 1,418 of plastid-late origin) that specifically place multiple kareniacean genera within the Chrysochromulinales. This figure is more than twice the number (91) that place the kareniaceae with the next most occurrent haptophyte group in our dataset, Isochrysidales. We nonetheless have chosen to no longer present this as a cryptic plastid endosymbiosis, in the absence of clear examples of extant kareniaceae still possessing this plastid, saying purely in the Discussion that “a common ancestor of the studied organisms either possessed a stable plastid or had a long-term symbiotic relationship (e.g., kleptoplastidic) with a haptophyte lineage related to the extant Chrysochromulinaceae” (lines 363-365).

      Concerning the phylogenetic placement of each karenicean genus, the majority of our plastid-late trees specifically recover the monophyly of Karenia and Karlodinium. Remarkably, we find that Takayama and Karlodinium only resolve together in 69/ 1,039 plastid-late gene trees in which all three genera are represented, strongly refuting a vertical origin of the haptophyte-derived components of their plastid proteome. This is not due to the Phaeocystales origin of the current Takayama plastid genome, which is found in only 21 of our plastid protein trees. Nonetheless, as the reviewer suggests, the opposite trend (1,505/ 2,804 gene trees grouping Takayama and Karlodinium as monophyletic) was observed amongst plastid-early gene trees, which might reflect a cryptic peridinin plastid shared between these groups. We expand on these results in the Discussion, stating “Many of the plastid-early gene trees copy the organismal topology …this awaits structural confirmation via microscopy” (lines 383-386).

      Finally, to enable reviewer comprehension of the relationships shown, we have presented some exemplar topologies of some of the trees previously displayed in the concatenation, provided in a new Fig. S5.2.

      For the phylogenetic analysis of plastid genome-derived transcripts, I might be wrong, but I could not find any information on dataset sizes (i.e., the numbers of sites) and evolutionary models for the analyses in the main text nor supplementary document. Although one may see the dataset sizes when looking at the original datasets in the supplementary files, such information is substantial and thus is to be described in the materials and methods section. I am afraid if this analysis was performed with a small dataset size. I would like to know total lengths of the concatenated sequences and especially that for Takayama. The phylogenetic position of Takayama, distantly related to the other kareniaceans, in this tree might be caused by a larger portion of gaps in the Takayama sequences than in the other kareniaceans.

      Author response: As noted in our response to Reviewer 2, we have included three new supplementary figures (S16-S18) with statistics on alignment size, length, and average gap percentage distribution. The average and median values of these three measurements do not differ significantly when calculated separately for different organisms. We have clarified in the Methods that the concatenated alignments retained (PhyloFisher, and plastid-encoded genes) were “constructed by IQ-TREE with the LG+C60+F model for the plastid matrices and posterior mean site frequency (PMSF) model (LG+C60+F+G with a guide tree constructed with C20) for PhyloFisher matrix” (lines 630-632).

      Moreover, due to lack of the plastid genome sequence of Takayama, no one could confidently identify plastid genome-derived transcripts: some of those could be derived from second, nuclear copies that might be pseudogenes. Otherwise, even if they are plastid-derived, no one can evaluate whether they are transcripts after or prior to RNA editing. I am afraid if the dataset used is comprised of a mixture of edited and non-edited sequences in kareniacean sequences. Either of sequences after or prior to RNA editing, latter of which are identical with DNA sequences, should be consistently used for the phylogenetic analysis. In any case, the plastid genomes are necessary for this analysis, and the authors can easily obtain them by DNAseq as they have the cultures.

      Author response: We thank the Reviewer for their insightful response. We agree that understanding the evolution of kareniacean plastid genomes are crucial to understanding their evolutionary history.

      We have accordingly, as described above, integrated a new main text Fig. 5 building a concatenated tree of plastid marker genes (psbA, psych, psbD, psaA, rbcL, and 16S rDNA) historically and commonly used to assess the evolutionary origins of fucoxanthin plastids (e.g., Takishita et al., Phycol Res 1999; Dorrell and Howe, PNAS 2012). These sequences were amplified cryopreserved stocks of total RNA and specific primers, amplified by RT-PCR. We have chosen here to use RNA sequences, to account for the presence of plastid RNA editing, which has been shown to play an important role in maintaining sequence identity between kareniaceaen plastids and haptophyte relatives despite a high DNA mutation rate in the former (Jackson et al., MBE 2013; Klinger et al., GBE 2018), rather than DNA sequences for this analysis.

      Additionally, we would like to note that while plastid genomes are generally relatively simple to sequence and assemble, this is not the case in Kareniaceae. The existing plastid genome assemblies are partially incomplete and suggest more complex and possibly unstable structures (e.g., involving at least some minicircles in Karlodinium micrum, Espelund et al., PLoS One 2012; Richardson et al., MBE 2014). From personal communication with our colleagues, we are aware of some efforts to sequence additional kareniacean plastid genomes that unfortunately have not yielded satisfactory results and publications to this day. This strongly invites a separate project focused on kareniacean plastid genomes but is vastly out of scope of this study.

      As described above, we have obtained striking new results which we are happy to report in the revised manuscript and which suggest even more, so far unnoticed, plastid replacements in the kareniacean lineage. In light of these finding, parts of the Results and Discussion sections have been extensively rewritten, and the schematic models presented in Fig. 8 has been updated to account for the distinct evolutionary origins of the Karlodinium armiger and Takayama helix plastids.

      In addition, although I might be wrong, the phylogenomic analysis for plastid-encoded transcripts might be performed with their nucleotide sequences according to the figure title and legend of Figure S4 mentioning "nucleotide phylogenetic matrix" and the file name "plastid_coded_nt_concatenation_files.tar". If so, translated amino acid sequences should be subjected to phylogenetic analysis, to avoid a well-known artifact that is caused by saturation of substitutions at the 3rd codon.

      Author response: With the exception of our 16S rDNA trees (in supporting data), all of our trees were generated with conceptual amino acid translations using a standard codon translation table, in accordance with previous studies (e.g., Klinger et al. GBE 2018). We have revised the file and figure names accordingly.

      Duplication of an ATP synthase subunit Duplication and relocation of ATP synthase subunit delta seems interesting. In figure S6.4.1, could you clarify why the possible extensions containing signal peptides lack the initiation methionine at N-termini? I wonder they are 5′ UTRs but artifactually detected as signal peptides, if they all indeed lack Met. To evaluate this point, I recommend 5′ RACE followed by transformation into a model organism as performed in previous studies by some of the authors.

      Author response: We reinvestigated these sequences more thoroughly using raw nucleotide data and conclude that the evidence for their retargeting to plastids is very weak and the reported extensions more likely represent untranslated regions some of which were falsely predicted as signal peptides. This section was removed from the new version of the manuscript, although we have noted in Supplementary Text 6.4 that: “A targeted HMMER search for possible distant homologs revealed that the distantly related functional analog of this protein in mitochondrial F-type ATP synthase (ATP5D, K02134) is duplicated in all species except Takayama. The additional copies, however, do not possess a detectable plastid-targeting signal and the specific functions of this duplicated subunit remain to be determined” (lines 107-111).

      Comparison of transit peptides Amino acid compositions in transit peptides would vary when targeted compartments are different. In complex plastids, there are functionally distinct compartments: lumen, stroma, periplastidal compartment (PPC). Comparison should therefore be conducted separately for lumen-targeted, stroma-targeted and PPC-targeted proteins in order to claim their transit peptides are not conserved.

      Author response: We acknowledge that this question was not explored in our analysis. We therefore re-analyzed our datasets taking the inferred sub-plastidial (thylakoid vs other, based on function) localization of the proteins into account. Our results showed no notable differences between these subsets and are reported in supplementary figure S10.

      RDS never possessed a stable fucoxanthin plastid Although the authors cite Hehenberger et al. 2019 for that RDS never possessed a stable fucoxanthin plastid, as far as I know, that paper seems not to mention it. Could you let me know where that is mentioned in the paper? Hehenberger et al. instead proposed the retention of non-photosynthetic peridinin plastid.

      Author response: We have modified the Results text, noting that we only identify 42 plastid-late proteins shared between RSD and other Kareniaceae, and in the Discussion that these data provide only limited support for a shared fucoxanthin plastid. We further clarify in the Introduction that “In some cases, the co-existence of a new organelle or endosymbiont with a remnant of the ancestral plastid has been proposed” (lines 106-108) and “It has previously been suggested that the RSD retains a non-photosynthetic form of peridinin plastid” (lines 378-379) with regard to the Hehenberger paper.

      Regardless of whether Hehenberger et al. mentioned or not, Novák Vanclová et al. propose that RDS never possessed a stable fucoxanthin plastid because, if I understand correctly, they detected no or few haptophyte-derived RDS genes for plastid-targeted proteins of which origins are shared with those of Karlodinium, Karenia, and Takayama. What about the possibility that the last common ancestor of kareniacean dinoflagellates possessed a fucoxanthin plastid in addition to peridinin plastid followed by almost complete losses of those haptophyte-derived genes after loss of a fucoxanthin plastid in evolution leading to RSD? Free living eukaryotes were appeared to have lost a plastid in recent studies and they have only a few or no genes showing evidence of a plastid previously retained. We cannot rule out that an ancestor of kareniacean dinoflagellates possessed both of peridinin and fucoxanthin plastids, as the authors mention in the main text, and either plastid was inherited to each lineage by differential losses. Accordingly, I would say Fig. 7 is a too much strong proposal as alternative hypotheses are still present. They should be introduced equally.

      Author response: We thank the reviewer for this comment. As discussed above, we evaluate the possibility of a cryptic peridinin plastid shared in different kareniaceae, which is suggested at a genetic level by our data but awaits structural confirmation.

      We agree that alternative hypotheses may be invoked for the origins of the current kareniacean plastids, and have modified our Fig. 8 to present three alternative possibilities: serial transfer, independent acquisition, and coexistence of an ancestral peridinin and fucoxanthin plastid, as the reviewer suggests. The presence of an ancestral fucoxanthin plastid that was subsequently replaced in Takayama and Karlodinium armiger is strongly suggested by the monophyly of the plastid-late signal across all kareniacean species studied, except RSD. We nonetheless feel that the frequent monophyletic placement of the Karenia and Karlodinium micrum plastids to the exclusion of Takayama in our plastid-late gene trees strongly argues against a vertical inheritance of this plastid from the common kareniacean ancestor, and more likely reflects a serial transfer between the Karenia and Karlodinium / Takayama branches. We have evaluated the evidence for and against each hypothesis in the Discussion and in the Fig. 8 legend.

      rRNA copy numbers in dinoflagellates It is known that the rRNA gene copy number varies among populations or strains in dinoflagellates; some possess several dozens of times as many rRNA gene copies as others (Galluzzi et al. 2010). Is it informative to see the ocean wide rRNA gene amplicon data for the kareniacean dinoflagellates? The numbers of rRNA gene-derived reads would not necessarily reflect the cell abundance of dinoflagellates.

      Galluzzi et al. 2010. Analysis of rRNA gene content in the Mediterranean dinoflagellate Alexandrium catenella and Alexandrium taylori: implications for the quantitative real-time PCR-based monitoring methods. J Appl Phycol 22:1-9

      Author response: We thank the reviewer for raising this point. The exploration of Kareniaceae distribution was intended primarily to investigate their respective ecological relevance in terms of niche diversity, in particular compared with the well-known cosmopolitan patterns of haptophytes, rather than comparing their abundance patterns. We feel that our approach, treating each Kareniacean genus independently, is sufficient for this, but have now clarified in the Results that the different abundances observed “may be biased by the different ribosomal DNA copy numbers in different genera” (lines 330-331) and have cited the reference the reviewer has kindly supplied.

      We further note in the Discussion that “It will therefore be worthwhile in the future to assess the distributions of other more recently developed marker genes (Penot et al., 2022; Pierella Karlusich et al., 2023)” (lines 371-372).

      Minor points

      1. the dataset size for the 241 protein-based host phylogeny should also be described in the main text. Author response: The information (72,162 positions241 genes, removal of sequences with >66% gaps) has been included in the Materials and Methods.

      The authors mention in Discussion "Thus, our results illuminate the mechanistics of a fundamental process that may under pin vast tracts of chloroplast evolution". If I understand correctly, I think this is based on "shopping bag model" when considering plastid replacements in dinoflagellates. It is helpful to add more details to clarify why the authors would like to claim so. "Chloroplast" should be replaced with "plastid".

      Author response: We agree that the term plastid is more appropriate in this context, and have used it globally throughout the manuscript. We have mentioned once in the Introduction “primary plastids, i.e. chloroplasts” to orient the non-specialist reader.

      We have elaborated on our definition of the Shopping Bag model, and the specific importance of the Kareniaceae, in the Discussion: “The idea that individual genes encoding plastid-targeted proteins may exhibit evolutionary affiliation with other groups than the plastid donor, typifying the “shopping bag” model (Larkum et al., 2007), is well-established in many plastid lineages” (lines 350-352).

      Nonetheless, we feel that our data are in many ways different to those previously observed in other plastid lineages. This may reflect that the kareniacean plastid has undergone one, and potentially multiple, recent replacement events. Nonetheless, the predominant contribution of the host to the plastid proteome is striking, which we elaborate in the Discussion: “Our data show that the dinoflagellate host was the principal contributor of nucleus-encoded proteins supporting the kareniacean plastid proteome” (lines 352-353).

      Supplementary document S6.6 I found the term nitrogen fixation, but should this be replaced with "nitrogen assimilation"?

      Author response: We have corrected the text as requested.

      Figure S5 For those LGTs, all the trees should be shown in supplementary text as they are only 11 or 12 trees. Especially, please add the chlorophyllide b reductase and chlorophyllase in the figure.

      Author response: Trees for all laterally transferred genes mentioned in the text have been provided among supplementary figures (S7.1-10).

      References I am not picky about a format of the reference list, but I think it should be consistent throughout the list. I recommend adding journals, volumes, and pages precisely for cited papers. I found lack of them at least in Novak Vanclova et al. and Pierella Karlusich et al.

      Author response: We corrected the incomplete citations and will perform a complete reformatting of the references to comply with the requirements of a concrete affiliate journal.

      Figures In figure 3, I strongly recommend adding RDS data, while distinguishing them by another color if they are derived from different origins from those of Karenia, Karlodinium, and Takayama. This would make the authors claim clearer that there are few haptophyte-derived genes for plastid targeted proteins of which origins are shared with those of the other kareniacean dinoflagellates.

      Author response: We believe the comparison to RSD is not among the main stories of our study and adding this dimension to the already complex discussion and metabolic map schematic would compromise the overall clarity. This point is already noted by Reviewer 1 (above). However, this question may indeed be asked by some readers, therefore we decided to include the results for RSD as an additional column in the supplementary table S3 and as an additional graphical element in the supplementary version of the map schematic (figure S8). Per the reviewer’s comments above, we have further stated the number of plastid-late trees shared (42) between the RSD and other kareniaceae in the Results text.

      In figures S5.1-2 showing LGTs, I found two paralogs of kareniacean dinoflagellates. What does "CP" mean? If "CP" means ChloroPlast-targeted, both paralogs of K. brevis in HARS and those of K. micrum are of plastid-targeted in TARS and they do not have cytosolic ones. I am afraid if these cases are caused by false positives of detection for plastid-targeted proteins by PredSI and ChloroP. Similarly, in figure S5.4, I found two distant paralogs of heam oxygenase in the tree and the taxon names for both types in kareniaceans include "CP." Are both targeted to the plastids or of false positives?

      Author response: The annotation with “CP” and darker colour denotes proteins that were predicted as plastid-targeted by our pipeline. We have clarified in supporting text 6.8 that we investigated our aminoacyl-tRNA synthetases for possible dual targeting to both plastid and mitochondria but found no evidence for it.

      We have searched the K. brevis SP3 HARS sequence (CAMPEP-0189291366) by CD-search and note that the conserved domain (underlined) starts at residue 24 after the first predicted methionine (bold), which is inconsistent with the probable length a plastid-targeting sequence, and we have noted in the figure legend that this is likely to represent a false positive.

      CAMPEP_0189291366_Karenia-brevis-SP3-20130916

      SWLVLLAFALTTPGPVVAVSATILRGLLVGLQRPCAAALRLSCCAATRALPLPGASELGSRFAAAAASSAR__M__GKEGKKKEDGKKKKDETKTEKLIGLEPPSGTRDFFPAEMRQQRYIFNKFRETANLYGFQEYDAPVLEHQELYIRKQGEEITDQMYSFDDKEGAKVTLRPEMTPTLARMVLNLMRVETGEMAAQLPLKWFSIPQCWRFETTQRGRKREHYQWNMDIVGVTSIYAEAELLSAICNFFESVGITSKDVGLRVNSRKVLNAVTKLAGVPDDRFAETCVIIDKLDKIGAEAVKTEMREKIGLPEEVGERIVKATGAKSLEEFADLAGVGQNNPEVLELKHLFELAEDYGYGDWLIFDASVVRGLGYYTGVVFEGFDRAGVLRAICGGGRYDRLLTKFGSPKEIPCVGFGFGDCVIAELLKEKGVTPSLPEHIDFVVAAFNSEMMGKAMNAARRLRLGGKSVDIFTEPGKKVGKAFNYADRVGADMVAFIAPDEWAKGLVRIKALRMGQDVPDDQKQKDVPLEDLANVDSYFGLAPAAAPVMSAAPAASTVKSTAPALAVPAAAKASAPKAAAPSGTGADVEAFLVDHPYVGGFRPCARDRTLFDELRLTSGRPSTPALGRWYDHIDSFPAVVRASWC

      The green HARS sequences (including that of Karenia brevis SP1) in contrast typically have conserved domains starting after residues 50-60, and are likely to be genuinely plastid-targeted. Reflecting that the automated prediction approach used within our dataset may contain other such false positive results (c.f., Fig. S18), we have chosen for tree-sorting and pathway reconstruction analyses to only consider genes in which we can identify plastid-targeted homologues of the same inferred phylogenetic origin in at least two distinct Kareniacean genera (Figs. 2, 3).

      For the Karlodinium micrum TARS sequence we have identified a second TARS sequence (CAMPEP_0200847158) that is of apparent dinoflagellate origin and lacks a credible targeting sequence, and have updated the tree accordingly.

      In the case of heme oxygenases, we are convinced that (at least) two paralogs of distinct origins are indeed plastid targeted. The presence of multiple copies of this enzyme has been noticed in other organisms including some plants (e.g., Dammeyer and Frankenberg-Dinkel, Photochemical & Photobiological Sciences, 2008) and may be reflective of functional specialization or regulation / expression under different conditions. We have discussed this in the supporting text 6.1: “Two evolutionarily distinct versions of the biliverdin-producing haem oxygenase seem to be present …the specific metabolic functions of the green- and haptophyte-like haem oxygenases in the fucoxanthin plastid await experimental characterisation.” (lines 52-58).

      Reviewer #3 (Significance (Required)):

      Significance

      General assessment: provide a summary of the strengths and limitations of the study. What are the strongest and most important aspects? What aspects of the study should be improved or could be developed?

      This study by Novak Vanclova et al. provide new transcriptome datasets from multiple species in kareniacean dinoflagellates including harmful and toxic species. Their transcriptome datasets would help understand their biology, evolution, and ecology. The authors also provide a program that predicts plastid proteomes in those dinoflagellates, which would be useful for future studies to focus on kareniacean dinoflagellate plastids, after further refinement. The most important aspect of this study is that many plastid-targeted proteins might be derived from a particular haptophyte lineage, although it is still not sure whether they are derived from LGTs or EGTs. Phylogenetic analyses performed in this study should be improved by adding some plastid genomes, in order to gain more conclusive results. In addition to methods, interpretation of the current results and proposals on plastid evolution should be toned-down.

      Advance: compare the study to the closest related results in the literature or highlight results reported for the first time to your knowledge; does the study extend the knowledge in the field and in which way? Describe the nature of the advance and the resulting insights (for example: conceptual, technical, clinical, mechanistic, functional,...).

      Although there are technical issues, this study improves our conceptual understanding the plastid proteome evolution in Kareniacean dinoflagellates. The plastid proteomes are comprised of proteins with more various origins in those dinoflagellates, suggesting more complex plastid proteome evolution than previously thought.

      Audience: describe the type of audience ("specialized", "broad", "basic research", "translational/clinical", etc...) that will be interested or influenced by this research; how will this research be used by others; will it be of interest beyond the specific field?

      This study seems to be "basic research".

      Please define your field of expertise with a few keywords to help the authors contextualize your point of view. Indicate if there are any parts of the paper that you do not have sufficient expertise to evaluate.

      algal evolution, eukaryotic evolution, mitochondrial metabolisms, plastid metabolisms, phylogenomics

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary

      This manuscript entitled "Divergent and diversified proteome content across a serially acquired plastid lineage" by Novak Vanclova et al. proposes the origin and evolution of plastids in kareniacean dinoflagellates. The authors generated new transcriptome data from Karenia mikimotoi, Karenia papilionacea, Karlodinium micrum, Karlodinium armiger, and Takayama helix. Combining them to the previously published transcriptome data from kareniacean dinoflagellates, they constructed the pan-kareniacean transcriptome library. They surveyed plastid-targeted protein-coding transcripts in the dataset, and consequently they estimated ~14.5% of the transcriptome data were of plastid-targeted ones. Of them, 65-80% were derived from a peridinin-containing dinoflagellate ancestor while ~15% were derived from EGTs from a haptophyte endosymbiont of the current plastid origin. By using the plastid-targeted transcript dataset, they investigated 1) origins of the plastid-targeted protein-coding transcripts by single gene-trees, 2) the plastid origin and evolution by the multigene dataset of 22 conserved plastid-targeted protein-coding transcripts and of 3) plastid genome-derived transcripts, 4) plastid functions, 5) diversity of plastid-targeted signals in kareniacean dinoflagellates, and 6) the distributions of kareniacean species by using the Tara Oceans database. On the basis of their results, they proposed many hypotheses regarding kareniacean dinoflagellate evolution, such as i) the chrysochromulinales-origin of the plastids, ii) more recent acquisition of the plastid than previously thought, iii) a plastid replacement within kareniaceae evolution, iv) the strict selection of signal peptides but non-conserved transit peptides in the kareniacean plastid-targeted proteins, and v) correlated or non-correlated distribution patterns of kareniaceaen dinoflagellates to specific haptophyte lineages.

      Although their proposals are interesting, I have many concerns to be addressed. Especially, their analyses on which the above proposals are based seem to be still preliminary and inconclusive. To support their proposals more confidently, I also suggest some additional analyses.

      Major comments

      1. seemingly inconsistency between the authors' claims The most striking is inconsistency of the authors' claims proposed in this manuscript. Their proposals include a) the common ancestor of kareniaceans has not possessed a fucoxanthin plastid but the plastid has been acquired more recently, b) an ancestor of Takayama and Karlodinium has gained a fucoxanthin plastid from a (chrysochlomulinales) haptophyte, c) an ancestor of Karenia has gained a fucoxanthin plastid from Karlodinium.

      However, they also demonstrate a higher proportion of plastid-late proteins in Karenia than Karlodinium and Takayama. If I understand correctly, "a higher proportion of plastid-late proteins in Karenia than Karlodinium and Takayama" would seemingly be inconsistent to and challenge two of the authors' claims: no haptophyte-derived plastid in the common ancestor of kareniacean dinoflagellates and a Karlodinium-to-Karenia plastid transfer (Fig. 7). If the Karenia plastid is derived from Karlodinium, I have no idea why haptophyte-derived plastid proteome of Karenia is larger than that of Karlodinium. After the plastid acquisition in Karenia, Karenia might have gained more genes for plastid-targeted proteins from haptophytes by LGTs. If this is true, many single gene trees would suggest different origins of plastid-targeted proteins between Karenia and Karlodinium/Takayama. Can we see it in the single gene analyses? I would like authors to rationalize the inconsistency in the main text. 2. Signal peptide prediction I think the modified ASAFind would be greatly helpful for future studies on automatic prediction of plastid proteomes in kareniacean dinoflagellates. However, I found no data on selection criteria for the signal peptide prediction program SignalP5.0 used. I believe such data would be very important to interpret the previously published paper by Gruber et al. in which prediction methods for plastid-targeting sequences are compared to each other to see how sensitively and specifically they can capture the plastid proteomes.

      Gruber et al. 2020. Comparison of different versions of SignalP and TargetP for diatom plastid protein predictions with ASAFind.

      According to Gruber et al. (2020), signalP5.0 is not suitable for prediction of signal peptides for diatoms, in consistent with the authors' claim for kareniacean dinoflagellates. This inconsistency would be difference of the nature in signal peptides between diatoms and kareniacean dinoflagellates. Even if so, it would be useful to see quantitatively how much different their signal peptides are in terms of their suitable prediction programs.

      I also have a concern about use of the combination of PrediSI and ChloroP, combination which is suitable for the plastid proteome prediction in Euglena gracilis. The authors should rationalize why the method for Euglena plastids can be applicable without any modification to the plastid proteome prediction in kareniacean dinoflagellates. Although Euglena plastids are enclosed by three membranes, kareniacean plastids are by four. Therefore, from the side of molecular mechanisms in protein import, the method suitable for Euglena plastids is not necessarily suitable for kareniacean dinoflagellate plastids. By using PrediSI and ChloroP, they detected additional "candidate plastid proteomes" including several proteins not detectable by SignalP5.0 and the modified ASAFind. That seems great. However, they did not seem to consider false positives since there is no mention on it. Although the additional candidates predicted by PrediSI and ChloroP included true plastid proteins of kareniacean dinoflagellates, many might not be. Nevertheless, the authors suggest 7.5 to 14.5% in K. micrum and K. brevis, respectively, are of plastid-targeted ones. I am so afraid if the proportions would be highly overestimated due to false positives by PrediSI and ChloroP. To rationalize the use of PrediSI and ChloroP, the authors should show sensitivity and specificity by quantitative analyses with a benchmark dataset. 3. Origin and evolution of kareniacean plastids The authors suggest the chrysochromulinales origin of the kareniacean dinoflagellate plastids and the Karlodinium-to-Karenia plastid transfer, on the basis of phylogenetic analyses using the concatenated datasets with the 22 conserved plastid-targeted proteins and with plastid-genome derived transcripts. It is very interesting that those plastid-targeted proteins in kareniacean dinoflagellates might be phylogenetically closely related to chrysochromulinales haptophyte I have suggestions on the analyses and interpretation

      As the 22 analyzed genes are nuclear-encoded plastid targeted genes, they are a quite small portion of entire plastid proteins. I am not convinced by that evolution of the small number of genes reflects evolution of fucoxanthin plastids of which proteomes are comprised of >1000 proteins. How many genes for haptophyte-derived plastid-targeted proteins suggest the monophyly of kareniaceaen dinoflagellates and chrysochromulinales haptophytes should be investigated by, for example, a coalescence-based analysis such as Astral for all the detected haptophyte-derived plastid-targeted proteins including the 22 genes. This is because the monophyly could be reconstructed only by one or few, limited number of proteins even if the concatenated dataset is analyzed.

      Relevant to this, plastid-targeted proteins derived from a peridinin-containing ancestor might still have phylogenetic signals of host evolution. I am interested in whether such analyses with peridinin plastid-derived plastid-targeted proteins reconstruct Takayama and Karlodinium as monophyletic but separate Karenia from them, as suggested in the phylogenomics with non-plastid proteins.

      For the phylogenetic analysis of plastid genome-derived transcripts, I might be wrong, but I could not find any information on dataset sizes (i.e., the numbers of sites) and evolutionary models for the analyses in the main text nor supplementary document. Although one may see the dataset sizes when looking at the original datasets in the supplementary files, such information is substantial and thus is to be described in the materials and methods section. I am afraid if this analysis was performed with a small dataset size. I would like to know total lengths of the concatenated sequences and especially that for Takayama. The phylogenetic position of Takayama, distantly related to the other kareniaceans, in this tree might be caused by a larger portion of gaps in the Takayama sequences than in the other kareniaceans. Moreover, due to lack of the plastid genome sequence of Takayama, no one could confidently identify plastid genome-derived transcripts: some of those could be derived from second, nuclear copies that might be pseudogenes. Otherwise, even if they are plastid-derived, no one can evaluate whether they are transcripts after or prior to RNA editing. I am afraid if the dataset used is comprised of a mixture of edited and non-edited sequences in kareniacean sequences. Either of sequences after or prior to RNA editing, latter of which are identical with DNA sequences, should be consistently used for the phylogenetic analysis. In any case, the plastid genomes are necessary for this analysis, and the authors can easily obtain them by DNAseq as they have the cultures.

      In addition, although I might be wrong, the phylogenomic analysis for plastid-encoded transcripts might be performed with their nucleotide sequences according to the figure title and legend of Figure S4 mentioning "nucleotide phylogenetic matrix" and the file name "plastid_coded_nt_concatenation_files.tar". If so, translated amino acid sequences should be subjected to phylogenetic analysis, to avoid a well-known artifact that is caused by saturation of substitutions at the 3rd codon. 4. Duplication of an ATP synthase subunit Duplication and relocation of ATP synthase subunit delta seems interesting. In figure S6.4.1, could you clarify why the possible extensions containing signal peptides lack the initiation methionine at N-termini? I wonder they are 5′ UTRs but artifactually detected as signal peptides, if they all indeed lack Met. To evaluate this point, I recommend 5′ RACE followed by transformation into a model organism as performed in previous studies by some of the authors. 5. Comparison of transit peptides Amino acid compositions in transit peptides would vary when targeted compartments are different. In complex plastids, there are functionally distinct compartments: lumen, stroma, periplastidal compartment (PPC). Comparison should therefore be conducted separately for lumen-targeted, stroma-targeted and PPC-targeted proteins in order to claim their transit peptides are not conserved. 6. RDS never possessed a stable fucoxanthin plastid Although the authors cite Hehenberger et al. 2019 for that RDS never possessed a stable fucoxanthin plastid, as far as I know, that paper seems not to mention it. Could you let me know where that is mentioned in the paper? Hehenberger et al. instead proposed the retention of non-photosynthetic peridinin plastid. Regardless of whether Hehenberger et al. mentioned or not, Novák Vanclová et al. propose that RDS never possessed a stable fucoxanthin plastid because, if I understand correctly, they detected no or few haptophyte-derived RDS genes for plastid-targeted proteins of which origins are shared with those of Karlodinium, Karenia, and Takayama. What about the possibility that the last common ancestor of kareniacean dinoflagellates possessed a fucoxanthin plastid in addition to peridinin plastid followed by almost complete losses of those haptophyte-derived genes after loss of a fucoxanthin plastid in evolution leading to RSD? Free living eukaryotes were appeared to have lost a plastid in recent studies and they have only a few or no genes showing evidence of a plastid previously retained. We cannot rule out that an ancestor of kareniacean dinoflagellates possessed both of peridinin and fucoxanthin plastids, as the authors mention in the main text, and either plastid was inherited to each lineage by differential losses. Accordingly, I would say Fig. 7 is a too much strong proposal as alternative hypotheses are still present. They should be introduced equally. 7. rRNA copy numbers in dinoflagellates It is known that the rRNA gene copy number varies among populations or strains in dinoflagellates; some possess several dozens of times as many rRNA gene copies as others (Galluzzi et al. 2010). Is it informative to see the ocean wide rRNA gene amplicon data for the kareniacean dinoflagellates? The numbers of rRNA gene-derived reads would not necessarily reflect the cell abundance of dinoflagellates.

      Galluzzi et al. 2010. Analysis of rRNA gene content in the Mediterranean dinoflagellate Alexandrium catenella and Alexandrium taylori: implications for the quantitative real-time PCR-based monitoring methods. J Appl Phycol 22:1-9

      Minor points

      1. the dataset size for the 241 protein-based host phylogeny should also be described in the main text.
      2. The authors mention in Discussion "Thus, our results illuminate the mechanistics of a fundamental process that may under pin vast tracts of chloroplast evolution". If I understand correctly, I think this is based on "shopping bag model" when considering plastid replacements in dinoflagellates. It is helpful to add more details to clarify why the authors would like to claim so. "Chloroplast" should be replaced with "plastid".
      3. Supplementary document S6.6 I found the term nitrogen fixation, but should this be replaced with "nitrogen assimilation"?
      4. Figure S5 For those LGTs, all the trees should be shown in supplementary text as they are only 11 or 12 trees. Especially, please add the chlorophyllide b reductase and chlorophyllase in the figure.
      5. References I am not picky about a format of the reference list, but I think it should be consistent throughout the list. I recommend adding journals, volumes, and pages precisely for cited papers. I found lack of them at least in Novak Vanclova et al. and Pierella Karlusich et al.
      6. Figures In figure 3, I strongly recommend adding RDS data, while distinguishing them by another color if they are derived from different origins from those of Karenia, Karlodinium, and Takayama. This would make the authors claim clearer that there are few haptophyte-derived genes for plastid targeted proteins of which origins are shared with those of the other kareniacean dinoflagellates. In figures S5.1-2 showing LGTs, I found two paralogs of kareniacean dinoflagellates. What does "CP" mean? If "CP" means ChloroPlast-targeted, both paralogs of K. brevis in HARS and those of K. micrum are of plastid-targeted in TARS and they do not have cytosolic ones. I am afraid if these cases are caused by false positives of detection for plastid-targeted proteins by PredSI and ChloroP. Similarly, in figure S5.4, I found two distant paralogs of heam oxygenase in the tree and the taxon names for both types in kareniaceans include "CP." Are both targeted to the plastids or of false positives?

      Significance

      General assessment: provide a summary of the strengths and limitations of the study. What are the strongest and most important aspects? What aspects of the study should be improved or could be developed?

      This study by Novak Vanclova et al. provide new transcriptome datasets from multiple species in kareniacean dinoflagellates including harmful and toxic species. Their transcriptome datasets would help understand their biology, evolution, and ecology. The authors also provide a program that predicts plastid proteomes in those dinoflagellates, which would be useful for future studies to focus on kareniacean dinoflagellate plastids, after further refinement. The most important aspect of this study is that many plastid-targeted proteins might be derived from a particular haptophyte lineage, although it is still not sure whether they are derived from LGTs or EGTs. Phylogenetic analyses performed in this study should be improved by adding some plastid genomes, in order to gain more conclusive results. In addition to methods, interpretation of the current results and proposals on plastid evolution should be toned-down.

      Advance: compare the study to the closest related results in the literature or highlight results reported for the first time to your knowledge; does the study extend the knowledge in the field and in which way? Describe the nature of the advance and the resulting insights (for example: conceptual, technical, clinical, mechanistic, functional,...).

      Although there are technical issues, this study improves our conceptual understanding the plastid proteome evolution in Kareniacean dinoflagellates. The plastid proteomes are comprised of proteins with more various origins in those dinoflagellates, suggesting more complex plastid proteome evolution than previously thought.

      Audience: describe the type of audience ("specialized", "broad", "basic research", "translational/clinical", etc...) that will be interested or influenced by this research; how will this research be used by others; will it be of interest beyond the specific field?

      This study seems to be "basic research".

      Please define your field of expertise with a few keywords to help the authors contextualize your point of view. Indicate if there are any parts of the paper that you do not have sufficient expertise to evaluate.

      algal evolution, eukaryotic evolution, mitochondrial metabolisms, plastid metabolisms, phylogenomics

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      This is a well done, detailed bioinformatic analysis of genomic and transcriptomic data from an important lineage of dinoflagellates that have undergone serial substitution of their plastid. On the whole I am enthusiastic about the paper; it presents valuable new insights, and is rigorously performed. However, I have to object to the way the term "proteome" is used in the paper; the manuscript is talking about the predicted proteome, not a measured proteome. This is something of a technical distinction, but it is an important one because the transcriptome and the proteome don't necessarily track each other, and there is little or no actual proteomic data available from dinoflagellates. We assume that transcript abundance has something to do with proteome abundance, but this is often violated. What this paper is really addressing is the potential proteome, because if a given gene is completely absent from the genome and the transcriptome we can be confident it will not be present in the proteome. The converse is not true. For this reason I feel it is important to be clear on the distinction. I would be satisfied in this regard by minor modifications, using the term "predicted proteome" in the title, and being more direct in the introduction about the distinction.

      Overall the analyses are impressive. I do have to squirm a little when I see automated analyses generating alignments where the threshold is less than 75% gaps and at least 100 nucleotides aligned. I looked at the supplementary data and the figshare files and could not find the alignments themselves, so I don't know what fraction of the sequences are in that territory. Because phylogenetic analysis (as performed here) treats the alignments as an observation, and because the alignments include sequences with more than 50% gaps, it is entirely possible that some taxa, or even whole segments of the tree, are based on non-overlapping data.

      Mind you, we have done similar analyses, and I don't think this invalidates the results, but it does open up the possibility of some dramatic artifacts. Consequently, I would recommend a) making the alignments available (or more obvious where to find them), and b) providing more detail on the alignments, including, if possible, to add a figure (probably in the supplementary data) that visualizes them. It is not given in the text itself, but according to the figure 2 caption there are 22 sequences thought to be "plastid late", and 241 in the pan-eukaryotic dataset. This is a scale that is feasible to put in a figure showing, for example, each aligned residue as a color and indels as grey. Such a figure is readable even when the individual residues are only a few pixels in size (less than a millimeter when printed). I also recommend describing the final alignments more fully in the text. Most of the summary statistics are presented in normalized form, and that can obscure patterns that come from poorly sampled taxa.

      Better clarify on the characteristics of the alignments will make it easier to interpret the findings overall. Although this is critical to interpreting the results, gappy alignments are not uncommon in analyses of this sort, and setting that aside the analyses presented are comprehensive and thorough. The discussion does a good job of addressing the significance of the work, and potential causes of error are addressed adequately (aside from the matter of the alignments).

      Significance

      I find the paper to be exciting and important. These organisms are economically important, particularly as potential nuisance organisms, but also because of their role in primary productivity. They also have extremely complex evolutionary histories and similarly complex genomes. performing any bioinformatic analysis of these organisms is a substantial challenge because almost every gene exists in high copy number and with complex and often obscure patterns of homology. The manuscript brings forward these challenges, and makes a substantial step forward in elucidating the evolution of a group that is fascinating and important, but remarkably difficult to work with. I feel that it is an important analysis, and should be of interest to a broad audience.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      The manuscript investigated the composition of the plastid proteomes of seven distantly-related kareniacean dinoflagellates, including newly-sequenced members of three genera (Karenia, Karlodinium, and Takayama). Using a custom plastid-targeting predictor, automatic single-gene tree building and phylogenetic sorting of plastid-targeted proteins for plastid proteome construction, the authors suggest that the haptophyte order Chrysochromulinales is the closest living relative of the fucoxanthin plastid donor. Interestingly, the N-terminal targeting sequences of kareniacean plastid signal peptides, reveal a high sequence conservation. Moreover, ecological and mechanistic factors are suggested that may have driven the endosymbiotic acquisition of the fucoxanthin plastid. Overall, this is a comprehensive and interesting analysis.

      Other comments.

      1. For analyses of N-terminal targeting sequences, why did the authors not consider to employ Predalgo as an additional tool?
      2. Given the fact that peridinin or fucoxanthin pigment binding is in the focus of the paper, a more detailed introduction of the peridinin and fucoxanthin light-harvesting systems should be given.
      3. The authors state "It is also possible that there has been a direct niche competition between the peridinin and fucoxanthin plastid that may have coexisted in the same host for a period of time with possibly different selective pressure on retention of their respective proteins based on their interaction with plastid-encoded components, e.g., extrinsic photosystem subunits not assembling correctly with their intrinsic haptophyte-like counterparts." It is tempting to ask, whether peridinin light-harvesting systems have left traces in the fucoxanthin plastid, possibly due to mistargeting of peridinin light-harvesting systems into the fucoxanthin plastid? Are some photosynthetic subunits "in-between" peridinin and fucoxanthin plastids?
      4. Figure 3 is difficult to understand, e.g. for PSI and PSII which subunits are shown, why has PSI "more" contribution from dinoflagellates as compared to PSII?
      5. Data shown in figure 4, is there experimental evidence for signal peptide cleavage site(s). Could these data been used to predict mature plastid targeted protein sequence?
      6. The authors state "Partial Least Square (PLS) analysis shows a set of environmental variables (salinity, silicate, iron) positively correlated with abundances of both Karenia and Takayma and also haptophytes as a whole, but at the same time negatively correlated to Karlodinium (Figure S8), further illustrating that the latter genus is quite distant from the rest in its biogeographical pattern." How could this be interpreted in the light of the plastid proteomes?

      Significance

      The current manuscript gives insights into the endosymbiotic acquisition of the fucoxanthin plastids.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      General Statements

      Ezrin, Radixin, and Moesin (ERMs) serve as crucial cytoskeletal linker proteins, connecting the actin cytoskeleton to the plasma membrane upon activation. ERMs are essential regulators of cell morphogenesis across every cell types reported so far, and have been implicated in vital cellular functions such as migration, and invasion. In our study, we discovered that ERMs are dispensable for the cortical organization of macrophages. In accordance with this surprising finding, we found that the migration of macrophages was not affected upon knock-out of the three ERMs. Our findings challenge the prevailing belief that ERMs universally regulate cortical organization. Instead, they indicate that the actin cortex of macrophages has evolved to possess a high degree of adaptability and plasticity, enabling these immune cells to function independently of ERM proteins.

      We thank the editors of Review Commons that handled our manuscript and all three reviewers for their positive assessment of our manuscript and for their constructive suggestions.

      Description of the planned revisions

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      In the manuscript, the authors systematically test the role of ERM proteins in macrophages using RNA silencing as well as the genetic knockout approaches. Previous studies have highlighted the fundamental importance of ERM proteins as structural and regulatory components of the cell cortex governing several essential functions such as the generation of surface features such as filopodia, maintenance of cortex-plasma membrane attachment, bleb retraction, cortical mechanics, and cell migration. The authors performed a series of experiments to comprehensively test each of these functions (including cell migration in 2D surface and 3D matrix in vitro, ex vivo on tumor implants, as well as in vivo) and found that none of these are significantly affected when ERM proteins are downregulated in macrophages. Overall, the paper is solid, the experiments are well-designed and conclusive, and the manuscript is written well.

      We thank the reviewer for these encouraging comments.

      I have no significant concerns with the study. My only experimental suggestion is related to a previously shown function of ERM protein in macrophages- the ERM proteins play an important role in phagosome maturation in macrophages (Defacque et al., EMBO, 2000; Lars-Peter et al., PNAS, 2006; Mylvaganam et al., Current Biology, 2021). It would be nice if authors could explore this phenotype in their perturbation system.

      We thank the reviewer for this valuable suggestion. ERM proteins have indeed been proposed as important for macrophage phagocytosis. Importantly, their necessity for the early steps of this process is still debated, as conclusions differ depending on the cellular model used and the type of particle to be internalised (Erwig et al., PNAS USA 2006; Di Pietro et al., Sci. Rep. 2017; Gomez and Descoteaux, Biochem. Biophys. Res. Commun. 2018; Mu et al., Nat. Commun. 2018; Okazaki et al., J. Physiol. Sci. 2020). While the implication of ERMs in the early steps of phagocytosis remains controversial, there seems to be a consensus to implicate ezrin and moesin in phagosome maturation (Defacque et al. EMBO 2000 ; Erwig et al., PNAS USA 2006; Marion et al., Traffic 2011; Gomez and Descoteaux, Biochem. Biophys. Res. Commun. 2018).

      We have already started addressing the ability of ERM-depleted macrophages to perform phagocytosis. In particular, we quantified the dynamics of phagocytosis of ovalbumin-coated or IgG-opsonized polystyrene beads, which did not reveal any difference between WT and ERM-depleted macrophages.

      Proposed revision: We propose to include in the manuscript our quantification of IgG-coated and non-coated phagocytosis, and evaluate whether phago-lysosome fusion is delayed in ERM-depleted macrophages.

      A minor concern with the study is, as the authors have already pointed out, that ERM proteins may still be required for some functions in macrophages under specific (environmental?) conditions. It is of course impossible to experimentally test all possible conditions that may involve ERMs, however, the authors should include a note on the hypothetical conditions that may require ERMs in macrophages. They should also discuss possible hypothetical reasons why macrophages may have evolved a cortex that does not rely on ERM proteins for specific functions. Overall, a more extended discussion on the role of ERM proteins (or the lack of them) in macrophages is required.

      As suggested, in the revised version of the manuscript we will add a more extensive discussion of the role of ERM proteins in macrophages, and in particular the hypothetical conditions that might require their presence, as well as the reasons why macrophages have developed a particular cortex.

      Reviewer #1 (Significance (Required)):

      The manuscript is important on many accounts: The ERM proteins are considered crucial membrane-cytoskeletal linkers in many cellular systems. The study presents a surprising finding that cortical phenomena requiring membrane-cytoskeletal attachment do not essentially need ERM proteins providing a fundamental conceptual advance. The results from this study will also inform both experimental as well as theoretical studies of cortical organization and dynamics in the future. Furthermore, overexpressed mutant forms of ERMs are used as sensors as well as perturbing agents of cortical actin dynamics in many cellular systems. These utilities can now be further substantiated and if required, revised in light of the results from this study.

      I am an immune cell biologist specializing in early lymphocyte activation and cytoskeleton dynamics.

      We would like to thank the reviewer for pointing out the importance of our work for our understanding of the function of the cellular cortex, and for highlighting the fact that it may lead to a reinterpretation of the results obtained using ERM mutants.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      Summary ERM proteins are known to play a central role in linking the cortical actin cytoskeleton with the plasma membrane, which is involved in regulating a diverse range of actin-rich membrane structures. The authors question the role that ERM proteins play in regulating cell shape changes and migration, specifically in macrophages. To test this, they designed an approach to systematically delete each ERM in macrophages - followed by the production of a triple-ERM ko line (tKO) using HoxB8 myeloid progenitor cells. The tKO line was subjected to a series of in vitro and in vivo experiments - all of which involve a series of imaging techniques to monitor membrane dynamics, protein subcellular organisation and cellular behaviours (e.g. rolling fraction, sticking fraction and chemotaxis). Their overall conclusion is that ERM are dispensable for macrophage membrane structures and migration.

      General comments.

      The experiments are very well executed. The manuscript in short demonstrates that the ERM proteins are dispensable for macrophage migration (both in 2D and 3D contexts), but there is very little beyond this work that points to what they might be doing instead. In this regard, given that the focus is exclusively on macrophage migration, the work comes across as quite specialised.

      We thank the reviewer for appreciating the quality of our work.

      We respectfully disagree to their assessment of the limited scope of our findings. Given the crucial importance of the migration of macrophages for so many of our body's functions, our findings will have a wide-ranging impact. Furthermore, and as acknowledged by Reviewers 1 and 3, we believe that the discovery that ERMs do not play a universal role in cortical mechanics and in cell migration, as hitherto believed, reaches a much wider scientific audience than that of the macrophage field. By proposing a unique research model (a triple KO for ERMs), our work allows to question many studies carried out with less direct molecular tools, such as the use of drugs or mutants of ERMs.

      We acknowledge the fact that although our data convincingly demonstrate that the ERM proteins are dispensable for macrophage migration, they do not reveal alternative functions for these proteins. We agree that it could be interesting to search for alternative functions for ERM proteins in macrophages in future studies. However, we believe that such studies are out of the scope of the present manuscript.

      The biggest concern I have is with the in vivo part. It should be noted that the work outlined in the manuscript does not actually address diapedesis, which is monitoring transmigration from the blood into tissue. Rolling and sticking do not define diapedesis. The experiments that the authors have conducted may have captured diapedesis events, but that very much depends on the length of time that the IVM was conducted. The authors would need to qualify their claims in this regard. Removing this work altogether would not lessen the impact, given that diapedesis is not shown. The work would therefore be very much in vitro/ex vivo.

      We agree with the reviewer that, due to technical limitations, we only measured the rolling and sticking capacity of the +/-ERM cells and did not measure diapedesis directly. Following Reviewer's comments, we have thus modified the text of the manuscript and no longer use the term ‘diapedesis’ to describe our in vivo intravital imaging studies.

      We also clarified the fact that we did not inject differentiated macrophages into the circulation, but macrophage precursors obtained by the treatment of progenitors with a 1 day treatment only (and not a 7 day treatment) with 20 ng/mL M-CSF.

      Here, highlighted in yellow, are the changes to the text (in the Introduction, Results, Methods and Legends sections):

      Introduction, p3:

      “Surprisingly, we found that ERMs are dispensable for macrophages to migrate in diverse contexts, including in vitro 2D migration and 3D invasion of extracellular matrix, ex vivo tissue infiltration through healthy dermis and tumor tissue, and for the in vivo adhesion of macrophage precursors to an activated endothelium.”

      Results, p6:

      ERM tKo cells without ezrin, radixin, and moesin exhibit no impairment in their ability to adhere to vascular endothelium in vivo and infiltrate the ear derma or fibrosarcoma.

      To further investigate the migratory properties of ERM-deficient cells in vivo, we first assessed their ability to adhere to activated vascular endothelium into mice bearing a fibrosarcoma (Gui et al., 2018).”

      Results, p8:

      “Our study uncovered a surprising finding: ezrin, radixin and moesin are dispensable for key aspects of macrophage behavior, including the formation of lamellipodia and filopodia, the dynamics of membrane ruffles and podosomes, migration in vitro (in 2D or 3D matrices) and ex vivo (into dermis or tumor tissues) as well as for the in vivo adhesion of macrophage precursors to activated vascular endothelium).”

      Methods, p14:

      “In vivo analysis of adhesion to vascular endothelium with wide-field intravital microscopy”

      And

      “HoxB8-progenitors were directed towards monocyte/macrophage differentiation using a 1 day treatment with 20 ng/mL mouse M-CSF.”

      Figure 4 legend, p33:

      Fig. 4: ERM tKO cells have no defect in adhesion to vascular endothelium in vivo and infiltrate tissues explants ex vivo

      1. In vivo adhesion to vascular endothelium

      Fibrosarcoma cells were injected into the flank of a mice. After a week, tumor was exposed for intravital microscopy, and the femoral artery of recipient mice was catheterized for injection of exogenous cells. Differentially labeled WT and TKO-ERM macrophage precursors were injected in the blood and their behaviour in tumor blood vessels was assessed by real-time imaging. Rolling fractions were quantified as the percentage of rolling cells in the total flux of cells in each blood vessel, and sticking fractions were quantified as the percentage of rolling cells that firmly adhered for a minimum of 30 seconds.”

      Proposed revision: We propose to keep the results of the in vivo experiments in the manuscript, including the modifications proposed by the reviewer and listed above.

      Specific questions

      How sure are the authors that they are capturing these events in cremasteric venules?

      As described in the Results and Methods section, these measurements were not captured in cremasteric venules but in fibrosarcoma tumour blood vessels, where we have previously demonstrated strong recruitment of circulating monocytes to infiltrate tumor tissue (Gui et al., Cancer Immunol. Res. 2018).

      Is there any sign of cells being trapped in the microcirculation?

      The diameter of the tumor blood vessels analysed is consistent with tumor post-capillary venules, and we have not seen cells trapped in these tumor blood vessels.

      The reason for injecting macrophages intravenously is not explained.

      We injected cells intravenously in order to compare their capacity to adhere to activated tumor blood vessels by intravital microscopy. This is now clarified in the corresponding result section (p6):

      “For that purpose, one day differentiated wild-type or ERM-deficient cells were fluorescently labelled with two different cell trackers, mixed in a 1:1 ratio, and co-injected intra-arterially into recipient mice in order to analyse their behaviour in tumor blood vessels by intravital microscopy.”

      Are these experiments modelling intravascular (patrolling) macrophages? Monocytes will typically differentiate into macrophages in tissue.

      We again apologize for the lack of clarity. In these experiments, we did not inject fully differentiated (seven days) macrophages but progenitors directed towards monocyte/macrophage differentiation using a 1 day treatment with 20 ng/mL mouse M-CSF. We believe that these experiments model the adhesion/recruitment of monocytes by activated vascular endothelium in the tumor microenvironment.

      The fact that the cells are able to "roll" and "stick" suggests that they have the complimentary cell adhesion molecules, although this is not addressed in the study.

      We agree with the reviewer. Our intravital microscopy analyses indicate that the injected cells have the complementary cell adhesion molecules for firm adhesion to activated tumor blood vessels. Importantly, our data clearly demonstrate that the capacity of ERM-tKO cells to bind vascular endothelium in the tumor microenvironment is similar to that of WT cells (Fig. 4A).

      Reviewer #2 (Significance (Required)):

      The strength of the manuscript is based on the robust in vitro experiments, however such experiments are difficult to address in vivo - mainly because of the issue that macrophages (unless patrolling macrophages) are not a useful model to investigate for ivm experiments.

      We thank the reviewer for recognizing the robustness of our in vitro experiments. We fully agree with the reviewer that the in vivo experiments are more challenging and that the behaviour of monocytes/(patrolling) macrophages is difficult to mimic in vivo. However, we believe that our intravital microscopy analyses are important because they demonstrate that ERM-tKO cells retain the capacity to bind firmly (sticking) to activated tumor blood vessels in vivo.

      This would be of great interest to the macrophage field, which is quite limited in scope. An advancement in the field would be to learn what is taking over the role of ERM in macrophages. As such, this becomes a report with a series of experiments to confirm that ERM are not involved.

      Again, we respectfully disagree with the reviewer, as this work goes against the dogma that ERMs are generally the most important mechanical links between the plasma membrane and the cytoskeleton. By clearly establishing that this is not the case in macrophages, cells whose importance for our immunity justifies the importance of their investigation, this study could make it possible to reconsider the functioning of the cellular cortex and the role of ERMs in other cellular systems.

      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      Verdys and colleagues report an elegant study in which the authors describe that ERM proteins are dispensable for migrating monocyte-derived macrophages. The methods are adequate and the results support the conclusions.

      We thank the reviewer for these very supportive comments.

      Major points:

      - Although the authors demonstrate, by multiple methods, the dispensability of ERM proteins in the migration of macrophages derived from monocytes, the role of these proteins must also be evaluated in the phagocytosis process (another relevant functional aspect of macrophages).

      This is an excellent suggestion, which should make it possible to clarify the role of ERMs in this important function of macrophages.

      ERM proteins have indeed been proposed as important for macrophage phagocytosis. Importantly, their necessity for the early steps of this process is still debated, as conclusions differ depending on the cellular model used and the type of particle to be internalised (Erwig et al., PNAS USA 2006; Di Pietro et al., Sci. Rep. 2017; Gomez and Descoteaux, Biochem. Biophys. Res. Commun. 2018; Mu et al., Nat. Commun. 2018; Okazaki et al., J. Physiol. Sci. 2020). While the implication of ERMs in the early steps of phagocytosis remains controversial, there seems to be a consensus to implicate ezrin and moesin in phagosome maturation (Defacque et al. EMBO 2000 ; Erwig et al., PNAS USA 2006; Marion et al., Traffic 2011; Gomez and Descoteaux, Biochem. Biophys. Res. Commun. 2018).

      We have already started addressing the ability of ERM-depleted macrophages to perform phagocytosis. In particular, we quantified the dynamics of phagocytosis of ovalbumin-coated or IgG-opsonized polystyrene beads, which did not reveal any difference between WT and ERM-depleted macrophages.

      Proposed revision: We propose to include in the manuscript our quantification of IgG-coated and non-coated phagocytosis, and evaluate whether phago-lysosome fusion is delayed in ERM-depleted macrophages.

      • How is the activation of key downstream targets of ERM proteins involved in macrophage migration in KO models?_

      This is a very pertinent question. However, while ERMs have been described as being downstream of several signalling pathways, their own downstream targets are unfortunately poorly documented and, to our knowledge, none are known in macrophages.

      In different cellular contexts, it has been proposed that ERMs regulate PI3K (Gautreau et al. PNAS USA 1999), Ras (Sperka et al. Plos One 2011) or that they are involved in the initiation of protein translation (Briggs et al. Neoplasia 2012), but these results have not yet been confirmed and we believe they are outside the scope of this study.

      During macrophage migration, we consider that their obvious main target is cortical actin, and demonstrate in this manuscript that the functional coupling between actin and the plasma membrane is not affected by full ERM knockout.

      Reviewer #3 (Significance (Required)):

      Advance: The present study fills a gap in the participation of ERM proteins in cell migration. The results obtained on the dispensability of these proteins in macrophage migration can pave avenues for identifying new processes and proteins associated with migration in this context.

      Audience: The audience for this study is very broad.

      We again thank the reviewer for recognising the importance of this work for the understanding of cell migration.

      My expertise: I have expertise in cellular and molecular biology with a focus on processes associated with cancer. Among the numerous research fronts of the group led by me, we recently identified the EZR gene (which encodes the ezrin protein) as a prognostic marker and molecular target in acute leukemias.

      Description of the revisions that have already been incorporated in the transferred manuscript

      In the revised version of the article, we have taken into account all relevant changes proposed by the reviewers. We modified the text of the manuscript and no longer use the term ‘diapedesis’ to describe our in vivo intravital imaging studies, and clarified the fact that we did not inject differentiated macrophages into the circulation, but macrophage precursors obtained by the treatment of progenitors with a 1 day treatment only (and not a 7 day treatment) with 20 ng/mL M-CSF.

      Here, highlighted in yellow, are the changes to the text (in the Introduction, Results, Methods and Legends sections):

      Introduction, p3:

      “Surprisingly, we found that ERMs are dispensable for macrophages to migrate in diverse contexts, including in vitro 2D migration and 3D invasion of extracellular matrix, ex vivo tissue infiltration through healthy dermis and tumor tissue, and for the in vivo adhesion of macrophage precursors to an activated endothelium.”

      Results, p6:

      ERM tKo cells without ezrin, radixin, and moesin exhibit no impairment in their ability to adhere to vascular endothelium in vivo and infiltrate the ear derma or fibrosarcoma.

      To further investigate the migratory properties of ERM-deficient cells in vivo, we first assessed their ability to adhere to activated vascular endothelium into mice bearing a fibrosarcoma (Gui et al., 2018). For that purpose, one day differentiated wild-type or ERM-deficient cells were fluorescently labelled with two different cell trackers, mixed in a 1:1 ratio, and co-injected intra-arterially into recipient mice in order to analyse their behaviour in tumor blood vessels by intravital microscopy.”

      Results, p8:

      “Our study uncovered a surprising finding: ezrin, radixin and moesin are dispensable for key aspects of macrophage behavior, including the formation of lamellipodia and filopodia, the dynamics of membrane ruffles and podosomes, migration in vitro (in 2D or 3D matrices) and ex vivo (into dermis or tumor tissues) as well as for the in vivo adhesion of macrophage precursors to activated vascular endothelium).”

      Methods, p14:

      “In vivo analysis of adhesion to vascular endothelium with wide-field intravital microscopy”

      And

      “HoxB8-progenitors were directed towards monocyte/macrophage differentiation using a 1 day treatment with 20 ng/mL mouse M-CSF.”

      Figure 4 legend, p33:

      Fig. 4: ERM tKO cells have no defect in adhesion to vascular endothelium in vivo and infiltrate tissues explants ex vivo

      1. In vivo adhesion to vascular endothelium

      Fibrosarcoma cells were injected into the flank of a mice. After a week, tumor was exposed for intravital microscopy, and the femoral artery of recipient mice was catheterized for injection of exogenous cells. Differentially labeled WT and TKO-ERM macrophage precursors were injected in the blood and their behaviour in tumor blood vessels was assessed by real-time imaging. Rolling fractions were quantified as the percentage of rolling cells in the total flux of cells in each blood vessel, and sticking fractions were quantified as the percentage of rolling cells that firmly adhered for a minimum of 30 seconds.”

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Verdys and colleagues report an elegant study in which the authors describe that ERM proteins are dispensable for migrating monocyte-derived macrophages. The methods are adequate and the results support the conclusions.

      Major points:

      • Although the authors demonstrate, by multiple methods, the dispensability of ERM proteins in the migration of macrophages derived from monocytes, the role of these proteins must also be evaluated in the phagocytosis process (another relevant functional aspect of macrophages).
      • How is the activation of key downstream targets of ERM proteins involved in macrophage migration in KO models?

      Significance

      Advance: The present study fills a gap in the participation of ERM proteins in cell migration. The results obtained on the dispensability of these proteins in macrophage migration can pave avenues for identifying new processes and proteins associated with migration in this context.

      Audience: The audience for this study is very broad.

      My expertise: I have expertise in cellular and molecular biology with a focus on processes associated with cancer. Among the numerous research fronts of the group led by me, we recently identified the EZR gene (which encodes the ezrin protein) as a prognostic marker and molecular target in acute leukemias.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary

      ERM proteins are known to play a central role in linking the cortical actin cytoskeleton with the plasma membrane, which is involved in regulating a diverse range of actin-rich membrane structures. The authors question the role that ERM proteins play in regulating cell shape changes and migration, specifically in macrophages. To test this, they designed an approach to systematically delete each ERM in macrophages - followed by the production of a triple-ERM ko line (tKO) using HoxB8 myeloid progenitor cells. The tKO line was subjected to a series of in vitro and in vivo experiments - all of which involve a series of imaging techniques to monitor membrane dynamics, protein subcellular organisation and cellular behaviours (e.g. rolling fraction, sticking fraction and chemotaxis). Their overall conclusion is that ERM are dispensable for macrophage membrane structures and migration.

      General comments.

      The experiments are very well executed. The manuscript in short demonstrates that the ERM proteins are dispensable for macrophage migration (both in 2D and 3D contexts), but there is very little beyond this work that points to what they might be doing instead. In this regard, given that the focus is exclusively on macrophage migration, the work comes across as quite specialised.

      The biggest concern I have is with the in vivo part. It should be noted that the work outlined in the manuscript does not actually address diapedesis, which is monitoring transmigration from the blood into tissue. Rolling and sticking do not define diapedesis. The experiments that the authors have conducted may have captured diapedesis events, but that very much depends on the length of time that the IVM was conducted. The authors would need to qualify their claims in this regard. Removing this work altogether would not lessen the impact, given that diapedesis is not shown. The work would therefore be very much in vitro/ex vivo.

      Specific questions

      How sure are the authors that they are capturing these events in cremasteric venules? Is there any sign of cells being trapped in the microcirculation? The reason for injecting macrophages intravenously is not explained. Are these experiments modelling intravascular (patrolling) macrophages? Monocytes will typically differentiate into macrophages in tissue. The fact that the cells are able to "roll" and "stick" suggests that they have the complimentary cell adhesion molecules, although this is not addressed in the study.

      Significance

      The strength of the manuscript is based on the robust in vitro experiments, however such experiments are difficult to address in vivo - mainly because of the issue that macrophages (unless patrolling macrophages) are not a useful model to investigate for ivm experiments.

      This would be of great interest to the macrophage field, which is quite limited in scope.

      An advancement in the field would be to learn what is taking over the role of ERM in macrophages. As such, this becomes a report with a series of experiments to confirm that ERM are not involved.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      In the manuscript, the authors systematically test the role of ERM proteins in macrophages using RNA silencing as well as the genetic knockout approaches. Previous studies have highlighted the fundamental importance of ERM proteins as structural and regulatory components of the cell cortex governing several essential functions such as the generation of surface features such as filopodia, maintenance of cortex-plasmamembrane attachment, bleb retraction, cortical mechanics, and cell migration. The authors performed a series of experiments to comprehensively test each of these functions (including cell migration in 2D surface and 3D matrix in vitro, ex vivo on tumor implants, as well as in vivo) and found that none of these are significantly affected when ERM proteins are downregulated in macrophages. Overall, the paper is solid, the experiments are well-designed and conclusive, and the manuscript is written well.

      I have no significant concerns with the study. My only experimental suggestion is related to a previously shown function of ERM protein in macrophages- the ERM proteins play an important role in phagosome maturation in macrophages (Defacque et al., EMBO, 2000; Lars-Peter et al., PNAS, 2006; Mylvaganam et al., Current Biology, 2021). It would be nice if authors could explore this phenotype in their perturbation system.

      A minor concern with the study is, as the authors have already pointed out, that ERM proteins may still be required for some functions in macrophages under specific (environmental?) conditions. It is of course impossible to experimentally test all possible conditions that may involve ERMs, however, the authors should include a note on the hypothetical conditions that may require ERMs in macrophages. They should also discuss possible hypothetical reasons why macrophages may have evolved a cortex that does not rely on ERM proteins for specific functions. Overall, a more extended discussion on the role of ERM proteins (or the lack of them) in macrophages is required.

      Significance

      The manuscript is important on many accounts: The ERM proteins are considered crucial membrane-cytoskeletal linkers in many cellular systems. The study presents a surprising finding that cortical phenomena requiring membrane-cytoskeletal attachment do not essentially need ERM proteins providing a fundamental conceptual advance. The results from this study will also inform both experimental as well as theoretical studies of cortical organization and dynamics in the future. Furthermore, overexpressed mutant forms of ERMs are used as sensors as well as perturbing agents of cortical actin dynamics in many cellular systems. These utilities can now be further substantiated and if required, revised in light of the results from this study.

      I am an immune cell biologist specializing in early lymphocyte activation and cytoskeleton dynamics.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We would like to thank all reviewers for their careful evaluation of our manuscript and their thoughtful feedback, which we could use to improve its quality significantly.

      Reviewer #1 (Evidence, reproducibility and clarity):

      Summary: This study addresses the problem of what is the optimal ribosome composition in terms of relative RNA and protein content, to ensure optimal growth rate and minimal energy waste. The RNA-world hypothesis suggests that primitive ribosomes were RNA-only objects, and in fact this would appear to be very advantageous from an energetic point of view, since RNA synthesis requires a much lower energy expenditure than protein synthesis. Yet a large fraction of present-day ribosome mass is protein, ranging from 30% to nearly 70% depending on the organism. The authors hypothesize that one of the main functions of ribosomal proteins is to stabilize the RNA and to protect it against degradation. According to their idea, the fast degradation of a protein-free rRNA would offset the energetic advantage given by its cheaper synthesis. To test the hypothesis, they developed a mathematical model whereby to evaluate the optimal ribosome composition under a number of different conditions.

      Major comments: The paper is well-written and very readable. I am not an expert of mathematical modelling, so I cannot go into the details of the model presented. As a biologist, I can say that the conclusion arrived at are reasonable and well-justified.

      We thank the reviewer for the positive evaluation.

      Perhaps the point of view is rather narrow, since ribosomal proteins are known to be important not only for RNA protection and ribosome stability, but also to ensure the accuracy of decoding and, in certain contexts, to allow the ribosomes to interact with other cellular ligands. The authors make only very slight reference to these questions, so it would be worthwhile to further comment on them.

      Thank you for your suggestion. To address it, we expanded the discussion as follows:<br /> "Finally, we need to consider that ribosomal proteins may play other roles in the cells, especially in eukaryotic organisms. Ribosomal proteins participate in translation processes, for example, binding of translation factors, release of tRNA, and translocation. They may also affect the fidelity of translation (Nikolay et al., 2015). Furthermore, they play roles in various cellular processes such as cell proliferation, apoptosis, DNA repair, cell migration and others (Kisly and Tamm, 2023). These additional functions might have conferred evolutionary fitness advantages. Nevertheless, the primary role of ribosomal proteins seems to be stabilization and folding of rRNA (Nikolay et al., 2015; Kisly and Tamm, 2023)."

      Furthermore, their explanation of why ribosome composition should be so different in different organisms (e.g. protein-poor bacterial ribosomes versus protein-rich archaeal ones) is not entirely convincing. For instance, they suggest that archaea may have protein-richer ribosomes than bacteria because they live in extreme environments, thus needing a further aid to stabilize the organelle. While this may be a factor, one must point out that non-extremophilic archaea (e.g. methanogens) have protein-rich ribosomes, making it obvious that other factors must be at play.<br />

      We appreciate the reviewer's feedback. Ribosome composition is indeed complex and influenced by various factors. While extreme environments (may) contribute to protein-rich ribosomes in archaea, it's important to note that not all archaea share this characteristic. Some, like Halobacteriales, Methanomicrobiales, and Methanobacteriales, have ribosomes with protein content similar to bacteria.

      Furthermore, there are species in both archaea and bacteria with low protein content in their ribosomes despite extreme habitats. This suggests that alternative strategies, possibly involving specific sequence variants in the rRNA (Nissley et al., 2023), play a role in stabilizing ribosomes. In our model, these findings would correspond to a decreased kdegmax. However, these sequence variants are not universal.

      Amils et al. (1993) suggest that protein-rich ribosomes in archaea are (more) ancient and proteins may have been lost in some species, possibly to favor higher growth rates (and in agreement with our theoretical analysis). An intriguing avenue for further research would be a phylogenetic analysis of archaeal evolution to investigate the emergence of different ribosome compositions.

      To address your concerns, we added the following paragraph to the discussion:<br /> "Additionally, some extremophilic organisms, such as the bacteria Chloroflexus aurantiacus or Fervidobacterium islandicum, exhibit ribosomes with lower protein content (approximately 40%) compared to extremophilic archaea (50%). It has been suggested that protein-rich ribosomes can be traced back to the oldest phylogenetic lineages, with some ribosomal proteins being lost over time (Amils et al., 1993; Acca et al., 1993). Organisms with lower protein content in their ribosomes may have evolved alternative strategies to thrive in extreme conditions. Examples of such strategies include the presence of specific rRNA sequence variants or base modifications, as recently discussed by Nissley et al. (2023).

      Moreover, certain archaeal species, such as those from Methanobacteriales or Halobacteriales, have transitioned to milder environmental conditions and subsequently shed unnecessary ribosomal proteins (Acca et al., 1993; Amils et al., 1993).

      To gain a comprehensive understanding of ribosome evolution in response to changing conditions, a thorough phylogenetic analysis is warranted. This analysis should be complemented by measurements of growth rate, translation rate, RNA degradation rate, among other parameters, to delineate the order of protein loss or gain, and the emergence of sequence variations and base modifications."

      Minor comments: none in particular. Referencing is adequate, text is clear and the figures are clear and well-organized.

      Thank you.

      Reviewer #1 (Significance):

      As I stated above, the main weakness of this study may be that it concentrates overwhelmingly on a single problem, i.e. the energetic cost of adding proteins to an RNA-only ancestral ribosome. On the other hand, this is a question seldom addressed when talking about ribosome composition, which indeed makes this paper valuable and interesting. The authors expand and advance a previous study of the same kind (to which they make ample reference).

      Although rather specialized, I think this paper, in its general conclusions, may be of interest to most of those working in the field of protein synthesis and ribosome evolution.

      Referee's keywords: archaea, ribosome evolution, translation, translation initiation

      Reviewer #2 (Evidence, reproducibility and clarity):

      The authors explore a mathematical model to rationalize the variable RNA content in ribosomes across species. The mathematical model particularly considers the idea that the protein-to-RNA ratio in ribosomes emerges as a consequence of faster rRNA than r-protein synthesis coupled with a faster degradation of rRNA. This is an interesting analysis. The idea is well explained and the math of the model is overall well explained. Overall, I thus support publication of this analysis.

      We thank the reviewer for the positive evaluation.

      However, while reading the manuscript I was continuously wondering about two major aspects which, I suggest, should be considered more prominently in the text:

      1. How clear is it that rRNA is more unstable than r-protein?
      2. Why should the translation rate (the speed with which ribosomes assemble new proteins) not be highly dependent on the ribosome-to-protein ratio (with some intermediate ratio ensuring efficient synthesis and efficient translation?

      Currently these points are considered briefly in the discussion part. I suggest that these points should at least be discussed more prominently in the introduction. I further appreciate any more detailed thoughts the authors have on these questions.

      Finally, I think the discussion section would benefit strongly from a more detailed consideration of possible future experiments. Which data is needed to probe the idea? What types of experiments could be performed to probe the model.

      We added a paragraph to the discussion with suggestions for experiments:<br /> "There are still many open questions about ribosome biogenesis and evolution. Our model could guide future experiments. There are a few studies that assessed the effect of individual rP deletions in E. coli, for example mutation in S10 increased RNA degradation (Kuwano et al., 1977), and mutation in L6 lead to disrupted ribosomal assembly (Shigeno et al., 2016). A systematic knock-out screen of all ribosomal proteins could be done (as in Shoji et al. (2011)), complemented with quantification of RNA degradation and misfolding.

      In case of extremophilic organisms with protein-rich ribosomes, temperature sensitivity could also be assessed. We would expect that deletion of the extra proteins would cause growth defects only at high temperatures.

      Furthermore, after removal of proteins from archaeal protein-rich ribosomes, laboratory evolution could be performed to see whether growth rate increases beyond wild-type.

      Comprehensive datasets, akin to the work of Bremer and Dennis in 2008 for E. coli, should be generated for non-standard organisms by measuring various parameters such as transcription and translation rates, ribosome and RNAP activities, and other relevant factors.

      Finally, as mentioned earlier, phylogenetic analysis or ribosome evolution across different species and environments could be done."

      More detailed comments:

      Regarding i: rRNA is pretty stable compared to other RNA types in the cell. The authors argue it is unstable. The specific question then seems to become how stable rRNA is compared to r-protein? Generally, proteins are also stable, but what data is available to support that r-proteins are more stable than rRNA?

      While rRNA that is already integrated into a ribosome is stable, nascent RNA may be susceptible to degradation (Jain, 2018). It has been observed that even during exponential growth, some rRNA is degraded (Gausing, 1997; Jain 2018) and the degradation rate increases if ribosome assembly is delayed (Jain, 2018). This suggests that rRNA that is synthesized in excess cannot be stored and used later. Furthermore, when rRNA is overexpressed in excess of rPs, it is rapidly degraded (half life 15-70 min) (Siehnel and Morgan, 1985).

      On the other hand, the turnover of proteins is negligible (Bremer and Dennis 2008), and most ribosomal proteins can exist in a free form without RNA. For example, under starvation/in stationary phase, rRNA is degraded, but most proteins are stable and can be reused later (Reier et al., 2022; Deutscher, 2003).

      The precise mechanisms of the rRNA instability are not clear. The simplest explanation is that rRNA that is not protected by rPs is attacked by RNases. Another option is that rRNA without proteins is difficult to fold and can get trapped in misfolded states. These are then degraded as a part of quality control. The model developed in this paper allows for both of these mechanisms.

      We added these references to the discussion:<br /> "In order to explain a mixed (RNA+protein) ribosome, we consider rRNA degradation in our extended model, thereby increasing the costs for RNA synthesis. While rRNA that is already integrated into a ribosome is stable, nascent RNA may be susceptible to degradation (Jain, 2018). Indeed, it has been experimentally observed that even at maximum growth rate, 10% of newly synthesized rRNA is degraded (Gausing, 1977), and the degradation rate increases if ribosome assembly is delayed (Jain, 2018). Furthermore, when rRNA is overexpressed in excess of rPs, it is rapidly degraded (Siehnel and Morgan, 1985). Due to the extremely high rates at which rRNA is synthesized, errors become inevitable, necessitating the action of quality control enzymes such as polynucleotide phosphorylase (PNPase) and RNase R to ensure ribosome integrity (Dos Santos et al., 2018). The absence of the RNases results in the accumulation of rRNA fragments, ultimately leading to cell death (Cheng and Deutscher, 2003; Jain, 2018).

      In contrast, protein turnover is negligible (Bremer & Dennis, 2008), and most ribosomal proteins can exist without rRNA and can be reused (Reier et al., 2022; Deutscher, 2003). Therefore, we do not consider protein degradation in our model."

      Regarding ii: Building on their model results, the authors rationalize the highly varying RNA-to-protein ratio in ribosomes across species. The model considers a non-varying rate with which ribosomes synthesize new proteins. This is briefly discussed in the discussion section. However, this appears to be a major assumption that, I think, should be stated clearly stated earlier in the text, including the abstract and introduction. Second, I wonder how the authors then rationalize variations in translation rate across species. Translation rates and the speeds with which ribosomes are varying strongly across species (indicated for example well by the change in the slope between ribosome content/rRNA and growth rate - slope in Fig. 2A). Why could the rRNA-to-protein ratio not be important in playing a role here?

      We decided not to consider the effect of rRNA/protein ratio in ribosomes on translation rate mainly because it is not clear in what way it affects it. Proteins are better catalysts than rRNA. Yet, eukaryotic ribosomes which have higher protein content, have lower translation rates. For archaea and mitochondria, we were not able to find data but it is unlikely that the translation rates are faster because the growth rates are not faster.

      We added a paragraph to the introduction that explains our assumption:<br /> "We focus on the primary role of ribosomal proteins, which is stabilizing rRNA (by preventing its degradation or misfolding).

      Ribosome protein content might also affect other parameters, such as translation rate. Proteins are generally better catalysts than RNA (Jeffares et al., 1998), but the ribosome's catalytic core is formed by rRNA (Tirumalai et al., 2021) and operates at a relatively slow catalytic rate compared to typical enzymes. This suggests that there is little evolutionary pressure to increase the catalytic rate. Furthermore, ribosomes with the lowest protein content, like the E. coli ribosome, exhibit the highest translation rates (Bonven and Gulløv, 1979; Hartl and Hayer-Hartl, 2009; Bremer and Dennis, 2008). Therefore, we do not consider the impact on translation rate in this study."

      And a sentence to the abstract:<br /> "In this study, we develop a (coarse-grained) mechanistic model of a self-fabricating cell and validate it under various growth conditions. Using resource balance analysis (RBA), we examine how the maximum growth rate varies with ribosome composition, assuming that all kinetic parameters remain independent of ribosome composition."

      More minor point, but I was also not sure about the justification that ribosome mass is constant (line 111). The mass of an amino acid and a nucleotide is quite different. Why should overall mass matter, and not for example the number of amino acids and proteins. I think it also would be good here to motivate the assumption better early on instead of commenting on it in the discussion section.

      Thank you for your suggestion. We agree with the reviewer that we should make our assumption of keeping the ribosome mass constant, which we used for simplicity, clearer from the beginning. Therefore, we have added the following statement to the introduction:<br /> "For simplicity, we assume a constant ribosome mass."

      Reviewer #2 (Significance):

      Protein synthesis by ribosomes is a major determinant of the rate with which microbes and other fast growing cells accumulate biomass. To better understand cell growth it is thus essential to better understand the makeup of ribosomes. Széliová et al present a mathematical model to entertain the idea that the varying RNA content in ribosomes across species is a consequence of RNA degradation. The model makes clear predictions which can guide future experiments.

      Reviewer #4 (Evidence, reproducibility and clarity):

      Summary

      In this manuscript, Széliová et al. used a simple self-replicating cell model to study why the ribosome consists of both RNA and protein from an economic point of view. Their base model predicts an RNA-only ribosome, which is not surprising since the smaller RNAP has a higher turnover number compared to the larger ribosome. When rRNA instability is included, the model predicts an "RNA+Protein" ribosome. In particular, the predicted ribosome composition is comparable to the measured ribosome composition when strong cooperative binding of ribosomal proteins to rRNA is considered. The authors conclude that the maximal growth rate is achieved by the real ribosome composition when rRNA instability is taken into account.

      Major comments:

      1. The authors modeled the rRNA degradation rate as a function of the concentration of fully assembled ribosomes (equation 5). However, only partially assembled ribosomes are susceptible to RNase, and they make up only a small fraction of total ribosomes. The majority of ribosomes are fully assembled. In addition, the turnover number obtained from Fazal et al. (2015) and used here is the degradation rate of double-stranded RNA, not the fully assembled ribosomes, which have a stable tertiary structure. In my opinion, the rRNA degradation rate should be modeled as a function of the concentration of partially assembled ribosomes (i.e., pre-R in Figure 7) rather than the concentration of fully assembled ribosomes.

      We agree with the reviewer that the way we model the process is not entirely biologically accurate. The problem is that even if we add the assembly intermediates, their concentration would be zero as they do not catalyze any reaction (similarly to the metabolites). Therefore, the degradation rate would also always be zero. Given the current modeling setup, the obvious proxy for the intracellular rRNA concentration is the rRNA concentration in the (assembled) ribosome, c_R*(1-x_rP).

      1. Compared to the work by Kostinski and Reuveni (2020), the authors have made an improvement by avoiding the use of constant ribosome allocation to ribosomal protein (Φ_rP^R) and RNAP (Φ_RNAP^R), allowing these parameters to vary with predicted growth rates (by changing 𝑥_rP). This is indeed important, as bacteria are very likely to adjust these parameters in response to different growth conditions. However, certain other growth rate-dependent parameters are still treated as constants (or treated as nutrient-specific parameters) across predicted growth rates under given conditions. For example, experiments have shown that the fraction of active RNAP (f_RNAP^act) and the ribosome elongation rate (k_R^el) are growth rate-dependent (Bremer and Dennis, 1996). In contrast, when the authors predict the maximum growth rate by changing 𝑥_rP, f_RNAP^act and k_R^el are held constant regardless of the predicted growth rates.

      The fraction of active RNAP (f_RNAP^act) was growth-rate dependent in all our simulations (see Table 2), only the fraction of active ribosomes (f_R^act) was kept constant according to Bremer and Dennis, 1996 & 2008.

      We decided to keep the elongation rate (k_R^el) constant similar to Scott et al. 2010 (their explanation is in the supplementary material “Correlation [1] and the control of ribosome synthesis”).

      We reran the simulations with variable k_R^el. It has no impact on the predictions of optimal ribosome composition. However, the linear dependence of RNA/protein ratio is less steep and predicts an offset at zero growth rate.

      We added the results to the supplementary material and the following text to the results section (for the base model):<br /> "…the base model correctly recovers the well-known linear dependence of the RNA to protein ratio and growth rate (Scott et al. 2010), see Figure 2a, but not the offset at zero growth rate, since our model does not contain any non-growth associated processes and we assume constant translation elongation rate kelR as in Scott et al. (2010). At low growth rate, kelR decreases, most likely because of the lower availability of the required substrates (Bremer and Dennis, 2008; Dai et al., 2016). Interestingly, when we use variable kelR, we observe a nonzero offset (Appendix 1, Figure 2)."

      and in a later section:<br /> "Using variable or constant kelR has no impact on the predicted optimal ribosome composition. As in the base model, variable kelR leads to predicted non-zero offset of RNA/protein ratio at zero growth rate (Appendix 1, Figure 6)."

      1. _If amino acids or nucleotides are provided in the media, the cell does not have to synthesize all of them de novo. However, the model assumes that the cell always synthesizes all amino acids or nucleotides de novo for growth on growth on amino acid-supplemented media or on LB. This problem could in principle be solved by assuming very fast kinetics of the metabolic reactions in these media, but that should be discussed in the manuscript. Furthermore, why does the turnover number for EAA depend on the growth rate while that of ENT is constant?<br /> > _

      We focused on the “enzyme” EAA because it forms a significant fraction of the proteome. However, for consistency, we now also made ENT turnover number depend on growth rate. It made no significant impact on the simulation results.

      We agree with the reviewer that the model is currently very simplified and the enzymes ENT and EAA are used even in the media supplemented with AAs/NTs. However, these enzymes represent lumped pathways that aim to take into account not only AA/NT synthesis but also the different ‘nutrient efficiencies’ of the carbon sources (as in Scott et al. 2010). Therefore, to approximate these effects we increase the kcat of EAA (and now also ENT) with growth rate.

      We added a paragraph to the results section to explain these simplifications:<br /> "We used parameters from E. coli grown in six different media. Three of them are rich media (Gly+AA, Glc+AA, LB) where amino acids (and nucleotides) are provided so cells only have to express the corresponding transporters instead of the synthesis pathways. In our model, the enzymes ENT and EAA represent lumped pathways for glycolysis and nucleotide / amino acid synthesis, and we only consider one type of transporter. Therefore, to model the changing `nutrient quality' of the different media (inspired by Scott et al. 2010), we assume that turnover numbers of EAA and ENT increase with growth rate."

      1. All parameters related to transcription (RNAP) and translation (ribosome) used in this manuscript are adopted from Kostinski and Reuveni (2020), which are slightly modified based on Bremer and Dennis' research (1996, 2008). However, the authors changed some of the original parameters or data points, but did not provide explanations for these changes:

      (a) The original data depicted a growth rate-dependent translation elongation rate, but Table 2 presents it as a constant value.

      Please see the reply to point 2 above.

      (b) Figure 2b displays five experimental data points, as opposed to the six data points in the original dataset and other figures in this manuscript.

      The values for the transcription rate were taken from Bremer and Dennis’s paper from 1996 which only contains five growth rates. We updated the Figure 2b – it now displays data from Bremer and Dennis 2008 for six growth rates.

      (c) The model does not consider the fraction of RNAP transcribing rRNA (Φ_rRNA^RNAP), except in Appendix Figure 4. In the original data (Bremer and Dennis 1996), the fraction of RNAP transcribing rRNA increases dramatically with growth rate; however, in this study, it remains constant at 1.

      Our goal was to keep the model as simple as possible and keep the number of required parameters to a minimum. We only included the figure in the supplementary material because it does not change the conclusions, even though it makes the predictions quantitatively better. In the future we would like to achieve this improvement by expanding the model (with mRNA, tRNA, non-specific RNAP binding to DNA etc.). We added a sentence to the discussion to point out again how the results are affected if Φ_rRNA^RNAP is included, and how this parameter could be mechanistically included in the model in the future.

      "Furthermore, incorporating other types of RNA (mRNA, tRNA) and energy metabolism, or even constructing a genome-scale RBA model (Hu et al., 2020), will likely lead to more quantitative predictions of fluxes and growth rate. A strong indication of this is that including a variable RNAP allocation into the model leads to quantitatively better predictions (see Appendix 1, Figure 5). Therefore, in the future, we aim to model RNAP allocation mechanistically. This will involve for example adding other RNA species (mRNA, tRNA), and considering non-specifically bound RNAP which is a significant fraction of RNAP (Klumpp and Hwa, 2008)."

      Furthermore, Φ_rRNA^RNAP was first introduced in line 205 but was not explained until line 337.

      We added an explanation to the sentence in line 205:<br /> "If we consider RNAP allocation to rRNA (k_RNAP^el^bar = k_RNAP^el f_act^RNAP Φ_rRNA^RNAP, where Φ_rRNA^RNAP is the fraction of RNAP allocated to the synthesis of rRNA), the results get closer to the experimental data (Appendix 1, Figure 5)."

      The value(s) of Φ_rRNA^RNAP for Appendix Figure 4 are also missing from this manuscript.

      We added the missing values to the figure caption.

      1. How, exactly, is the unit of flux converted to mmol g-1 h-1?

      We are not exactly sure what the reviewer means by this question. As an example of unit conversion, we provide an explanation for the conversion of literature RNAP fluxes. The RNAP fluxes predicted by the model are in mmol g^-1 h^-1. The RNAP fluxes in Bremer and Dennis (2008) were in nt min^-1 cell^-1. To convert them to mmol g^-1 h^-1, we used the values of dry mass/cell from Bremer and Dennis (2008) and the number of nucleotides in rRNA (the stoichiometric coefficient n_rRNA). The code for the conversion is available on GitHub (https://github.com/diana-sz/RiboComp) in the script fluxes_vs_growth_rate.py.

      1. What is the (dry) mass constraint and how is it defined? In the manuscript, both the second equation in line 101 and the bottom row of Table 1 are dry mass constraint(s). Why are they different? Furthermore, why is the right-hand side of the second equation in line 101 a dimensionless 1, and how does the last row of Table 1 result in the unit of growth rate, time^(-1)?

      These are two forms of the same constraint. We added a paragraph to the methods section that explains how to convert the equations (capacity constraints, dry mass constraint) into the form in Table 1.

      In the first form of the equation, Tc = 1, the units of are g/mmol, and the units of c are mmol/g, so they cancel out.

      The rows in Table 1 are multiplied by the vector of fluxes, so we get ⍵C [g/mmol] * vIC [mmol/gh] = μ [1/h].

      1. The concentrations of all components that serve as "substrates" will be zero when growth rate is maximized, as these molecules do not catalyze any reactions, nor do they influence reaction kinetics in the model. These "0" concentration components are C, AA, NT, rP, and rRNA. Why are these concentrations even included in the model?

      The reviewer is correct in pointing out that these species have zero concentrations at maximum growth, and it would be possible to simplify the model accordingly. However, we have chosen not to merge these reactions to maintain clarity in distinguishing between metabolic and macromolecular synthesis processes. Additionally, while we currently use the model to predict optimal behavior, it is not inherently limited to this purpose, as it can equally describe sub-optimal states (as in Figure 2b). Finally, if needed, we can easily introduce minimum concentration constraints (e.g. obtained from measurements) for any of these species without affecting our overall arguments.

      Minor comments:

      1. Questions regarding Figure 2:

      (a) The explanation of Figure 2a is unclear. Intuitively, I assumed that it was a comparison between model predictions and experimental data, with the points representing experimental data and the line representing predictions; and the authors wrote in the figure legend "The points represent maximum growth rates in six experimental conditions". However, the growth rates shown in the figure do not match the original experimental data. Are all the data in the figure predictions?

      Yes, the points are predictions and the line is a linear fit. We changed the figure caption as follows:<br /> "The model predicts a linear relationship between RNA to protein ratio and growth rate. The points represent the predicted maximum growth rates in six experimental conditions (Table 2). The line is a linear fit."

      (b) Figure 2b is difficult to understand. This figure shows the non-optimal solutions of the model. It is unclear how these solutions are achieved and why there are three lines in the figure.

      We expanded the figure caption to make it clearer:<br /> "Alternative RNAP fluxes at different non-optimal growth rates in glucose minimal medium. These are obtained by varying the growth rate step by step from zero to maximum and enumerating all solutions (elementary growth vectors as defined in Müller et al. (2022)) for each growth rate. The grey and blue lines are the alternative solutions. The blue line corresponds to solutions, where rRNA and ribosomes do not accumulate (constraints rRNA' andcap R' in Table 1 are limiting)."

      1. Table 1 is also difficult to understand. While the stoichiometric constraints can be easily derived, the capacity constraints and the dry mass constraint cannot be easily derived from related equations from the text.

      We added a paragraph into the methods section that explains how to convert the equations (capacity constraints, dry mass constraint) into matrix form.

      1. As the authors ask a question in the title, they should provide an explicit answer in the abstract.

      We added a sentence to the abstract:<br /> "Our model highlights the importance of RNA instability. If we neglect it, RNA synthesis is always ``cheaper' than protein synthesis, leading to an RNA-only ribosome at maximum growth rate. However, when we account for RNA turnover, we find that a mixed ribosome composed of RNA and proteins maximizes growth rate."

      1. The authors should cite a seminal modeling paper, which was the first to examine resource allocation in simplified self-replicating cell systems (Molenaar et al. 2009, Molecular Systems Biology 5:323).

      The citation was added.

      1. The meaning of v is not consistently defined throughout the manuscript. It refers to the fluxes of enzymatic reactions in some instances, but in other contexts, it refers to the fluxes of the entire network of enzymatic reactions and protein synthesis reactions (Figure 1, Equation 1, and Line 386).

      We have made the notation more consistent. When we refer to the fluxes of the entire network we now use v_tot instead of v.

      1. Line 85, it might be difficult to interpret "RNAP fluxes" as the flux of rRNA synthesis without reading the subsequent text.

      _We added the explanation in brackets.<br /> "_We validate the model by predicting RNAP fluxes (rRNA synthesis fluxes)."

      1. Typo in line 102-103. "...protein fluxes 𝒘" → "...protein synthesis fluxes 𝒘".

      Thank you for spotting that, we added the missing word.

      1. Line 104, f_RNAP^act and f_R^act are not explained in the text; and their biological significance cannot be understood from their names in Table 2 ("RNAP activity" and "Ribosome activity").

      We added a sentence that explains these parameters:<br /> "f_RNAP^act is the fraction of actively transcribing RNAPs, and f_R^act is the fraction of actively translating ribosomes."

      1. Notion "**" in Table 2. The coupling between transcription and translation means the coupling of "mRNA" transcription and translation, not rRNA. At least in E. coli, the transcription rate of rRNA is faster than that of mRNA.

      The transcription rate of the archaeal RNAP was determined in vitro. To our knowledge, data for transcription rates of rRNA vs. mRNA in vivo are not available. Therefore, the translation rate is only a very rough estimate.

      1. Is the citation correct in line 136? I didn't find related information in Bremer and Dennis' paper after a quick scan.

      We corrected the citation. Additionally, we added references that indicate that if rRNA is transcribed in excess of available r-proteins, it gets rapidly degraded:<br /> "In fact, the accumulation of free rRNA in a cell is biologically not realistic as it is bound by rPs already during transcription (Rodgers and Woodson, 2021). Furthermore, if rRNA is expressed in excess of rPs, it is rapidly degraded (Siehnel and Morgan, 1985)."

      1. Lines 136-138. The statement is not accurate, as the fraction of inactive ribosomes increases with decreasing growth rate in E. coli (Dai et al. 2016, Nat Microbiol 2, 16231). If the studied growth rates are relatively high, it is acceptable to use a constant active ribosome fraction as an approximation, but this approximation should be made explicit.

      We used the fractions of active ribosomes as reported in Bremer and Dennis, 2008 which are constant between growth rates of 0.4-2.1 1/h. In Dai et al. 2016, it was similarly observed that above the growth rate of ~0.5 1/h, the active fraction is quite constant. We rephrase the text to make it more accurate:<br /> "For the growth rates studied here (0.4-2.1 1/h), the fraction of inactive ribosomes stays roughly constant at 15-20% (Bremer and Dennis, 1996, 2008; Dai et al., 2016). In our model, we have already incorporated this fraction using the effective translation elongation rate (k_R^el^bar = k_R^el*f_R^act). However, below the growth rate of ~0.5 1/h, the fraction of active ribosomes rapidly decreases (Dai et al. 2016)."

      1. The citation in line 142 is not accurate. It should be (Bremer and Dennis, 1996).

      We corrected the citation.

      1. Lines 192-193: "six" different growth media, not five.

      Thank you for pointing that out, we corrected it.

      1. Line 287: The statement "... translation rate does not increase in ribosomes with a higher protein content" could be misinterpreted as discussing translation elongation rate changes with different protein content in ribosomal protein mutant strains in a given species. It should be rephrased to remove ambiguity.

      We rephrased the sentence as follows:<br /> "…translation rate does not increase in ribosomes from different species which have higher protein content."

      1. Parameters for the three panels in Figure 8 are missing.

      The parameters used for mitochondria are the same as for E. coli in glucose minimal media. The only difference is that a fraction of rPs can be imported. We added a sentence to the figure caption to clarify this:<br /> "The model can be adjusted to predict mitochondrial protein-rich ribosome composition. All parameters used for the simulation of mitochondria are the same as for E. coli in glucose minimal media, except a fraction of rPs can be imported for free from the cytoplasm and does not have to be synthesized. For simplicity, we assumed that 1/3 of rPs are imported. (In reality, almost all rPs are imported, but mitochondria make additional proteins to provide energy for the whole cell.)"

      Reviewer #4 (Significance):

      Strengths: Why the ribosome is composed of RNA and protein parts is a fundamental biological question. This manuscript proposes a very interesting hypothesis, arguing that the mixed ribosome composition results from rRNA instability. To test their hypothesis, the authors parameterize a simplified self-replicating cell model with realistic parameters. The model is first developed/parameterized for E. coli, and it could be easily adapted to other organisms with higher ribosomal protein content.

      Limitations: The main limitations of this manuscript lie in the development of the model, especially the modeling of rRNA degradation and the use of constant values for growth rate-dependent parameters.

      Advances: (1) This manuscript proposes a new hypothesis that rRNA instability is a universal factor that influences the ribosome composition across living organisms. (2) Compared to Kostinski and Reuveni's work, the authors have made certain improvements by including adjustable ribosome allocation to RNA and ribosomal protein when maximizing growth rate, which may lead to more realistic conclusions.

      Audience: This work will be of interest to people in the field of theoretical biology, computational biology, and evolution, as well as to researchers studying ribosome structure and function.

      Areas of expertise: Microbial systems biology, computational biology, and prokaryotic genomics.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #4

      Evidence, reproducibility and clarity

      Summary

      In this manuscript, Széliová et al. used a simple self-replicating cell model to study why the ribosome consists of both RNA and protein from an economic point of view. Their base model predicts an RNA-only ribosome, which is not surprising since the smaller RNAP has a higher turnover number compared to the larger ribosome. When rRNA instability is included, the model predicts an "RNA+Protein" ribosome. In particular, the predicted ribosome composition is comparable to the measured ribosome composition when strong cooperative binding of ribosomal proteins to rRNA is considered. The authors conclude that the maximal growth rate is achieved by the real ribosome composition when rRNA instability is taken into account.

      Major comments:

      1. The authors modeled the rRNA degradation rate as a function of the concentration of fully assembled ribosomes (equation 5). However, only partially assembled ribosomes are susceptible to RNase, and they make up only a small fraction of total ribosomes. The majority of ribosomes are fully assembled. In addition, the turnover number obtained from Fazal et al. (2015) and used here is the degradation rate of double-stranded RNA, not the fully assembled ribosomes, which have a stable tertiary structure. In my opinion, the rRNA degradation rate should be modeled as a function of the concentration of partially assembled ribosomes (i.e., pre-R in Figure 7) rather than the concentration of fully assembled ribosomes.
      2. Compared to the work by Kostinski and Reuveni (2020), the authors have made an improvement by avoiding the use of constant ribosome allocation to ribosomal protein (Φ_rP^R) and RNAP (Φ_RNAP^R), allowing these parameters to vary with predicted growth rates (by changing 𝑥_rP). This is indeed important, as bacteria are very likely to adjust these parameters in response to different growth conditions. However, certain other growth rate-dependent parameters are still treated as constants (or treated as nutrient-specific parameters) across predicted growth rates under given conditions. For example, experiments have shown that the fraction of active RNAP (f_RNAP^act) and the ribosome elongation rate (k_R^el) are growth rate-dependent (Bremer and Dennis, 1996). In contrast, when the authors predict the maximum growth rate by changing 𝑥_rP, f_RNAP^act and k_R^el are held constant regardless of the predicted growth rates.
      3. If amino acids or nucleotides are provided in the media, the cell does not have to synthesize all of them de novo. However, the model assumes that the cell always synthesizes all amino acids or nucleotides de novo for growth on growth on amino acid-supplemented media or on LB. This problem could in principle be solved by assuming very fast kinetics of the metabolic reactions in these media, but that should be discussed in the manuscript. Furthermore, why does the turnover number for EAA depend on the growth rate while that of ENT is constant?
      4. All parameters related to transcription (RNAP) and translation (ribosome) used in this manuscript are adopted from Kostinski and Reuveni (2020), which are slightly modified based on Bremer and Dennis' research (1996, 2008). However, the authors changed some of the original parameters or data points, but did not provide explanations for these changes:

      (a) The original data depicted a growth rate-dependent translation elongation rate, but Table 2 presents it as a constant value.

      (b) Figure 2b displays five experimental data points, as opposed to the six data points in the original dataset and other figures in this manuscript.

      (c) The model does not consider the fraction of RNAP transcribing rRNA (Φ_rRNA^RNAP), except in Appendix Figure 4. In the original data (Bremer and Dennis 1996), the fraction of RNAP transcribing rRNA increases dramatically with growth rate; however, in this study, it remains constant at 1. Furthermore, Φ_rRNA^RNAP was first introduced in line 205 but was not explained until line 337. The value(s) of Φ_rRNA^RNAP for Appendix Figure 4 are also missing from this manuscript.<br /> 5. How, exactly, is the unit of flux converted to mmol g-1 h-1?<br /> 6. What is the (dry) mass constraint and how is it defined? In the manuscript, both the second equation in line 101 and the bottom row of Table 1 are dry mass constraint(s). Why are they different? Furthermore, why is the right-hand side of the second equation in line 101 a dimensionless 1, and how does the last row of Table 1 result in the unit of growth rate, time^(-1)?<br /> 7. The concentrations of all components that serve as "substrates" will be zero when growth rate is maximized, as these molecules do not catalyze any reactions, nor do they influence reaction kinetics in the model. These "0" concentration components are C, AA, NT, rP, and rRNA. Why are these concentrations even included in the model?

      Minor comments:

      1. Questions regarding Figure 2:

      (a) The explanation of Figure 2a is unclear. Intuitively, I assumed that it was a comparison between model predictions and experimental data, with the points representing experimental data and the line representing predictions; and the authors wrote in the figure legend "The points represent maximum growth rates in six experimental conditions". However, the growth rates shown in the figure do not match the original experimental data. Are all the data in the figure predictions?

      (b) Figure 2b is difficult to understand. This figure shows the non-optimal solutions of the model. It is unclear how these solutions are achieved and why there are three lines in the figure.<br /> 2. Table 1 is also difficult to understand. While the stoichiometric constraints can be easily derived, the capacity constraints and the dry mass constraint cannot be easily derived from related equations from the text.<br /> 3. As the authors ask a question in the title, they should provide an explicit answer in the abstract.<br /> 4. The authors should cite a seminal modeling paper, which was the first to examine resource allocation in simplified self-replicating cell systems (Molenaar et al. 2009, Molecular Systems Biology 5:323).<br /> 5. The meaning of v is not consistently defined throughout the manuscript. It refers to the fluxes of enzymatic reactions in some instances, but in other contexts, it refers to the fluxes of the entire network of enzymatic reactions and protein synthesis reactions (Figure 1, Equation 1, and Line 386).<br /> 6. Line 85, it might be difficult to interpret "RNAP fluxes" as the flux of rRNA synthesis without reading the subsequent text.<br /> 7. Typo in line 102-103. "...protein fluxes 𝒘" → "...protein synthesis fluxes 𝒘".<br /> 8. Line 104, f_RNAP^act and f_R^act are not explained in the text; and their biological significance cannot be understood from their names in Table 2 ("RNAP activity" and "Ribosome activity").<br /> 9. Notion "**" in Table 2. The coupling between transcription and translation means the coupling of "mRNA" transcription and translation, not rRNA. At least in E. coli, the transcription rate of rRNA is faster than that of mRNA.<br /> 10. Is the citation correct in line 136? I didn't find related information in Bremer and Dennis' paper after a quick scan.<br /> 11. Lines 136-138. The statement is not accurate, as the fraction of inactive ribosomes increases with decreasing growth rate in E. coli (Dai et al. 2016, Nat Microbiol 2, 16231). If the studied growth rates are relatively high, it is acceptable to use a constant active ribosome fraction as an approximation, but this approximation should be made explicit.<br /> 12. The citation in line 142 is not accurate. It should be (Bremer and Dennis, 1996).<br /> 13. Lines 192-193: "six" different growth media, not five.<br /> 14. Line 287: The statement "... translation rate does not increase in ribosomes with a higher protein content" could be misinterpreted as discussing translation elongation rate changes with different protein content in ribosomal protein mutant strains in a given species. It should be rephrased to remove ambiguity.<br /> 15. Parameters for the three panels in Figure 8 are missing.

      Significance

      Strengths: Why the ribosome is composed of RNA and protein parts is a fundamental biological question. This manuscript proposes a very interesting hypothesis, arguing that the mixed ribosome composition results from rRNA instability. To test their hypothesis, the authors parameterize a simplified self-replicating cell model with realistic parameters. The model is first developed/parameterized for E. coli, and it could be easily adapted to other organisms with higher ribosomal protein content.

      Limitations: The main limitations of this manuscript lie in the development of the model, especially the modeling of rRNA degradation and the use of constant values for growth rate-dependent parameters.

      Advances: (1) This manuscript proposes a new hypothesis that rRNA instability is a universal factor that influences the ribosome composition across living organisms. (2) Compared to Kostinski and Reuveni's work, the authors have made certain improvements by including adjustable ribosome allocation to RNA and ribosomal protein when maximizing growth rate, which may lead to more realistic conclusions.

      Audience: This work will be of interest to people in the field of theoretical biology, computational biology, and evolution, as well as to researchers studying ribosome structure and function.

      Areas of expertise: Microbial systems biology, computational biology, and prokaryotic genomics.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      The authors explore a mathematical model to rationalize the variable RNA content in ribosomes across species. The mathematical model particularly considers the idea that the protein-to-RNA ratio in ribosomes emerges as a consequence of faster rRNA than r-protein synthesis coupled with a faster degradation of rRNA. This is an interesting analysis. The idea is well explained and the math of the model is overall well explained. Overall, I thus support publication of this analysis. However, while reading the manuscript I was continuously wondering about two major aspects which, I suggest, should be considered more prominently in the text:

      i. How clear is it that rRNA is more unstable than r-protein?

      ii. Why should the translation rate (the speed with which ribosomes assemble new proteins) not be highly dependent on the ribosome-to-protein ratio (with some intermediate ratio ensuring efficient synthesis and efficient translation?

      Currently these points are considered briefly in the discussion part. I suggest that these points should at least be discussed more prominently in the introduction. I further appreciate any more detailed thoughts the authors have on these questions. Finally, I think the discussion section would benefit strongly from a more detailed consideration of possible future experiments. Which data is needed to probe the idea? What types of experiments could be performed to probe the model.

      More detailed comments:

      Regarding i: rRNA is pretty stable compared to other RNA types in the cell. The authors argue it is unstable. The specific question then seems to become how stable rRNA is compared to r-protein? Generally, proteins are also stable, but what data is available to support that r-proteins are more stable than rRNA?

      Regarding ii: Building on their model results, the authors rationalize the highly varying RNA-to-protein ratio in ribosomes across species. The model considers a non-varying rate with which ribosomes synthesize new proteins. This is briefly discussed in the discussion section. However, this appears to be a major assumption that, I think, should be stated clearly stated earlier in the text, including the abstract and introduction. Second, I wonder how the authors then rationalize variations in translation rate across species. Translation rates and the speeds with which ribosomes are varying strongly across species (indicated for example well by the change in the slope between ribosome content/rRNA and growth rate - slope in Fig. 2A). Why could the rRNA-to-protein ratio not be important in playing a role here?

      More minor point, but I was also not sure about the justification that ribosome mass is constant (line 111). The mass of an amino acid and a nucleotide is quite different. Why should overall mass matter, and not for example the number of amino acids and proteins. I think it also would be good here to motivate the assumption better early on instead of commenting on it in the discussion section.

      Significance

      Protein synthesis by ribosomes is a major determinant of the rate with which microbes and other fast growing cells accumulate biomass. To better understand cell growth it is thus essential to better understand the makeup of ribosomes. Széliová et al present a mathematical model to entertain the idea that the varying RNA content in ribosomes across species is a consequence of RNA degradation. The model makes clear predictions which can guide future experiments.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary: This study addresses the problem of what is the optimal ribosome composition in terms of relative RNA and protein content, to ensure optimal growth rate and minimal energy waste. The RNA-world hypothesis suggests that primitive ribosomes were RNA-only objects, and in fact this would appear to be very advantageous from an energetic point of view, since RNA synthesis requires a much lower energy expenditure than protein synthesis. Yet a large fraction of present-day ribosome mass is protein, ranging from 30% to nearly 70% depending on the organism. The authors hypothesize that one of the main functions of ribosomal proteins is to stabilize the RNA and to protect it against degradation. According to their idea, the fast degradation of a protein-free rRNA would offset the energetic advantage given by its cheaper synthesis. To test the hypothesis, they developed a mathematical model whereby to evaluate the optimal ribosome composition under a number of different conditions.

      Major comments: The paper is well-written and very readable. I am not an expert of mathematical modelling, so I cannot go into the details of the model presented. As a biologist, I can say that the conclusion arrived at are reasonable and well-justified. Perhaps the point of view is rather narrow, since ribosomal proteins are known to be important not only for RNA protection and ribosome stability, but also to ensure the accuracy of decoding and, in certain contexts, to allow the ribosomes to interact with other cellular ligands. The authors make only very slight reference to these questions, so it would be worthwhile to further comment on them.<br /> Furthermore, their explanation of why ribosome composition should be so different in different organisms (e.g. protein-poor bacterial ribosomes versus protein-rich archaeal ones) is not entirely convincing. For instance, they suggest that archaea may have protein-richer ribosomes than bacteria because they live in extreme environments, thus needing a further aid to stabilize the organelle. While this may be a factor, one must point out that non-extremophilic archaea (e.g. methanogens) have protein-rich ribosomes, making it obvious that other factors must be at play.

      Minor comments: none in particular. Referencing is adequate, text is clear and the figures are clear and well-organized.

      Significance

      As I stated above, the main weakness of this study may be that it concentrates overwhelmingly on a single problem, i.e. the energetic cost of adding proteins to an RNA-only ancestral ribosome. On the other hand, this is a question seldom addressed when talking about ribosome composition, which indeed makes this paper valuable and interesting. The authors expand and advance a previous study of the same kind (to which they make ample reference).

      Although rather specialized, I think this paper, in its general conclusions, may be of interest to most of those working in the field of protein synthesis and ribosome evolution.

      Referee's keywords: archaea, ribosome evolution, translation, translation initiation

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      1. General Statements

      We thank the reviewers for their comments, and their appreciation of the value and thoroughness of our work in identifying a novel and clinically relevant consequence of centrosome amplification in favoring cell death. The reviewers accurately identify weaknesses of our work which we had also pointed out in the discussion of our manuscript. In particular, we agree as pointed out by Reviewer 1 that direct links between our cellular and clinical observations are difficult to establish given the low level of centrosome amplification observed in the tumor samples. Although multiple hypothesis might explain why preferentially eliminating a small population of cells is beneficial for the patients, we consider that this is out of the scope of this manuscript. However, given that our cellular and clinical observations point in the same direction, we remain confident in the value of presenting them together in this manuscript. We have made it clearer both in the results section and discussion that further work is required to better understand the influence of low levels of centrosome amplification on chemotherapy responses in patients.

      We also thank the reviewers for their suggestions to improve the in vitro work we have performed. Our point by point response below lists the experiments we plan to perform, and corrections we have already included in this submitted version. Although Reviewer 3 points out that the molecular mechanism underlying apoptotic priming in cells with centrosome amplification remains a mystery, we argue that the identification of this priming already provides a mechanistic explanation for enhanced chemotherapy responses. Our careful and thorough analysis of these responses, using a diversity of advanced technical approaches was key to achieve this. We were also able to clearly rule out that priming is caused by a previously characterized centrosome amplification consequence, demonstrating its novelty. Reviewer 3’s characterization of our work as “archival” is diminishing to say the least, and we believe multiple aspects of this work will be built upon, even beyond the identification of a molecular mechanism which will of course also be important. Indeed, centrosome amplification is observed in a diversity of healthy cell types (megakaryocytes, B cells, hepatocytes…) and could contribute to the homeostasis of these tissues via apoptotic priming. We predict the translational perspectives of this work also to be important, from the point of view of centrosome amplification in disease, but also in understanding apoptotic priming and responses to BH3-mimetics.

      2. Description of the planned revisions

      Reviewer 1, Major comments:

      1. The conclusion that centrosome amplification primes to apoptosis irrespective of mitotic defects is largely based on low resolution timelapse analysis (20x magnification, 10 minute imaging intervals, no tubulin). Imaging at this resolution is likely to miss mitotic defects, reducing the confidence with which this conclusion can be drawn.

      We were unsure of the exact point brought up by Reviewer 1 here and we have consulted Reviewer 1 (through Reviews commons) to confirm the revision plan. In Figure 5A, we show that the level of heterogeneity stemming from chromosome instability is lower for PLK4OE than for MPS1 inhibition, and Figure 5D then shows that apoptotic priming only occurs in PLK4OE, and not in response to MPS1 inhibition. Combined, these experiments allow us to conclude that apoptotic priming occurs independently of mitotic defects. Nevertheless, we propose to reproduce the live-imaging of mitosis, increasing the resolution and including tubulin, to better visualize mitotic defects in response to the different mitotic perturbations induced.

      1. Data from timelapse analysis of DNA content in Fig. 2 are used to conclude that Plk4OE cells are more sensitive to carboplatin due to mitotic defects that occurred without multipolar spindles. However, it is premature to conclude that multipolar spindles were not involved in DNA mis-segregation without visualizing the spindles themselves. While DNA positioning can be used as a proxy for spindle morphology, as performed here, it only reliably detects multipolar spindles when all poles are relatively equal in size and the multipolar spindle is maintained throughout mitosis. However, the poles in multipolar spindles often differ in size and ability to recruit DNA. Additionally, they often cluster over time, which can preclude their identification when only visualizing DNA, especially at 20x magnification. Compelling evidence that high mis-segregation is occurring without multipolar spindles would require visualizing the spindles and also demonstrating the cause of the increased chromosome mis-segregation. (Are acentric fragments being mis-segregated as lagging chromosomes?)

      We agree with Reviewer 1 that the “High mis-segregation” mitotic phenotype we describe is poorly characterized in our original manuscript, and that we cannot formally exclude that multipolar spindles are involved, although we observe this phenotype in similar proportions in PLK4Ctl and PLK4OE. We also agree that identifying the origin of increased chromosome mis-segregation is relevant here. We therefore propose to characterize spindles and mis-segregating chromosomes by imaging fixed mitotic figures upon Carboplatin treatment, staining for Tubulin, centrosomes, and centromeres. This will allow us to better determine if Carboplatin induces the same mitotic phenotypes in PLK4OE and PLK4Ctl cells.

      1. The images in Fig. 3D and 4D are not of sufficient resolution to support the central conclusion that centrosome amplification primes cells for MOMP. This conclusion is further weakened by the facts that 1) Plk4OE was the only source of centrosome amplification tested and 2) Plk4OE was reported to prime for MOMP in only 2 of 3 cell lines. Potential explanations for the lack of priming in SKOV3 cells should be discussed. Additionally, the sensitization in Fig. S4H-J appears quite modest. (These data are also difficult to see, perhaps because the Plk4Ctl -/+ chemo conditions are overlapping.)

      We have made images in Fig. 3D and 4D larger. We hope that this makes our observations of Cytochrome C release (quantified in Fig. 3E and 4E) easier to visualize for readers. We would like to point out that our conclusion that centrosome amplification primes for MOMP in OVCAR8 does not only arise from the assays presented in these figures. In Figures 4A and 4C we show by MTT assays and detection of apoptotic cells by cytometry respectively, that PLK4OE OVCAR8 are sensitized to BH3-mimetic WEHI-539 compared to PLK4Ctl cells. We also show this priming using BH3-mimetic Navitoclax in Fig S4F. Regarding the source of centrosome amplification, we use OVCAR8 cells devoid of the inducible PLK4OE transgene and show that “natural” centrosome amplification also makes OVCAR8 cells more sensitive to WEHI-539 (Fig. S4C). This strongly suggests that priming does indeed stem from centrosome amplification and not from other consequences of PLK4 over-expression. Nevertheless we are currently generating cells to induce centrosome amplification via SAS-6 over-expression, to test an alternative source of centrosome amplification.

      We do not claim that this apoptotic priming is a universal consequence of centrosome amplification, as indeed we show that it is not observed for the cell line SKOV3 (Fig. S4F). For now, we do not have a clear hypothesis of the reason for the cell line differences. Initially we hypothesized that p53 status could be in cause because OVCAR8 and COV504 both express mutant p53 whereas p53 protein is completely absent in SKOV3. However we observe that p53 does not seem to affect cell death signaling in OVCAR8 (Fig. S3C-D), making this hypothesis less likely. The 3 cell lines are indeed very different in terms of origin and genomic alterations, making it difficult at this stage to propose an evidence-based explanation of differences in terms of apoptotic priming.

      Finally, regarding the sensitization to chemotherapy associated priming presented in Fig. S4H-J, we have made the figures bigger and non-overlapping hoping that this makes them easier to read. Additionally, we agree that the effect of centrosome amplification appears modest. The trypan-blue assays we used have the advantage of being relatively high-throughput, but they only detect a fraction of the killed cells: only cells that are late in the apoptotic process but that haven’t yet been degraded. This makes the assay less sensitive. The general tendency we observe nevertheless proposes an association between apoptotic priming induced by centrosome amplification, and an enhanced sensitivity to a diversity of chemotherapy agents. We propose to confirm this for OVCAR8 cells treated with Olaparib, by performing cytometry experiments staining for AnnexinV and Propidium Iodide in order to increase sensitivity by detecting earlier signs of apoptosis.

      Reviewer 2, Major comments:

      1. The authors state that (Line 133) "the increased multipolarity we observe in presence of the combined chemotherapy is caused by the effect of Paclitaxel on the capacity of cells to cluster centrosomes." Could the authors to back up this claim by reanalyzing the imaging data to look for clustering as a survival mechanism versus inhibition of clustering in Paclitaxel-treated cells? Or indeed test any of the range of available clustering inhibitors directly on PLK4OE and thus prove the contribution of clustering to survival?

      We agree that the conclusion that Paclitaxel suppresses centrosome clustering is not sufficiently backed by experimental data. We cannot directly view clustering in the live-imaging experiments we performed, because we are visualizing neither tubulin nor centrosomes. To clarify this point, we will:

      1. Image fixed mitotic figures of Plk4Ctl and PLK4OE cells untreated or treated with Paclitaxel, staining for tubulin and centrosomes to identify if indeed Paclitaxel increases the proportion of anaphases with multiple poles characterized by the presence of centrosomes. We will use this type of assay as live imaging approaches to film both microtubules and centrosomes will not be feasible within the timing of this revision, but also because paclitaxel responses maybe modified if tubulin dyes are used such as Sir-tubulin.
      2. We will use HSET inhibitor CW069, to test if this also prevents centrosome clustering.
      3. If this is the case, we will then test if CW069 also preferentially kills PLK4OE compared to PLK4Ctl by Trypan-blue viability assays.

      3. Description of the revisions that have already been incorporated in the transferred manuscript

      Reviewer 1, Major comments:

      1. In its current form, the title suggests that the major role of centrosome amplification in sensitizing to chemotherapy is independent of multipolar divisions. Based on Figure 1, this is misleading. Figure 1D shows that in centrosome amplified cells treated with combination chemotherapy, the most common cause of death is high mis-segregation on multipolar spindles. Modifying the title to "Centrosome amplification favors the response to chemotherapy in ovarian cancer by priming for apoptosis in addition to promoting multipolar division" would more accurately reflect the data.

      We agree with Reviewer 1 that our title should include the promotion of multipolar divisions, and have modified the title accordingly.

      1. Line 191 points out that more Plk4OE cells that were in G1 at the beginning of carboplatin died than Plk4Ctl cells. However, in Fig. 2H-I, it looks like longer G1 durations in the presence of carboplatin led to increased cell death and that the Plk4OE cells happened to spend more time in G1 at the beginning of carboplatin treatment than Plk4Ctl cells did. Is this the case? Quantification of the average time spent in G1 for each group would be helpful.

      Upon Carboplatin exposure, G1 length is indeed longer for PLK4OE cells compared to PLK4Ctl cells, as shown in Fig. S2D for complete G1 phases observed after the first mitosis (although the induced lengthening is mild compared to the observed extension of G2 induced upon carboplatin exposure shown in Fig. S2D). The same tendency, although not significant, is observable for cells in G1 at the beginning of carboplatin treatment, although it is harder to conclude because these are not complete G1 phases.

      To assess links between G1 phase length and cell fate, we have plotted the length of G1 depending on whether cells live or die, focusing on cells of the second generation for which G1 length is complete. We observed no link between G1 length and cell fate, and have added this figure as Fig. S1E.

      Reviewer 1, minor comments:

      1. The authors cite Fig. 1B when drawing the conclusion that "combined chemotherapy induced a stronger reduction of viable cells produced per lineage in PLK4OE compared to PLK4Ctl". But Fig. 1B shows that combination chemotherapy produced a similar decrease in viable cells per lineage +/- Plk4OE. If anything, the Plk4OE+ cells showed slightly less sensitivity because they proliferated more poorly in the absence of chemotherapy. This is also true for carboplatin sensitivity in Fig. 2D (line 156).

      Here our focus is actually more on the proportion of cell death that on the number of viable cells. We agree that the way we wrote this makes it confusing so we have re-written this paragraph to make it clearer.

      1. Line 202 concludes that Fig. S2H-I shows that Plk4OE doesn't affect recruitment of DNA damage repair factors. The dotted outlines around the nuclei in Fig. S2H-1 make it very difficult to see, but it appears that gH2AX, FancD2, and 53BP1 signals are lower in Plk4OE cells.

      We have made images in Fig. S2H bigger and the dotted outlines around nuclear less strong, and we hope this makes the signal easier to see. Strong cell to cell variations in signal make it hard to draw conclusions from images, although we have aimed to present this heterogeneity. The quantifications shown in Fig. S2I however show that there are no differences in Rad51 or FANCD2 recruitment in PLK4OE cells. For 53BP1 however, we observed less recruitment in PLK4OE for one biological replicate (squares in quantification shown in Fig. S2I) but not in the two other replicates. Although there may be some interesting observation here, this difference does not appear sufficiently robust to consider it as relevant in the context of this study.

      1. The images for "dies in interphase" and "dies in mitosis" in Fig. 1B are suboptimal. Alternative images would be beneficial.

      We have modified the images and added timepoints to make the phenotypes clearer. We have also added supplementary movies to better visualize the events (See Movie S1A for cell death events).

      1. It would be helpful to discuss the clinical relevance of WEHI-539 and Navitoclax.

      We have further developed the section of our discussion about the clinical relevance of BH3-mimetics and these drugs.

      1. The discussion states that "mitotic drugs that limit centrosome clustering have had limited success in the clinic". I am not aware of any drugs that limit centrosome clustering that are suitable for in vivo use and the citation provided does not mention centrosome clustering.

      We thank Reviewer 1 for this comment. Indeed, we oversimplified things a bit here, and have rewritten this paragraph. We have however kept the citation because although this reference does not directly mention centrosome clustering, some of the discussed drugs have been shown to kill cancer cells via centrosome unclustering in vitro in other studies.

      1. The dark purple and black are very difficult to discriminate (Figure 1,2 and S1), as are the light green and light turquoise (Fig. 4A,S4A-B, S4F, S4H).

      We changed these colors in the indicated graphs, and also in other figures where they were used. We hope these changes make the figures easier to read.

      1. Line 246 claims that Fig. S3B shows that p21 and PUMA mildly increase upon carboplatin exposure, but it isn't clear that these increase in a biologically or statistically significant manner.

      We have modified this paragraph because indeed it seems unlikely that the differences are statistically or biologically significant.

      1. The green used to indicate S/G2 in Fig. S2A-B is different in Plk4 Ctrl vs Plk4OE cells.

      We thank Reviewer 1 for spotting this and have changed the colors.

      1. I do not believe that carboplatin + paclitaxel is standard of care treatment for breast or lung cancer, as stated on line 48-49.

      Based on the guidelines of the NIH, we believe that these two drugs are indeed used in combination for the treatment of Stage IV non small cell lung cancer, as well as triple-negative breast cancer. (https://www.cancer.gov/types/lung/hp/non-small-cell-lung-treatment-pdq#_48414_toc, https://www.cancer.gov/types/breast/hp/breast-treatment-pdq#_1049).

      However, given the complexity and diversity of treatment protocols, we have modified the text so as not to convey the idea that these are the only drugs used.

      1. This study advances, but does not complete our understanding of centrosome amplification in breast cancer, as stated on line 75.

      Agreed and changed.

      1. Line 297 describes Navitoclax as an "inhibitor of BCL2, BCL-XL and BCL2". (ie BCL2 is listed twice).

      Thank you for noticing this, we have corrected this.

      1. It's not clear why line 120, which refers to effects of combined chemotherapy, cites Fig. S1G-I, which apparently show data from untreated (even without dox?) Plk4Ctrl and Plk4OE cells.

      We indeed meant to refer to Fig. 1E-F and have therefore made this change.

      1. In Fig. S6A, how can the mitotic index be 200%?

      We thank Reviewer 1 for noticing the poor labelling of this figure. It is not a percentage of cells we are presenting, but the number of mitotic figures identified in 10 analyzed fields. We have corrected the figure.

      Reviewer 2 major comments:

      1. Fig 3: Results line 229-236 refer to quantification of fragmented nuclei which the authors interpret as poised for apoptosis. Micronuclei are also quantified- do the authors interpret this phenotype as advanced apoptosis? There is no mention of apoptotic bodies in the analysis. I would ask the authors to provide a bank of representative images with explanations to illustrate their interpretation of the range of morphologies - differences between nuclear fragmentation, versus micronuclei versus DNA contained in apoptotic bodies.

      The cells we defined as “poised for apoptosis” are cells that release cytochrome C in presence of a pan-caspase inhibitor. These cells are therefore activating mitochondrial outer membrane permeabilization without executing apoptosis. It is then within these cells that we observe different nuclear morphologies, reflecting different behaviors in mitosis rather than apoptosis advancement. Apoptotic bodies are not observed in these cells, because they are actually not executing apoptosis owing to the presence of the pan-caspase inhibitor. We visualized apoptotic bodies only in absence of pan-caspase inhibitor. These are indicated by white arrow-heads, in Fig. 3D which was made bigger for more clarity. We have also added images of nuclei to present the different morphologies we describe in Fig. 3F.

      1. Although this patient cohort is described in a previous publication, authors should include a cohort description in a table within supplemental for this manuscript: age range of patients, number of patients in each stage, size of tumours, and most relevant to this study, treatment regimens- adjuvant versus neoadjuvant, surgery vs no surgery? How is the cohort selected- sequentially selected? inclusion/exclusion criteria? Statement in abstract "we show that high centrosome numbers associate with improved chemo responses" is too specific as we have no information on the treatment regimens received by the patients (neo or adjuvant chemo versus surgical/radiological interventions?). Maybe treatment response would be more appropriate? Were there any cases of Pathological complete (or even near complete) response in this cohort and if so, what was the CNR in those cases?

      We have included the cohort description in Supplementary Table 1. This is a retrospective cohort, so no specific inclusion criteria were applied. Treatment mainly consisted of surgery (100% patients) followed by adjuvant chemotherapy consisting of platinium salts and/or taxanes (84% of patients, 67% treated with both). Despite the wide common ground of treatment (surgery followed by taxanes and/or platinium salts for 84% of patients), we have nevertheless modified the abstract as suggested by Reviewer 2. Regarding complete or near-complete response, there were no such cases in this cohort.

      Reviewer 2, minor comments:

      Just some minor points on language:<br /> Line 54: Suggest rephrasing of the statement "and this can be favored by centrosome amplification (29) "<br /> Perhaps a word like potentiated instead of favored?<br /> Line 67: Again consider using an alternative to favored "We show that centrosome amplification favors the response to combined Carboplatin and Paclitaxel via multiple mechanisms."<br /> Favored is in fact used throughout the manuscript text- in my opinion this is not a scientific enough term and would consider replacing with alternative.

      We have replaced the term favor with more appropriate terms, depending on the context.

      4. Description of analyses that authors prefer not to carry out

      Reviewer 1, major comments:

      1. In a previous technical tour de force (Morretton et al, EMBO Mol Med 2022), the Basto lab quantified centriole numbers in the ovarian patient cancer samples analyzed here, and found that the percentage of cells with centrosome amplification in a given ovarian tumor is quite small, only reaching a maximum of 3.2%. It is critical background information to cite that quantification here. This information also begs the question of whether introducing this low rate of centrosome amplification is sufficient to cause a more global apoptotic priming in the sample, as suggested.

      We have now included this important background information in our results section. We agree with Reviewer 1 that the low levels of centrosome amplification in tumors may not cause a more global apoptotic priming in the whole tumor. However, based on our findings, this low proportion of cells will most likely be more sensitive to chemotherapy. We cannot affirm for now what will be the consequences of the preferential elimination of these cells. However, given centrosome amplification’s potential to promote malignant behaviors such as genetic instability or invasiveness, we hypothesize that the elimination of these cells may have effects on tumor survival that are not proportional to their numbers. Testing this hypothesis would require many more experiments using in vivo models, which we cannot carry out within the scope of this study.

      Reviewer 2, major comments:

      1. Fig 6: While the authors have already acknowledged this as a weakness of the study, can the patient data really be compared to cell line data on CA because inclusion of CNRs between 1.4 and 2 as "high CNR" is questionable given that this ratio represents a completely normal centrosome complement? Are the authors confident enough in the imaging technique that all centrosomes are being detected? Can the authors justify the inclusion of the 1.4-2 CNR tumours by breaking down individual patient data on response to various treatments? Have the authors tried to analyse the cohort for OS and RFS using only those 9% of tumours exhibiting CA? What does the analyses of Fig 6 and S6 look like with a CNR cut-off of 2 instead of 1.45? Does the re-analysis show a better correlation between CNR and FIGO stage?

      At the single-cell level, centrosome amplification is indeed defined as the presence of more than 2 centrosomes per cell. Tumor samples are characterized by heterogeneous centrosome numbers, with some regions showing extensive centrosome loss, and some others showing nuclei associated with either one, two or various levels of centrosome amplification. In such a heterogeneous population of cells, it is therefore not straight-forward to use the cut-off CNR=2 to define tumors with centrosome amplification. We have nevertheless analyzed the clinical parameters using the cut-off for CNR at 2 as proposed. Using this cut-off, High CNR patients still show improved overall survival, but a non-statistically significant extension of time to relapse. There are very few patients with CNR>2 (6 for overall survival and 5 for time to relapse), and therefore we remain unconvinced by the statistical value of such an analysis.

      The definition of a cut-off at 1.45 was not arbitrary. We dichotomized the population into two groups using the Classification And Regression Trees (CART) method. Taking into consideration the binary outcome “relapse within 6 months or no relapse within 6 months” this method resulted in the categorization of the cohort into low CNR (£ 1.45) and high CNR (> 1.45). Independently, we also used predictiveness curves to estimate an optimal cut-off parameter for a continuous biomarker such as the CNR. The threshold obtained by this robust methodology was in agreement with CART approach with a cut-off of 1.40.

      Dichotomizing the population does not guarantee the identification of significant clinical differences between the generated groups. We therefore analyzed overall survival and time to relapse ex post, and observed that high CNR and low CNR populations differed significantly for both these parameters.

      Regarding FIGO stage, given frequent late detection of ovarian cancer, 59% of the cohort is considered at stage III (See Fig. S6C). All patients with CNR>2 are in the group of Stage III, except one which is Stage II. However, no patient with CNR>2 is in Stage IV, arguing that even with a higher CNR cut-off, there is no association between CNR and Figo stage.

      1. The experimental PLK4 overexpression system is an accepted and clean method to induce CA in vitro. Could the authors comment in the discussion on how they envision CA being induced as a sensitizing agent in the clinical setting to support the translational aspects of their work?

      In the clinical setting, we do not suggest to induce centrosome amplification as a sensitization agent. Indeed, centrosome amplification induces multiple phenotypes associated with malignancy (genomic instability, invasiveness). The translational aspects of our work relate more to the detection of centrosome amplification as a potential biomarker of chemotherapy responses, from conventional chemotherapies to BH3-mimetics for which biomarkers are absent. This aspect we have commented on in our discussion.

      Reviewer 2, minor comments:

      Line 263: "Centrosome amplification primes for MOMP and sensitizes cells to a diversity of chemotherapies." CA primes to one very specific BCL-XL inhibitor in this section so consider modifying the title of the section.

      We agree that centrosome amplification makes cells sensitive to a specific BCL-XL inhibitor. However, we nevertheless claim that this very specific priming, can potentiate these cells responses to a diverse range of chemotherapies with different targets (paclitaxel, carboplatin, and olaparib).

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      This is a valuable archival paper that catalogues the effects of combined treatment with paclitaxel and carboplatin predominantly on one ovarian cancer cell line, OVCAR8, in which extra centrosomes can be induced by induced overexpression of Plk4. It systematically examines cellular responses to this drug treatment regimen in control and Plk4 overexpressing cells. Together the experiments show that Plk4-mediated formation of extra-centrosomes sensitizes cells to cell death independently of any effect upon spindle multipolarity and chromosome segregation, irregular spindle formation and mitotic errors, and of the DNA damage response. The authors then go on to show that Plk4 over expression results in premature cleavage of Caspase 3 and so favors the apoptotic response. \This appears to be mediate through increased mitochondrial outer membrane permeabilization. The PIDDosome is believed to contribute to apoptosis in the presence of extra centrosomes through a p%£ mediated pathway. However, in this case, apoptosis appears to be independent of p53 and also of the PIDDosome, as show by deleting a key PIDDosome component. The authors are therefore left with a bit of a mystery in terms of providing a mechanistic explanation of their findings.<br /> I do recommend publication of this paper in its present form as the study has been carried out very carefully and it is very important for workers in the field to know what has been tried in attempt to explain the phenomenon of increased cell death following Plk4 overexpression. It does not lead to a new mechanistic discovery but highlights an important phenomenon that we still have to explain.

      Significance

      valuable archival information

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary

      The authors' findings suggest that induction of centrosome amplification synergises with and potentiates the cytotoxic effects of standard chemo in epithelial ovarian cancer cell lines via a mechanism involving mitochondrial membrane priming and Cyt C release. CA has differential apoptotic priming effects depending on the cell line context. The authors use single cell analysis to characterise the range of mitotic defects through to cell fate following PLK4 OE and the combination treatments. The studies are extended to an ovarian cancer patient cohort where elevated centrosome numbers are associated with better OS and RFS. These findings have the potential to improve future patient stratification and treatment in EOC in addition to prognosis of treatment response.

      Major comments

      1. The authors state that (Line 133) "the increased multipolarity we observe in presence of the combined chemotherapy is caused by the effect of Paclitaxel on the capacity of cells to cluster centrosomes." Could the authors to back up this claim by reanalysing the imaging data to look for clustering as a survival mechanism versus inhibition of clustering in Paclitaxel-treated cells? Or indeed test any of the range of available clustering inhibitors directly on PLK4OE and thus prove the contribution of clustering to survival?
      2. Fig 3: Results line 229-236 refer to quantification of fragmented nuclei which the authors interpret as poised for apoptosis. Micronuclei are also quantified- do the authors interpret this phenotype as advanced apoptosis? There is no mention of apoptotic bodies in the analysis. I would ask the authors to provide a bank of representative images with explanations to illustrate their interpretation of the range of morphologies - differences between nuclear fragmentation, versus micronuclei versus DNA contained in apoptotic bodies.
      3. Fig 6: While the authors have already acknowledged this as a weakness of the study, can the patient data really be compared to cell line data on CA because inclusion of CNRs between 1.4 and 2 as "high CNR" is questionable given that this ratio represents a completely normal centrosome complement? Are the authors confident enough in the imaging technique that all centrosomes are being detected? Can the authors justify the inclusion of the 1.4-2 CNR tumours by breaking down individual patient data on response to various treatments? Have the authors tried to analyse the cohort for OS and RFS using only those 9% of tumours exhibiting CA? What does the analyses of Fig 6 and S6 look like with a CNR cut-off of 2 instead of 1.45? Does the re-analysis show a better correlation between CNR and FIGO stage?
      4. Although this patient cohort is described in a previous publication, authors should include a cohort description in a table within supplemental for this manuscript: age range of patients, number of patients in each stage, size of tumours, and most relevant to this study, treatment regimens- adjuvant versus neoadjuvant, surgery vs no surgery? How is the cohort selected- sequentially selected? inclusion/exclusion criteria?<br /> Statement in abstract "we show that high centrosome numbers associate with improved chemo responses" is too specific as we have no information on the treatment regimens received by the patients (neo or adjuvant chemo versus surgical/radiological interventions?). Maybe treatment response would be more appropriate? Were there any cases of Pathological complete (or even near complete) response in this cohort and if so, what was the CNR in those cases?
      5. The experimental PLK4 overexpression system is an accepted and clean method to induce CA in vitro. Could the authors comment in the discussion on how they envision CA being induced as a sensitizing agent in the clinical setting to support the translational aspects of their work?

      Minor comments

      The manuscript is well written and all data clearly and thoroughly presented.

      Just some minor points on language:

      Line 54: Suggest rephrasing of the statement "and this can be favored by centrosome amplification (29)"<br /> Perhaps a word like potentiated instead of favored?<br /> Line 67: Again consider using an alternative to favored "We show that centrosome amplification favors the response to combined Carboplatin and Paclitaxel via multiple mechanisms."<br /> Favored is in fact used throughout the manuscript text- in my opinion this is not a scientific enough term and would consider replacing with alternative.<br /> Line 263: "Centrosome amplification primes for MOMP and sensitizes cells to a diversity of chemotherapies." CA primes to one very specific BCL-XL inhibitor in this section so consider modifying the title of the section.

      Significance

      Overall, this well-written work extends and provides mechanistic detail to understand the role of CA in priming cells for cytotoxicity in response to commonly used chemo agents in the EOC context. It is a thorough study with sound conclusions drawn from the data provided. It also employs a broad range of assays and techniques to explore the hypotheses from every angle. In view of this, this manuscript is a valuable contribution to the literature on the role of CA in ovarian cancer and its treatment.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      In this manuscript, Edwards et al analyze OVCAR8 cells with dox inducible expression of Plk4. Doxycycline treatment induces centrosome amplification in ~80% of cells. 72 hour timelapse analysis of cells with fluorescent chromosomes revealed that cell death after carboplatin+paclitaxel was more common in Plk4OE than Plk4Ctl cells. Cell death was most common after high chromosome mis-segregation/multipolar division, which resulted in death of ~80% of the daughter cells. However, death was also elevated in cells with no or slight mis-segregation when comparing Plk4OE to PlkrCtl (40% vs 12%), suggesting an additional sensitization effect. Plk4OE also increased cell death in carboplatin alone, most notably after high mis-segregation but also to a lesser extent in cells with no or slight mis-segregation. 17% of Plk4OE cells exposed to carboplatin in G1 died in S/G2 vs 6% of Plk4Ctl. This difference did not appear to be due to DNA damage response or PIDDosome activity. Carboplatin caused caspase 3 cleavage and cytochrome C release to a greater extent in Plk4OE than Pl4Ctl cells, suggesting MOMP priming. Plk4OE sensitizes OVCAR8 cells to the BCL-XL inhibitor WEHI-539, and Plk4OE sensitized COV504 but not SKOV3 cells to the less specific inhibitor Navitoclax. In 88 patients with high grade serous ovarian carcinoma, a high (>1.45) centrosome-to-nucleus ratio was associated with increased relapse-free and overall survival. The authors conclude that centrosome amplification primes ovarian cancer cells to chemotherapy independent of mitotic defects.

      Major comments

      1. In its current form, the title suggests that the major role of centrosome amplification in sensitizing to chemotherapy is independent of multipolar divisions. Based on Figure 1, this is misleading. Figure 1D shows that in centrosome amplified cells treated with combination chemotherapy, the most common cause of death is high mis-segregation on multipolar spindles. Modifying the title to "Centrosome amplification favors the response to chemotherapy in ovarian cancer by priming for apoptosis in addition to promoting multipolar division" would more accurately reflect the data.
      2. In a previous technical tour de force (Morretton et al, EMBO Mol Med 2022), the Basto lab quantified centriole numbers in the ovarian patient cancer samples analyzed here, and found that the percentage of cells with centrosome amplification in a given ovarian tumor is quite small, only reaching a maximum of 3.2%. It is critical background information to cite that quantification here. This information also begs the question of whether introducing this low rate of centrosome amplification is sufficient to cause a more global apoptotic priming in the sample, as suggested.
      3. The conclusion that centrosome amplification primes to apoptosis irrespective of mitotic defects is largely based on low resolution timelapse analysis (20x magnification, 10 minute imaging intervals, no tubulin). Imaging at this resolution is likely to miss mitotic defects, reducing the confidence with which this conclusion can be drawn.
      4. Data from timelapse analysis of DNA content in Fig. 2 are used to conclude that Plk4OE cells are more sensitive to carboplatin due to mitotic defects that occurred without multipolar spindles. However, it is premature to conclude that multipolar spindles were not involved in DNA mis-segregation without visualizing the spindles themselves. While DNA positioning can be used as a proxy for spindle morphology, as performed here, it only reliably detects multipolar spindles when all poles are relatively equal in size and the multipolar spindle is maintained throughout mitosis. However, the poles in multipolar spindles often differ in size and ability to recruit DNA. Additionally, they often cluster over time, which can preclude their identification when only visualizing DNA, especially at 20x magnification. Compelling evidence that high mis-segregation is occurring without multipolar spindles would require visualizing the spindles and also demonstrating the cause of the increased chromosome mis-segregation. (Are acentric fragments being mis-segregated as lagging chromosomes?)
      5. The images in Fig. 3D and 4D are not of sufficient resolution to support the central conclusion that centrosome amplification primes cells for MOMP. This conclusion is further weakened by the facts that 1) Plk4OE was the only source of centrosome amplification tested and 2) Plk4OE was reported to prime for MOMP in only 2 of 3 cell lines. Potential explanations for the lack of priming in SKOV3 cells should be discussed. Additionally, the sensitization in Fig. S4H-J appears quite modest. (These data are also difficult to see, perhaps because the Plk4Ctl -/+ chemo conditions are overlapping.)
      6. Line 191 points out that more Plk4OE cells that were in G1 at the beginning of carboplatin died than Plk4Ctl cells. However, in Fig. 2H-I, it looks like longer G1 durations in the presence of carboplatin led to increased cell death and that the Plk4OE cells happened to spend more time in G1 at the beginning of carboplatin treatment than Plk4Ctl cells did. Is this the case? Quantification of the average time spent in G1 for each group would be helpful.

      Minor comments

      1. The authors cite Fig. 1B when drawing the conclusion that "combined chemotherapy induced a stronger reduction of viable cells produced per lineage in PLK4OE compared to PLK4Ctl". But Fig. 1B shows that combination chemotherapy produced a similar decrease in viable cells per lineage +/- Plk4OE. If anything, the Plk4OE+ cells showed slightly less sensitivity because they proliferated more poorly in the absence of chemotherapy. This is also true for carboplatin sensitivity in Fig. 2D (line 156).
      2. Line 202 concludes that Fig. S2H-I shows that Plk4OE doesn't affect recruitment of DNA damage repair factors. The dotted outlines around the nuclei in Fig. S2H-1 make it very difficult to see, but it appears that gH2AX, FancD2, and 53BP1 signals are lower in Plk4OE cells.
      3. The images for "dies in interphase" and "dies in mitosis" in Fig. 1B are suboptimal. Alternative images would be beneficial.
      4. It would be helpful to discuss the clinical relevance of WEHI-539 and Navitoclax.
      5. The discussion states that "mitotic drugs that limit centrosome clustering have had limited success in the clinic". I am not aware of any drugs that limit centrosome clustering that are suitable for in vivo use and the citation provided does not mention centrosome clustering.
      6. The dark purple and black are very difficult to discriminate (Figure 1,2 and S1), as are the light green and light turquoise (Fig. 4A,S4A-B, S4F, S4H).
      7. Line 246 claims that Fig. S3B shows that p21 and PUMA mildy increase upon carboplatin exposure, but it isn't clear that these increase in a biologically or statistically significant manner.
      8. The green used to indicate S/G2 in Fig. S2A-B is different in Plk4 Ctrl vs Plk4OE cells.
      9. I do not believe that carboplatin + paclitaxel is standard of care treatment for breast or lung cancer, as stated on line 48-49.
      10. This study advances, but does not complete our understanding of centrosome amplification in breast cancer, as stated on line 75.
      11. Line 297 describes Navitoclax as an "inhibitor of BCL2, BCL-XL and BCL2". (ie BCL2 is listed twice).
      12. It's not clear why line 120, which refers to effects of combined chemotherapy, cites Fig. S1G-I, which apparently show data from untreated (even without dox?) Plk4Ctrl and Plk4OE cells.
      13. In Fig. S6A, how can the mitotic index be 200%?

      Significance

      The importance of centrosome amplification in cancer has long been debated. The possible effects of extra centrosomes on multipolar divisions are well known. An independent apoptosis-priming effect of additional centrosomes is novel and of interest. However, in their previous manuscript (Morretton et al, EMBO Mol Med 2022), the Basto lab showed that centrosome amplification only occurs in a maximum of 3.2% of cells in a given ovarian cancer. Given the large discrepancy between the rate of centrosome amplification in the models here and in ovarian cancers ({greater than or equal to}80% vs {less than or equal to}3%), it is unclear whether the mechanism of apoptosis priming reported here is at play in a clinical setting. It is unclear whether the low rate of centrosome amplification observed in cancers can predispose response to a particular inhibitor, as suggested, particularly when centrosome amplification in {greater than or equal to}80% of cells 1) only induced apoptosis priming in 2 of 3 cell lines (Fig. S4F) and 2) induced relatively modest drug sensitivity (Fig. S4J). If it were shown in an additional experiment that induction of centrosome amplification in a small minority of cells, as occurs in patient tumors, increases MOMP priming and drug response, this would substantially increase the significance of the study.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      1. General Statements [optional]

      The findings presented in this manuscript are original and have not been previously published, nor is the manuscript under consideration for publication by another journal. The authors of this manuscript declare to have no conflicts of interest.

      1. Description of the planned revisions

      We believe that incorporating the suggested corrections and conducting the additional experiments recommended by the reviewers will significantly enhance the quality of this study. These revisions will not only bolster the current conclusions but also broaden the relevance and applicability of our work to a wider scientific audience, extending beyond the field of virology.

      As outlined in the following sections, we are fully committed to implementing the experiments proposed by the reviewers and making the necessary modifications to the manuscript in line with their suggestions. Our responses to each specific comment are provided below.

      Reviewer #1

      Evidence, reproducibility and clarity

      Summary: Several target cell entry pathways have been described for different viruses, including endocytic/ fusion pathways, some which are dynamin-dependent.

      Here the authors exploited cell lines with multiple dynamin gene disruptions and other cell biological tools, as well as a phenotypic range of previously characterized viruses, to evaluate the relative importance of dynamin and actin for entry of viruses, including SARS-CoV-2.

      In cells that lack the serine protease TMPRSS2, dynamin depletion blocked uptake and infection by SARS-CoV-2. Increasing the input virus partially rescued SARS-CoV-2 infection in the absence of dynamin, and both dynamin-dependent and dynamin-independent entry pathways were inhibited by drugs that disrupt actin polymerization.

      Examination by electron microscopy indicated that the dynamin-independent endocytic process was clathrin-independent, in that, in the absence of dynamin, the majority of Semliki Forrest Virions were detected in bulb-shaped, non-coated pits. When TMPRSS2 was expressed, SARS-CoV-2 infection was rendered dynamin-independent.

      Significance

      Overall, the experiments are expertly performed, the results and conclusions are convincing, the text is clearly written and accurately describes the data, and the manuscript makes an important contribution to a complex and important topic in the cell biology of virus infection. It would be reasonable for the authors to publish the manuscript with the current data.

      That being said, we have two main questions/comments:

      1. The authors point out that SFV differs from SARS-CoV-2 in that it required actin only for the dynamin-independent entry. The EM experiments were done with SFV, not with SARS-CoV-2. This raises the question of the relevance for SARS-CoV-2 of the interesting finding that, in the absence of dynamin, SFV associated with non-coated pits.

      If the authors had the tools to do similar EM experiments with SARS-CoV-2, it would be nice to include those results. Otherwise, it is fine to discuss/speculate about SARS-CoV-2 regarding this issue.

      RESPONSE:As requested by the reviewer, we are currently perform the suggested EM analysis of SARS-CoV-2 entry in the presence and absence of dynamins.

      1. The authors show that TMPRSS2 allows the original Wuhan strain and Delta Variant of SARS-CoV-2 to bypass the need for dynamin. This is presumably because TMPRSS2 allows SARS-CoV-2 to fuse at the plasma membrane, precluding need for endocytosis altogether. The authors also mention literature claiming that Omicron is more dependent upon endocytosis than the Wuhan and Delta variants. If the authors had data with Omicron it would be really nice to include it.

      RESPONSE: We have already conducted this experiment and have incorporated the quantitative results into the updated version of the manuscript, now presented as Figure 8.

      There were some minor typos/grammar/other quoted here:

      • Ultrastructural analysis by electron microscopy showed that this dynamin-independent endocytic processes - cell injests particles and nutrients by encoulfing them - some viruses have been show

      RESPONSE: Thank you for noticing the error. We have modified the text as: “Ultrastructural analysis by electron microscopy showed that this dynamin-independent endocytic processes appeared as 150-200 nm non-coated invaginations that have been shown to be efficiently used by numerous mammalian viruses, including alphaviruses, influenza, vesicular stomatitis, bunya, adeno, vaccinia, and rhinovirus.”.

      • The final step of an endocytic vesicle formation culminates with the pinching of vesicle off from the PM into the cytoplasm

      RESPONSE: We have modified the sentence as: “The concluding stage of endocytic vesicle formation is marked by the vesicle being pinched off from the plasma membrane and released into the cytoplasm.”

      • For other viruses, such as respiratory viruses (This word is a little strange here since influenza was mentioned in the last sentence.)

      RESPONSE: Thank you for noticing the error, we have removed the mention to respiratory viruses: “ For other viruses (including coronaviruses), the fusion is triggered by proteolytic cleavage of the spike proteins that, once cleaved, undergo conformational changes leading first to the insertion of the viral spike into the host membrane and, upon retraction, the fusion of viral and cellular membranes9,10.”.

      • Viruses that use a receptor that is internalized by dynamin-dependent endocytosis (e.g. CPV and the TfR) (just reminding that TfR is not a virus)

      RESPONSE: We have amended the sentence to avoid misunderstandings: “Viruses (e.g. CPV) that use a receptor (e.g. TfR) that are internalized by dynamin-dependent endocytosis cannot efficiently infect cells in the absence of dynamins.”.

      • that appeared surrounded by an electron dense coated

      RESPONSE: We have corrected the typo: “In MEFDNM1,2 DKO cells treated with vehicle control, TEM analysis revealed numerous viruses at the outer surface of the cells (Figure 4 A), as well as inside endocytic invaginations that were surrounded by an electron dense coat, consistent with the appearance of clathrin coated pits47,48 (CCP) (Figure 4 B).”

      • The main virial receptor could be internalized using two endocytic

      RESPONSE: We have corrected the typo: “The main viral receptor could be internalized using two endocytic mechanisms, one mainly available in unperturbed cells (e.g. dynamin-dependent), the other activated upon dynamin depletion (i.e. dynamin independent).”

      • Virus infection was determined by FACS analysis of virial induced EGFP

      RESPONSE: We have corrected the typo: ‘Virus infection was determined by FACS analysis of EGFP (VAVC and VSV), mCherry (SINV) or after immunofluorescence of viral antigens using virus-specific antibodies (IAV X31 and UUKV).”.

      Reviewer #2

      Evidence, reproducibility and clarity

      Summary: Ohja et al. present an interesting study investigating dynamin independent endocytic entry mechanism of viral infection. Using a genetic KO of 2 dynamin isoforms they show impacts on the infection of a range of large and small DNA and RNA viruses.

      They go onto show that SARS-CoV-2 may utilise a dynamin independent mechanism of infection that requires an intact actin cytoskeleton.

      Significance

      This work is of interest to the field of virology and has the potential to answer previously understudied entry mechanisms important for a wide range of viruses. It is a well presented piece of work overall.

      Major Comments:

      • The abstract does not in my opinion reflect the content of the paper and is too 'SARS-CoV-2' centric. The work involves the use of a range of viruses to first define a mechanism that is applicable to SARS-CoV-2 and I think the abstract and title should reflect this.

      RESPONSE: As per the reviewer's request, we will make revisions to the Title and Abstract. As a ‘non SARS-CoV-2-centric’ title we have amended the title to: Multiple animal viruses, including SARS-CoV-2, can infect cells using alternative entry mechanisms.

      • In figure 1H the authors postulate that the reduced impact of dyn1,2 KO on SFV infection may be due to the interaction with heparin sulphate proteoglycans. Have the authors considered performing experiments using Heparin to block infection in their KO cells -/+ tamoxifen treatment?

      RESPONSE: As per the reviewer's request, we will perform the proposed heparin experiments for SFV.

      • In Figure 2 the authors assess infection of a range of viruses in dyn1,2 KO cells showing differential effects in some viruses but not all.

      Have the authors confirmed whether tamoxifen treatment and the subsequent KD of dyn1,2 effect surface expression of the entry receptors for the viruses tested?

      RESPONSE: Although in general blocking receptor endocytosis results in an increase in its cell surface levels, we agree with the Reviewer that the effect of dynamin depletion on receptors levels should be monitored at least for some of the viruses. To address the question raised by the reviewer, we will monitor the surface expression of SFV receptors VLDLR and ApoER2, and of the CPV receptor TfR in the presence and absence of dynamins.

      We have already confirmed that there are no changes in the surface expression of SARS-CoV-2 receptor ACE2 in the absence of dynamin and this new data will be added to Figure 7.

      • Additionally in this setting, dyn1,2 KD may impact on post entry steps in the virus life cycle such as the initial establishment of viral replication.

      Can the authors either provide evidence as to how they have delineated measurement entry over replication or support their findings with psuedotyped virus-like-particles?

      RESPONSE: This is an important point. As suggested by the reviewer, we will perform infection experiments in the presence or absence of Dynamins using VLPs pseudotyped with SFV and VSV spikes.

      In addition, several of our experiments already indicate that upon dynamin depletion, the main block in virus infection is at the step of cell entry: 1) Upon DNM-depletion, the decrease in SARS-CoV-2 infection strongly correlates with a proportional block in spike (Figure 5) and virions (Figure 7) endocytosis; 2) exogenous expression of even low levels of the cell surface protease TMPRSS2 rescued SARS-CoV-2 infection in cells devoid of dynamins, indicating that merely by-passing endocytosis restores virus infection; 3) as shown in Figure 1 H for SFV, and in Figure 2 for multiple viruses, increasing the multiplicity of infection increases the number of infected cells, indicating that when virions access the dynamin-independent entry route, cells can be efficiently infected; 4) the infection of both negative strand (i.e. Uukuniemi virus, UUKV, Figure 2 ) and positive strand (i.e. human Rhino virus, HRVA1, Figure S3 D-E) RNA viruses, as well as DNA viruses (i.e. Vaccinia, Figure 2, and Adenovirus-5, Figure S3 B-C) are not affected by dynamin depletion, arguing against a general negative impact of dynamin depletion on cellular protein synthesis or other basic cell functions required for virus replication.

      • Figure 3, given the unexpected results with the dynamin inhibitors, could this experiment be repeated with the dyn1-3 triple KD presented in figures 5-8?

      RESPONSE: As requested by the reviewer, we will repeat the main inhibitor experiments presented in Figure 3 for SFV also in DNM TKO cells.

      • Statistical analysis of imaging data in figure 4 would help with the conclusions.

      RESPONSE: We have already performed the requested statistical analysis and modified Figure 4 accordingly.

      • Additionally, the authors comment that in the KD cells the viruses were trapped in 'stalled CCPs'. What morphological changes determine this classification?

      RESPONSE: As previously reported by Ferguson et al. (Developmental Cell, 2009), who developed the conditional MEF DNM knock out cell models, all CCPs are stalled at 6 days post induction of dynamin depletion. When observed by electron microscopy, stalled CCPs are readily identified by the presence of elongated, membranous narrow neck structures that connects the vesicle to the plasma membrane. We have clarified this description in the manuscript text and indicated the morphological features typical for a ‘stalled’ clathrin coated pit in Figure 4 F (black asterisk and white arrowheads).

      • Concerning the SARS-CoV-2 work presented in figures 6-8, the use of exogenous expression of the viral entry receptors ACE2 and TMPRSS2 is a concern.

      RESPONSE: While the reviewer appreciates that this is a necessary step to allow entry into their MEF-dyn1-3 KD cells, exogenous receptor expression can result in artificial entry of the virus.

      • To support their findings, can the authors perform experiments in either cell lines endogenously expressing ACE-2/TMPRSS2 such as Calu3 or Caco2 and KD dyn1-3 using transient siRNA?

      RESPONSE: This experiment poses a challenge due to the inherent difficulty of transfecting Caco2 and Calu3 cells and the potential difficulty of achieving a robust (>80%) simultaneous knockdown of all three dynamin isoforms. This is one of the reasons why we chose the conditional knock out approach. Nevertheless, we are committed to attempting this experiment.

      • This approach would also provide more evidence for the role of TMPRSS2 presented in SF5 as the limited expression of this protease limits the robustness of the conclusions one can draw from the data presented.

      RESPONSE: We appreciate the reviewer's observation, and to address this concern, we plan to not only perform siRNA knockdown of dynamins in cells with endogenous ACE2 and TMPRSS2 but also endeavor to elevate the expression levels of TMPRSS2 in our MEF DNM1,2,3 TKO ACE2 cells. It's worth noting, however, that this task presents a unique challenge since expression of TMPRSS2, a trypsin-like cell surface protease, leads to cell detachment even when expressed at moderate levels.

      Minor comments & typo:

      • Introduction paragraph 1 engulfing

      RESPONSE: The sentence has been amended: “To gain access into the host cell's cytoplasm where viral protein synthesis and genome replication take place, most animal viruses hijack cell’s endocytic pathways1 by which the cell engulfs particles and nutrients into vesicular compartments. “.

      • Pg 13 - typo in 'Figurre 6B'

      RESPONSE: The typo has been corrected.

      2. Description of the revisions that have already been incorporated in the transferred manuscript

      • Regarding the Reviewer 1 request on the use of Omicron variants, we have already conducted the requested experiments and have incorporated the quantitative results into the updated version of the manuscript, now presented as Figure 8.
      • Regarding the Reviewer 2 request on the EM data, we have already performed the requested statistical analysis and modified Figure 4 accordingly. We have also clarified the EM descriptions in the manuscript text and indicated the morphological features typical for a ‘stalled’ clathrin coated pit in Figure 4 F (black asterisk and white arrowheads).

      3. Description of analyses that authors prefer not to carry out

      none

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary

      Ohja et al present an interesting study investigating dynamin independent endocytic entry mechanism of viral infection. Using a genetic KO of 2 dynamin isoforms they show impacts on the infection of a range of large and small DNA and RNA viruses. They go onto show that SARS-CoV-2 may utilise a dynamin independent mechanism of infection that requires a intact actin cytoskeleton.

      Major Comments

      The abstract does not in my opinion reflect the content of the paper and is too 'SARS-CoV-2' centric. The work involves the use of a range of viruses to first define a mechanism that is applicable to SARS-CoV-2 and I think the abstract and title should reflect this.

      In figure 1H the authors postulate that the reduced impact of dyn1,2 KO on SFV infection may be due to the interaction with heparin sulphate proteoglycans, have the authors considered performing experiments using Heparin to block infection in their KO cells -/+ tamoxifen treatment

      In Figure 2 the authors assess infection of a range of viruses in dyn1,2 KO cells showing differential effects in some viruses but not all. Have the authors confirmed whether tamoxifen treatment and the subsequent KD of dyn1,2 effect surface expression of the entry receptors for the viruses tested? Additionally in this setting, dyn1,2 KD may impact on post entry steps in the virus life cycle such as the initial establishment of viral replication. Can the authors either provide evidence as to how they have delineated measurement entry over replication or support their findings with psuedotyped virus-like-particles?

      Figure 3, given the unexpected results with the dynamin inhibitors could this experiment be repeated with the dyn1-3 triple KD presented in figures 5-8.

      Statistical analysis of imaging data in figure 4 would help with the conclusions. Additionally, the authors comment that in the KD cells the viruses were trapped in 'stalled CCPs'. What morphological changes determine this classification?

      Concerning the SARS-CoV-2 work presented in figures 6-8, the use of exogenous expression of the viral entry receptors ACE2 and TMPRSS2 is a concern. While the reviewer appreciates that this is a necessary step to allow entry into their MEF-dyn1-3 KD cells exogenous receptor expression can result in artificial entry of the virus.

      To support their findings, can the authors perform experiments in either cell lines endogenously expressing ACE-2/TMPRSS2 such as Calu3 or Caco2 and KD dyn1-3 using transient siRNA. This approach would also provide more evidence for the role of TMPRSS2 presented in SF5 as the limited expression of this protease limits the robustness of the conclusions one can draw from the data presented.

      Minor comments

      typo: Introduction paragraph 1 engulfing

      Pg 13 - typo in 'Figurre 6B'

      Significance

      This work is of interest to the field of virology and has the potential to answer previously understudied entry mechanisms important for a wide range of viruses. It is a well presented piece of work overall.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Several target cell entry pathways have been described for different viruses, including endocytic fusion pathways, some which are dynamin-dependent. Here the authors exploited cell lines with multiple dynamin gene disruptions and other cell biological tools, as well as a phenotypic range of previously characterized viruses, to evaluate the relative importance of dynamin and actin for entry of viruses, including SARS-CoV-2. In cells that lack the serine protease TMPRSS2, dynamin depletion blocked uptake and infection by SARS-CoV-2. Increasing the input virus partially rescued SARS-CoV-2 infection in the absence of dynamin, and both dynamin-dependent and dynamin-independent entry pathways were inhibited by drugs that disrupt actin polymerization. Examination by electron microscopy indicated that the dynamin-independent endocytic process was clathrin-independent, in that, in the absence of dynamin, the majority of Semliki Forrest Virions were detected in bulb-shaped, non-coated pits. When TMPRSS2 was expressed, SARS-CoV-2 infection was rendered dynamin-independent.

      Significance

      Overall, the experiments are expertly performed, the results and conclusions are convincing, the text is clearly written and accurately describes the data, and the manuscript makes an important contribution to a complex and important topic in the cell biology of virus infection.

      It would be reasonable for the authors to publish the manuscript with the current data. That being said, we have two questions/comments:

      1. The authors point out that SFV differs from SARS-CoV-2 in that it required actin only for the dynamin-independent entry. The EM experiments were done with SFV, not with SARS-CoV-2. This raises the question of the relevance for SARS-CoV-2 of the interesting finding that, in the absence of dynamin, SFV associated with non-coated pits. If the authors had the tools to do similar EM experiments with SARS-CoV-2, it would be nice to include those results. Otherwise, it is fine to discuss/speculate about SARS-CoV-2 regarding this issue.
      2. The authors show that TMPRSS2 allows the original Wuhan strain and Delta Variant of SARS-CoV-2 to bypass the need for dynamin. This is presumably because TMPRSS2 allows SARS-CoV-2 to fuse at the plasma membrane, precluding need for endocytosis altogether. The authors also mention literature claiming that Omicron is more dependent upon endocytosis than the Wuhan and Delta variants. If the authors had data with Omicron it would be really nice to include it.
      3. There were some minor typos/grammar/other quoted here:
      4. Ultrastructural analysis by electron microscopy showed that this dynamin-independent endocytic processes
      5. cell injests particles and nutrients by encoulfing them
      6. some viruses have been show
      7. The final step of an endocytic vesicle formation culminates with the pinching of vesicle off from the PM into the cytoplasm
      8. For other viruses, such as respiratory viruses (This word is a little strange here since influenza was mentioned in the last sentence.)
      9. Viruses that use a receptor that is internalized by dynamin-dependent endocytosis (e.g. CPV and the TfR) (just reminding that TfR is not a virus)
      10. that appeared surrounded by an electron dense coated
      11. The main virial receptor could be internalized using two endocytic
      12. Virus infection was determined by FACS analysis of virial induced EGFP
    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      FULL REVISION

      The preprint of this article is uploaded in bioRxiv (doi:10.1101/2023.06.03.543550) (June 2023) and has been previously submitted and revised by peers in Review Commons. We attach the full Review, with a detailed answer to the Reviewers and a new revised version of the manuscript following the Reviewer’s comments and suggestions, adding new data, a new Supplementary figure, as well as a revision of the text and discussion. We are thankful to the reviewers for their helpful comments, which have further clarified some of aspects of our work and overall improved the quality of our manuscript.

      All the line’s numbering mentioned in the point by point answer to the reviewers refer to the converted pdf of the revised manuscript, including the main figures.

      Answers to Reviewer #1

      Aísa-Marín et al. present a detailed scRNAseq description of two Nr2e3 mouse models the authors had published in Neurobiology of Disease in 2020. These two mouse models do not mirror known pathogenic variants in human patients, but are useful animal models to understand disease mechanisms in NR2E3-linked retinal degenerations. The present follow-up study has been carefully done, the bioinformatic analysis is sound and selected pathways have been validated at protein level by immunohistochemistry and Western blot. The impact of this data on photoreceptor development and maintenance is somewhat decreased because previous data by the groups of Joseph Corbo, Connie Cepko, Jeremy Nathans, Anand Swaroop and others have already shown several years ago upregulation of cone-specific genes in a spontaneous Nr2e3 mutant mouse, the rd7 mouse. In these papers, hybrid cones both expressing cone- and rod-specific genes have been described and coined 'cods'. The authors are encouraged to use already defined terms in their paper. For instance, the concept of 'half differentiated' photoreceptors is unclear and must be rephrased. In general, existing literature is not always integrated adequately into the submitted work. The detailed remarks are listed below.

      We thank the reviewer for this suggestion to incorporate previous terminology in the field for the sake of clarity. Although it is true that previous authors have described hybrid photoreceptors, they have not quantified them, or compared their contribution to the different subpopulations of photoreceptors in different models of disease. For instance, there may be different types of hybrid photoreceptors, as they can be identified both within the cone and the rod populations, they show different characteristics and might perform different roles or else, be indicative of a pathological phenotype.

      Taking into account the reviewer’s suggestion, we have carefully revised our text and figures and the terms “intermediate” or “half differentiated photoreceptors” have been substituted by the already existing term “hybrid photoreceptors” of “incompletely differentiated”. We have also included some context in previous work regarding ‘cods’.

      See now lines 60, 146, 215, 271, 638-645 in the Discussion, Figure 7 legend and the Graphical Abstract for changes in terminology, and also sentences in lines 518-522, for reference to previous works.

      Reviewer #1

      One important question the authors must also address in their scRNAseq analysis is why the well described 'mixed' S- and M-opsin expressing cones do not seem detectable, are actually not even mentioned?

      We sincerely thank the reviewer for this comment, as it is a relevant piece of information that we missed in our previous analysis. Cones are usually classifed according to the type of opsin they express. In mouse, previous work has described cones expressing solely S- or M-opsins, but also cones that co-express both types of opsins. Indeed, we find these three types of cones, overlapping partially with our cone subpopulations, which are defined by a larger number of signature genes. As previously described, merging the results of the wild-type with the two mutants demonstrate that most cones co-express both opsins (roughly 46%), S- and M-opsins are expressed exclusively in around 13% cone cells each, and somewhat surprisingly around 28% of cones do not express any opsin (Fig. EVF6). However, the dissection of cone results by genotype is more informative, as the percentages vary according to the mutant genotype. In the mutants, the percentage of cones expressing no opsins is higher than in the wild-type at the expense of the cones that should express solely S-opsin (data in EVF5). Again reflecting the impact of Nr2e3 mutations on the differentiation of cones and reinforcing our main message.

      We have introduced several sentences in the text to reflect this results and refer to this new figure EVF6 (see lines 292-307 in the Results as well as 575-580 in the Discussion sections.

      Reviewer 1. Detailed comments:

      1. Graphical abstract: replace 'half differentiated' by incompletely differentiated or similar

      As detailed above, we have followed the suggestion of the reviewer and throroughly revised all the text and all Figures. “Half differentiated” and “intermediate photoreceptors” have been substituted by “incompletely differentiated” and “hybrid photoreceptors”, respectively.

      1. l.86: to my best knowledge, the shorter isoform has only been described at transcript level in humans, no evidence at protein level, please clarifiy. Please also state that the isoform lacking exon 8 is due to retention of intron 7.

      Following the suggestion of the reviewer, we have clarified that the short NR2E3 transcript isoform is due to retention of intron 7, both in human and mouse. We have also clarified that in human, the protein has been computationally predicted, whereas there are experimental evidences in mouse. (lines 94-104).

      1. l.89: lacks repressor and dimerization domains. Exon 8 is not coding all repressor and dimerization domains. The authors do not mention neither the D-box in the DBD that also contributes to dimerization, in addition to the LBD (von Alpen et al., Hum Mut, 2015). Furthermore, repressor domain should be presented in the context of the auto-repressed structure of NR2E3 (Zhu et al., Genes Dev, 2015).

      We agree with the reviewer that the original text was simplified. For the sake of clarity and following his/her suggestion we now include more context about the structure of NR2E3 and included the suggested references (lines 87-93).

      See also below the answer to the points 6, 9 and 13, which are also related.

      1. l.90: typo NR2E3

      The corresponding line is now on line 105 and the typo has been corrected.

      1. l.93-106: incorrect, please rewrite whole paragraph. There is only one single pathogenic variant leading to NR2E3-Gly56Arg-linked autosomal dominant retinitis pigmentosa, all other pathogenic variants are recessive and cause ESCS!

      Now these paragraph starts in line 105. We agree with the reviewer that so far only mutation Gly56Arg in NR2E3 is associated to autosomal dominant retinitis pigmentosa. however there are also some (even if few) NR2E3 mutations associated to autosomal recessive forms of RP, in addition to the most well known autosomal recessive mutations that cause ESCS. Here we provide a selection of reports supporting NR2E3 as causative of arRP (that are some more included in HMGD).

      In order to avoid further confusion to some readers, we also include these references in the new version (see lines 109-112).

      • Gerber, S. et al. The photoreceptor cell-specific nuclear receptor gene (PNR) accounts for retinitis pigmentosa in the Crypto-Jews from Portugal (Marranos), survivors from the Spanish Inquisition. Hum Genet 107, 276–284 (2000). https://doi.org/10.1007/s004390000350
      • Kannabiran, et al. Mutations in TULP1, NR2E3, and MFRP genes in Indian families with autosomal recessive retinitis pigmentosa. Mol. Vis. 2012; 18:1165-74..
      • Bocquet, B. et al. Homozygosity mapping in autosomal recessive retinitis pigmentosa families detects novel mutations. Mol Vis 19:2487-500.
        1. l.110: see comment above about dimerization.

      We have modified the sentence in the text accordingly, see now line 125.

      1. l.162: ok, but the main reason for restricting the analysis to photoreceptors should be the photoreceptor-specific expression of Nr2e3 though...

      We have specified that Nr2e3 is solely expressed in photoreceptor cells (see line 176).

      1. l.165: please specify what is the percentage of rods with respect to all retinal cells

      The percentage of rods is around 77.7% of all cells (now on line 180). We value the suggestion, as it adds information to the reader. Therefore, the percentage of each main cell type is now included in Figure 1B.

      1. l.210: idem l.89

      We have modified the sentence in the text accordingly (now on lines 226-227).

      1. l.310: replace 'halfway'

      As specified in the answer to the first main point, we have throroughly revised the text and amended the references towards hybrid and incompletely differentiated photoreceptors.

      1. l.337: as expected? please detail

      We agree that the sentece was not clear. We have now clarified that our results agree with previous studies (see lines 370-371).

      1. l.388: discuss also crystallins in other RD models, v.g. Rpe65 ko mice

      We thank the reviewer for this suggestion and have included a brief description of the expression of crystallins in response to retinal stress in other RD models, and include the appropriate references (now on lines 422-428).

      1. l.469: idem l.89

      We have modified the sentence in the text accordingly (see lines 506-509).

      1. l.526: Please discuss increase in non-apoptotic cell death markers with respect to published data in the rd7 mouse (Venturini et al., Sci Rep, 2021)

      We have included published data in the rd7 mouse and discussed that multiple non-apoptotic cell death markers might be activated in response to NR2E3 disfunction (see lines 587-593).

      1. l.580: the proposed dominant negative effect is overtly speculative and not supported by any presented data, please remove.

      We have rewritten the sentence removing the dominant negative effect and referring exclusively to our results.

      Answers to Reviewer #2

      Aísa-Marín et al. present a detailed scRNAseq description of two Nr2e3 mouse models the authors had published in Neurobiology of Disease in 2020. These two mouse models do not mirror known pathogenic variants in human patients, but are useful animal models to understand disease mechanisms in NR2E3-linked retinal degenerations. The present follow-up study has been carefully done, the bioinformatic analysis is sound and selected pathways have been validated at protein level by immunohistochemistry and Western blot.

      Major comments:

      1. Overall, the conclusions of the study are well supported by the results. The findings provide valuable insights into retinal development and the pathogenesis of NR2E3-associated retinal dystrophies in an animal model, which need to be validated in humans. This limitation should be noted in the manuscript.

      Indeed, we agree that our work has used animal models, but further work in human-derived models (e.g. retinal organoids) should be performed to confirm these results. We have clarified this point in the Discussion section (see lines 649-650).

      Include an explanation in the text about how the specificity of the different signals detected by immunohistochemistry was assessed.

      The specificity of each antibody was assessed by introducing a negative control into the immunostaining procedure, wherein only the secondary antibody was used, as well as by comparison to the staining of the protein of interest in wild type or basal conditions reported in previous work from ours or other groups. This has been now specified in the corresponding Methods section (see lines 912-916).

      Explain the observed high variability in the percentage of cones, particularly between the two deltaE8 mutants (Figure 3C).

      We believe that the main characteristic of the Nr2e3-mutant retinas is that photoreceptors are not adequately differentiated and thus, affected photoreceptor subpopulations, in this case cones, degnerate and die. The pathogenic phenotype might be somewhat variable between animals from the same genotype (as it also happens in siblings carrying the same mutation). The deltaE8 mutants show a very different cone subpopulation pattern compared to wild-types and they clearly cluster with the other mutant retinas. For instance, cones of subpopulation cone4 might have all died.

      We take note of the question posed by the reviewer, and thus have included a graph of the absolute number of cones in each subcluster per retina and genotype, which may help the reader (see new Fig 3C, panel on the right).

      Explain why PARP-1 signals in Figure 6E are so thick and intense. Why this thick pattern is also present in the wild type retina?

      The IHC of mouse tissue sections using antibodies of mouse origin can result in background by secondary antibody binding to the endogenous Igs (as reported in Eng et al, 2016, https://doi.org/10.1093/protein/gzv054). The PARP-1 antibody is a mouse monoclonal antibody (Abcam, ab14459). The strong signal that we observe in the INL, IPL, and GL of the retina is typically found when using primary mouse antibodies in mouse tissues and corresponds to the reaction of the secondary anti-mouse antibodies binding to the endogenous IgGs in the blood vessels of the retina (we obtain the same result using the secondary antibody as a negative control, see answer to point 2).

      For the sake of clarity, we have clarified this background staining in the corresponding figure legend (lines 831-834).

      Reviewer #2

      Minor comments:

      1. Describe the abbreviations used in the text, such as PARP-1, MLKL, IRD, and VADC.

      A list of abbreviations has been included at the end of the main text (see lines 663-672).

      1. Improve the visibility of number 4 in Figure 3A and describe the meaning of the insert.

      Figure 3A has been amended accordingly

      1. Label the X-axis (cone subclusters) in Figure 3E.

      The X-axis is now correctly labelled in Figure 3E.

      1. Describe the meaning of the insert in Figure 4A.

      Figure 4A legend now contains the meaning of the insert.

      1. Indicate the relationship among inserts in Figure 4F.

      Figure 4F and legend have been modified to clarify the meaning of the insert.

      1. Use an arrow to indicate the higher expression of CSTB in the cone-rich invaginations in the mutant retinas (Figure 6A).

      The Figure 6A has been modified to include white arrowheads indicating the high expression of CSTB in the invaginations of the mutant retinas. This is also indicated in the corresponding Figure 6 Legend (lines 819-820.

      1. Revise the Y-axis values in Figure 6B, as they do not correspond to a percentage. Please, provide an explanation for the number of symbols displayed in this panel.

      The Y-axis was previously expressed on a per-unit basis. For the sake of clarity and following the reviewer’s suggestion, it has now been appropriately modified to percentage of CSTB colocalizing with opsins.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Aísa-Marin et al. present a study on alterations in photoreceptor cell fate in NR2E3-associated diseases. The results convincingly reveal the presence of heterogeneous rod and cone populations in the mouse retina, as well as the existence of a novel cone pathway that results in hybrid cones characterized by the expression of genes associated with both cones and rods. Furthermore, the authors show that functional alteration of NR2E3 affects the expression of rod and cone signature genes, providing an interesting animal model to unveil the molecular mechanism underlying these retinal disorders.

      Major comments:

      1. Overall, the conclusions of the study are well supported by the results. The findings provide valuable insights into retinal development and the pathogenesis of NR2E3-associated retinal dystrophies in an animal model, which need to be validated in humans. This limitation should be noted in the manuscript.
      2. Include an explanation in the text about how the specificity of the different signals detected by immunohistochemistry was assessed.
      3. Explain the observed high variability in the percentage of cones, particularly between the two deltaE8 mutants (Figure 3C).
      4. Explain why PARP-1 signals in Figure 6E are so thick and intense. Why this thick pattern is also present in the wild type retina?

      Minor comments:

      1. Describe the abbreviations used in the text, such as PARP-1, MLKL, IRD, and VADC.
      2. Improve the visibility of number 4 in Figure 3A and describe the meaning of the insert.
      3. Label the X-axis (cone subclusters) in Figure 3E.
      4. Describe the meaning of the insert in Figure 4A.
      5. Indicate the relationship among inserts in Figure 4F.
      6. Use an arrow to indicate the higher expression of CSTB in the cone-rich invaginations in the mutant retinas (Figure 6A).
      7. Revise the Y-axis values in Figure 6B, as they do not correspond to a percentage. Please, provide an explanation for the number of symbols displayed in this panel.

      Significance

      While it is known that NR2E3, an orphan nuclear receptor, plays a role in photoreceptor fate and differentiation during retinal development, its precise biological function remains poorly characterized. Additionally, the mechanisms by which inherited functional alterations of NR2E3 lead to RP or ESCS are not well understood. To address these unresolved questions, the authors employ a comprehensive experimental approach, including scRNAseq, RT-PCR, and immunohistochemistry, using retinas from two NR2E3 mutant mice. The technical procedures are well executed, and the complex scRNAseq data are rigorously analyzed and presented in a clear manner. Overall, this is a careful and meticulous study, that provides the fundamental basis for further verification in humans.

      In my view, this research is highly relevant for the scientific community interested in the study of retinal development and inherited retinal dystrophies, specifically retinitis pigmentosa (RP) and enhanced S-cone syndrome (ESCS).

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Aísa-Marín et al. present a detailed scRNAseq description of two Nr2e3 mouse models the authors had published in Neurobiology of Disease in 2020. These two mouse models do not mirror known pathogenic variants in human patients, but are useful animal models to understand disease mechanisms in NR2E3-linked retinal degenerations. The present follow-up study has been carefully done, the bioinformatic analysis is sound and selected pathways have been validated at protein level by immunohistochemistry and Western blot. The impact of this data on photoreceptor development and maintenance is somewhat decreased because previous data by the groups of Joseph Corbo, Connie Cepko, Jeremy Nathans, Anand Swaroop and others have already shown several years ago upregulation of cone-specific genes in a spontaneous Nr2e3 mutant mouse, the rd7 mouse. In these papers, hybrid cones both expressing cone- and rod-specific genes have been described and coined 'cods'. The authors are encouraged to use already defined terms in their paper. For instance, the concept of 'half differentiated' photoreceptors is unclear and must be rephrased. In general, existing literature is not always integrated adequately into the submitted work. The detailed remarks are listed below.

      One important question the authors must also address in their scRNAseq analysis is why the well described 'mixed' S- and M-opsin expressing cones do not seem detectable, are actually not even mentioned?

      Detailed comments:

      Graphical abstract: replace 'half differentiated' by incompletely differentiated or similar l.86: to my best knowledge, the shorter isoform has only been described at transcript level in humans, no evidence at protein level, please clarifiy. Please also state that the isoform lacking exon 8 is due to retention of intron 7.

      l.89: lacks repressor and dimerization domains. Exon 8 is not coding all repressor and dimerization domains. The authors do not mention neither the D-box in the DBD that also contributes to dimerization, in addition to the LBD (von Alpen et al., Hum Mut, 2015). Furthermore, repressor domain should be presented in the context of the auto-repressed structure of NR2E3 (Zhu et al., Genes Dev, 2015).

      l.90: typo NR2E3

      l.93-106: incorrect, please rewrite whole paragraph. There is only one single pathogenic variant leading to NR2E3-Gly56Arg-linked autosomal dominant retinitis pigmentosa, all other pathogenic variants are recessive and cause ESCS!

      l.110: see comment above about dimerization

      l.162: ok, but the main reason for restricting the analysis to photoreceptors should be the photoreceptor-specific expression of Nr2e3 though...

      l.165: please specify what is the percentage of rods with respect to all retinal cells

      l.210: idem l.89

      l.310: replace 'halfway'

      l.337: as expected ? please detail

      l.388: discuss also crystallins in other RD models, v.g. Rpe65 ko mice

      l.469: idem l.89

      l.526: Please discuss increase in non‑apoptotic cell death markers with respect to published data in the rd7 mouse (Venturini et al., Sci Rep, 2021)

      l.580: the proposed dominant negative effect is overtly speculative and not supported by any presented data, please remove.

      Significance

      Strength: first scRNAseq analysis in Nr2e3 mouse models, validation at protein level

      Limitations: descriptive of gene expression, no mechanims identified, previous literature not adequately incorporated or missing

      Audience: specialized, basic research

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1

      The paper provides models of essential complexes formed in bacteria. These models have been predicted by AlphaFold2 and in some of the models, information from existing experimental structures is utilized. The predicted models have been calculated based on standard workflow procedures which are explained in detail and can be reproduced by others. The figures are informative and clear.

      We are grateful for the reviewer's insightful comments, which have significantly contributed to improve our manuscript.

      Suggestions for improvement:

      1. The PDB accession codes of the experimental structures should be providedb. A comparison of the predicted models with the experimental structures should be provided (e.g. same orientation, superposition). In Fig. 6 for example, a figure with superposition or use of the same orientation would be more informative.

      As suggested by the reviewer, we have included a new table (Table 1) listing all experimental structures discussed in the main text, with the corresponding PDB codes. All predictions are listed in Supplementary File 1. For instances with available PDB codes, we compared the predicted structures to the experimental ones (new Supplementary Figure 3). In Fig. 6, the structures were difficult to superimpose because the subunits in the complexes have different relative orientations. To help comparing both models, we have added a schematic representation (new Fig. 6c).

      The paper will certainly generate many hypotheses based on the predicted models. In this respect, it would be useful for a wide audience in the bioscience field. However, the discussed models will need experimental verification by various techniques, such as X-ray crystallography, cryo-EM, SAXS, and structural proteomics. A more thorough analysis of the literature may help to improve the paper in this respect.

      We acknowledge the reviewer's emphasis on the importance of experimental verification of the predicted models. We have conducted a thorough analysis of the literature to identify instances where experimental verification could complement our predictions. We identified several mutations in BirA, documented in the literature, that affect its interaction with AccB. __In BirA mutations M310L and P143T were found to induce a superrepressor phenotype (BirA lacks the capacity to biotinylate AccB). These mutations do not significantly affect the BirA active site, but can destabilize the BirA-AccB interface. __We have added this information in the main text. Also, we investigated whether our complexes have known crosslinks in the xlinkdb database(https://xlinkdb.gs.washington.edu/xlinkdb/). We found information for five of our predicted complexes. In all cases, the distance restraints identified by crosslinking (crosslinked lysines are ~15Å apart) are compatible with our models. We have incorporated these references into a new table in Supplementary File 1. Unfortunately, we could not find more information in the xlinkdb that can be used to further validate our complexes.

      Supplementary table. Selected binary complexes modeled by AF2 whose structure is experimentally verified by cross-linking mass spectrometry.

      Protein 1

      Protein 2

      Peptide 1

      Pepitde 2

      Species

      acca

      accd

      VNMLQYSTYSVISPEGCASILWKSADK

      IKSNITPTR

      E. coli

      dnak

      grpe

      DDDVVDAEFEEVKDKK

      VKAEMENLR

      E. coli

      rpob

      rpoc

      GKTHSSGK

      KGLADTALK

      E. coli

      bama

      bamd

      TVDIKPAR

      DVSYLKVAYQNFVDLIR

      A. baumannii

      secd

      secf

      ILGKTANLEFR

      MPSEDPELGKK

      P. aeruginosa

      Reviewer #2

      This study attempts to identify the 'essential interactome' through combining information in presence/absence genomics across bacteria, information in the STRING database, and predictions from alpha-fold. Overall, the strategy is clear, and I do not have concerns about reproducibility and clarity.

      We value the reviewer's constructive evaluation of our manuscript and we would like to thank the reviewer's feedback as it has significantly helped us in improving our manuscript.

      Strengths: Clever approach to get at the essential interactome.

      Weaknesses: Putative impact. It is clear why understanding which interactions are present are important. But even as the authors suggest, interactions are dynamic and there are plenty of other tools that people could use to find interactions (including AA Coev that the authors themselves cite). The counter argument the authors bring up is the high false positive rate of interactions that is solved by this method. While true, the stringency criteria for what constitutes an interaction in this paper is remarkably high: each protein within the interaction needs to be essential, and needs to have a high confidence score in STRING, and then there is a hyperparameter that dictates the level at which AlphaFold 2 is providing confident answers. In this sense, this is less about an 'essential' interactome, and more about an interactome that is present with the highest true positive rate (trading off with the ability to discover new interactions at a reasonable breadth).

      We appreciate the reviewer's insights concerning the stringency criteria for defining interactions. Here, we provide a detailed justification for our selection criteria and show how it aligns with our goal of identifying high-confidence interactions.

      1. Protein essentiality: In our model, interactions are considered essential if, and only if, both proteins involved are essential, providing a conservative estimate for the essential interactome. In our revised manuscript, we explored the possibility the potential for two non-essential proteins to form an essential interaction by investigating synthetically lethal interactions. Out of all synthetic lethal interactions in * coli*, only 28 interactions were identified, and only two could be modeled with an ipTM score > 0.6. Likely, these non-essential proteins operate in parallel or compensatory pathways instead of interacting directly. These findings lend support to our hypothesis and suggest that our interactome encompasses most essential interactions.
      2. Conditional essentiality: While we concur with the reviewer that our study does not address conditional essentiality, we would like to note that exploring conditional essential interactions across all the bacterial species discussed in our manuscript is currently unviable. Just as a matter of example, we checked the overlap in essential genes between Acinetobacter baumannii and Pseudomonas aeruginosa in the lung environment (Wang et al., 2014; Potvin et al., 2003). In that case, there is a minimal overlap between the two species, suggesting that conditional interactions might also be species-dependent. In our manuscript, we aimed to describe the core essential interactions for Gram-negative and Gram-positive bacteria under standard laboratory growth conditions. We agree that further research is needed to incorporate specific, context-dependent interactions to provide a complete, comprehensive view of the interactome. Nonetheless, we define here the first bacteria essential interactome that, in our opinion, marks a significant step towards understanding bacterial cell metabolism and holds relevance in applications such as developing broad-spectrum antibiotics.
      3. Confidence of the interaction: All existing methods to predict protein-protein interactions, including those based on coevolution, suffer from poor performance metrics. Most of them generate many false positive interactions while missing important ones. Without the aim of being exhaustive, here we reproduce a table of some of the latest computational methods to predict PPIs. Table 1. Performance of state-of-the-art PPI prediction methods (Huang et al., 2023).

      Methods

      AUPRCa

      *SGPPI *

      0.422

      Profppikernelb

      0.359

      PIPRc

      0.342

      PIPE2b

      0.220

      SigProdb

      0.264

      a AUPRC denotes the average AUPRC value of 10-fold cross-validation.

      It is clear from the data that such methods are not mature enough to be used as confident predictors. Hence, we decided to resort to validated interactions in the String database, which is one of the most comprehensive PPI databases__. In this revised version, we have expanded our data set to include all experimentally labeled interactions in the String database, even those with a low probability (experimental score > 0.15). The addition of these new interactions __increased the total number of interactions tested from 1089 to 1402 and generated 38 new models for Gram-negative species (13 with high accuracy) and 275 new models for Gram-positive bacteria (18 with high accuracy). All interactions are now included in the Supplementary File 1 and high accuracy models will be deposited on Model Archive after acceptance.

      Alphafold (AF2) criterion for complex prediction. Although AF2 has its limitations, its accuracy in predicting bacterial complexes is consistently high. In various benchmarking studies, AF2 Multimer accurately predicted between 70-75% of tested complexes, with almost 90% of them being of medium-to-high quality (Evans et al., Yin et al., 2022). While there might be some minor deviations, AF2 can largely capture the bacterial essential interactome accurately. In the revised version, we compare pDockQ and pDockQ2 metrics with our ipTM criterion to define confident models. We observed that both pDockQ and pDockQ2 metrics were capable of identifying highly reliable complexes, but also disregarded actual complexes (Supplementary Figure 1). Thus, we decided to retain our initial criterion, based on ipTM scores, which is consistent with other authors who used similar ipTM thresholds to model bacterial interactions (e.g., O’Reilly et al., 2023).

      In summary, although our methodology has inherent limitations, we believe that our approach is sound and can give a comprehensive and realistic view of the bacterial essential interactome. We hope that these new insights further substantiate our approach.

      I don't know of too many studies that use AlphaFold 2 in this way. This was clever. However, there are plenty of studies that use phylogenomic information to infer interactions. In this sense, the core idea of the paper is not intrinsically novel.

      We thank the reviewer for valuing our approach. Although other methods have been used to predict interactomes, our study, to the best of our knowledge, provides the first high-quality essential interactome for bacteria. We used experimental data (analysis of single deletion mutants) to define the essential interactions in bacteria. Other methods, either using phylogenomic information and/or deep learning tools to infer interactions, have a poor performance, as illustrated in the preceding table. Often, these methods yield a high number of interactions and, in many cases, show a bias towards overrepresented entries in the positive databases used to train the predictors (Macho Rendón et al., 2022). Also, while other methods lack detailed structural insights into the interactions, we offer structural models for every interaction tested.

      Overall, I do feel this would be worth publishing as an expose of AF2 is capable of. I'm not sure of the impact it will have on researchers, however.

      We appreciate the reviewer's positive feedback on our manuscript. Using AF2, we identified key interactions using only gene deletion mutant data. __This manuscript reveals new insights into the assembly of essential bacterial complexes, providing specific structural details to understand their stability and function. Additionally, __our work seeks to establish a methodology applicable to all bacterial species, guiding future research in this field. The approach taken in this study may expand drug targeting opportunities and accelerate the development of more effective antibiotics aimed to disrupt these essential interactions. In conclusion, the impact of the paper lies in its novel use of Alphafold2 to understand essential bacterial protein interactions, providing key insights into assembly mechanisms, and identifying new potential drug targets.

      Reviewer #3

      The selection of "essential" interactions is a bit arbitrary, given that their main criterion for selection is that both proteins are essential. Unfortunately, it's not always clear where the essential protein data is coming from. Authors cite Mateus et al. (ref 15) as source for E. coli, but I don't see an explicit list of essential genes in this paper (nor its supplement). For Pseudomonas the citation doesn't contain author information and for Acinetobacter essentiality only seems to refer to "essentiality" in the lung.

      As a minimum, the author should provide a table with summary statistics for the essential proteins they are using, as this is the basis for the whole paper. Such a table should include the names of the species, the number of genes that are considered as essential, a very brief characterization of how essentiality was determined and the source for this information. For instance, are the genes listed in the Supplementary File congruent with the genes in the Database of Essential Genes (DEG) for these organisms? Finally, authors should indicate in that table which (essential) protein pairs are conserved across species, as this is another one of their selection criteria. Conservation is not necessary for an essential interaction, but it certainly makes it more likely.

      We understand the reviewer's concerns regarding the selection of essential interactions and the need for a more thorough description of the sources of essential protein data. To address these concerns in the revised manuscript:

      1. __We included a clear explanation of the sources for essential protein data, including proper citations for each organism in Supplementary File 1. __The selected studies were primarily sourced from the DEG database. If data was unavailable, we revised the literature for relevant studies. The DEG database's most recent update was on September 1, 2020. __A graphical summary of the datasets has been included in Supplementary Figure 12, __that shows the overlapping between the different studies.
      2. We included comprehensive information for the essential proteins used in our study in Supplementary File 1. The file provides two tables detailing genes for both Gram-positive and Gram-negative datasets. Each table lists the gene names and their corresponding Uniprot IDs for every species in our study, as well as their orthologues in other organisms. Also, the reviewer was right in pointing out that for Acinetobacter baumannii, the study was conducted in the lung, which may bias the results as all other studies were performed in the test tube. To solve this, we replaced this study for Bai et al., 2021, that was performed in rich medium.

      Author should also state whether they have verified that none of the random pairs are in the positive set.

      We thank the reviewer for this comment. We certainly checked that none of the random pairs was present in the positive dataset. This clarification has now been added to the methods section.

      This is also relevant because authors "retrieved all high-confidence PPIs between these proteins from the STRING database" which provides compound scores for interactions but that has often little to do with physical interactions (given that the scores factor in co-expression and several other criteria). In fact, I find STRING scores difficult to interpret for that very reason.

      We appreciate the reviewer's comment to the use of combined interaction scores from the STRING database. We agree with the reviewer that STRING combined scores are somehow difficult to interpret because they combine different evidence of interaction. We decided to use the STRING combined scores to include interactions that may not have direct experimental evidence but are probable to interact according to other information (e.g., co-expression). However, to further examine the interactome we have also included in the revised version all interactions with experimental evidence in String to complete our interactome. As mentioned in the response to Reviewer 1, __we expanded the tested interactions from 1089 to 1402. This resulted in 38 new models for Gram-negative species, with 13 being highly accurate, and 275 for Gram-positive bacteria, of which 18 were highly accurate. All interactions are now included in the Supplementary File 1 __and high accuracy models will be deposited on the Model Archive after acceptance.

      The authors "reasoned that a given interaction would only be essential if and only if both proteins forming the complex are essential" - this sounds reasonable but doesn't capture synthetically lethal (genetic) interactions, that is, interactions between two proteins that are both non-essential but are essential in combination. Admittedly, I don't have a number of how many such cases exist, but there are such cases in the literature (e.g. Hannum et al. 2009, PLoS Genet 5[12]: e1000782, for yeast).

      We thank the reviewer for bringing this point into discussion. We acknowledge that our reasoning does not capture synthetic lethality, which occurs when the loss of one of two individual genes has no effect on cell survival, but the simultaneous loss of both leads to cell death. In this case, the two genes or proteins are non-essential individually but become essential in combination. To cover synthetic lethality, we retrieved all synthetically lethal interactions found in Escherichia coli, strain K12-BW25113 from the Mlsar database and included them in our pipeline. We identified 28 synthetically lethal PPIs (involving 45 proteins) and we modeled them with AF2. Only two interactions displayed an ipTM score > 0.6 (nadA-pncB and nuoG-purA). Hence, the number of interactions due to synthetic lethality seems to contribute low to the overall interactome. We believe that synthetic lethal partners often function in parallel or compensatory pathways, rather than directly interacting with each other. For example, in yeast, the genes RAD9 and RAD24 are synthetic lethal. RAD9 is involved in cell cycle checkpoints, while RAD24 is involved in DNA damage response. They function in related pathways but do not encode proteins that directly interact with each other. Hence, finding specific examples of proteins that are both synthetic lethal and directly interact might be challenging as the synthetic lethal relationship often reveals functional rather than physical interactions.

      Apart from that, one could question the selection method more generally, given that for a biological process always essential and non-essential proteins work together, so I wonder why the authors didn't include additional proteins known to be involved in specific processes as this could make their predictions much more biologically meaningful.

      We agree with the reviewer that accessory proteins are important to understand the biological context of interactions. In fact, in several sections of our manuscript, we included accessory proteins to fully describe the essential complexes. For example, in the cell division complex, we incorporated proteins like MreCD-RodZ from the elongasome to enhance the structural context of the interactions. However, a comprehensive explanation of all identified interactions and accessory proteins would extend beyond the scope of this manuscript and further lengthen an already extensive document. In our study, we sought to describe the fundamental interactions for both Gram-negative and Gram-positive bacteria. We anticipate that our findings will prompt additional research to confirm our hypotheses and enhance knowledge of these protein complexes within the proper cellular context.

      In any case, to understand their choice better, authors should provide a table (in the main text) summarizing the proteins they actually analyze and discuss in more detail in their models. This would allow a reader to see which proteins are considered essential and which ones are missing. I would organize this by function / pathway / process, so these proteins are listed in a functional context.

      We added Table 1 in the main text, listing all interactions described in the text. Table 1 includes the proteins involved in each complex, the ipTM score of the interaction, whether a PDB code is available for comparison and the functional classification of the interaction.

      With regard to docking, please also discuss why you focus on iPTM, as there are other derived metrics from AF2 scores, such as pdockq based on if_plddt (e. g. Bryant et al, 2022), as well as external metrics to AF2 (physics-based methods such as Rosetta). Another option may be a modified versions of AF2 multimer, such as AFSample, which produces a greater diversity of models, allowing for more "shots on goal" and ultimately a higher success rate, assuming one has a reliable QC filter (I wonder how those compares to iPTM).

      We did not use AFsample because is a very expensive computational approach that would require too many resources for the batch prediction of more than 1.400 complexes. AFsample generates 240x models, and including the extra recycles, the overall timing is around 1,000x more costly than the baseline. However, we acknowledge that using other metrics can be useful to further evaluate our models. Hence, we investigated how pDockQ and pDockQ2 metrics compare with ipTM score. We observed that pDockQ hardly correlates with ipTM (R = 0.328) whereas the improved metric pDockQ2 correlates much better (R = 0.649). All complexes described in the manuscript, which have an ipTM score higher than our threshold (0.6), have also a pDockQ2 score higher than 0.23, except for six interactions that have a lower pDockQ2 score. However, these scores improve when the interactions are modeled with accessory proteins in the complex. This somehow suggests that the ipTM metric better captures binary interactions when these are excluded from their context. __It is possible however, that pDockQ scores are better in discriminating false positive interactions than ipTM scores. Based on the strong correlation between the two metrics and the observation that ipTM may better capture binary interactions, we decided to keep our method in the manuscript. Other authors have employed analogous ipTM thresholds to model bacterial interactions (e.g., O’Reilly et al., 2023). Notwithstanding, __we also included pDockQ and pDockQ2 metrics in Supplementary File 1, so readers can evaluate complexes based on these metrics.

      Minor comments:

      1. 1, 3rd last line: "the essential interactome is a potentially powerful strategy to [...] identify new targets for discovering new antibiotics"

      2. Figures and figure legends need to be explicit which species is represented (ideally with a Uniprot ID) and which structure was predicted by alphafold and which one has an experimental structure. Known structures should be indicated in a table, as suggested above.

      3. Figure 5: LptF is too dark when printed, so a lighter color may be better.

      4. Figure 6: The cryoEM and alphafold structures look quite different, so please discuss discrepancies between them (in terms of prediction or cryEM modeling). A schematic may be helpful to illustrate the differences in more clarity.

      5. Figure 7: LolC is also too dark when printed. Make lighter.

      6. Maybe in some cases it may be worthwhile looking at Consurf structures to see if the predicted inferfaces are indeed more conserved than the non-conserved parts.

      We thank the reviewer for his/her insightful feedback on our manuscript. We have addressed all these comments as follows:

      1. The statement on page 1 was revised as suggested.
      2. We revised all figure legends to include the Uniprot IDs, and distinguish between predicted and experimental structures. We also included Table 1 and Supplementary File 1 for known structures.
      3. We adjusted the colors in Figures 5 and 7 to enhance print visibility.
      4. We provided a schematic to illustrate discrepancies between cryoEM and AlphaFold structures in Figure 6c.
      5. We used Vespa to highlight conserved interfaces in the complexes described in the manuscript, as suggested. The figures displaying the conservation of interfaces in the complexes are now depicted in Supplementary Figure 2. A comparison between interface and surface conservation can be found in Figure 1f.

        The main significance of this study is its potential use for a better understanding of the protein complexes described in more detail (and the fact that alphafold can be applied in a similar fashion to many other complexes). This is why the individual sections need to be evaluated to process-specific experts (disclaimer: I have only worked on some of the complexes, but I am not an expert on any of them). I wonder if it would make more sense to break out some of the sections on individual complexes into separate papers, and then discuss them in more detail and with more context from previous studies. Complexes such as the divisome have a huge body of literature and it may be worth reviewing which structures are known and which ones are not. However, the dynamic and labile nature of these complexes have made it difficult for both crystallography as well as modeling to get a good structural understanding, but some of the models proposed here may be useful for overcoming some of these hurdles.

      We appreciate the reviewer's suggestion. While we acknowledge the complexity of some of the individual complexes, such as the divisome, and the wealth of existing literature, we believe that the current manuscript provides a valuable comprehensive view on how AF2 can be used to predict essential protein complexes in bacteria. In our opinion, dividing the manuscript in separate pieces might dilute its scope. Nonetheless, we are exploring in our laboratory the interactions detailed in the manuscript, aiming to further expand the knowledge on these important complexes and their potential as targets for new antimicrobials.

      References:

      Bai J, Dai Y, Farinha A, et al. Essential Gene Analysis in Acinetobacter baumannii by High-Density Transposon Mutagenesis and CRISPR Interference. J Bacteriol. 2021; 203(12):e0056520.

      Evans R, O’Neill M, Pritzel A, et al. Protein complex prediction with AlphaFold-Multimer.

      bioRxiv. 2021; 2021.10.04.463034.

      Huang Y, Wuchty S, Zhou Y, Zhang Z. SGPPI: structure-aware prediction of protein-protein interactions in rigorous conditions with graph convolutional network. Brief Bioinform. 2023; 24(2):bbad020

      Macho Rendón J, Rebollido-Ríos R, Torrent Burgas M. HPIPred: Host-pathogen interactome prediction with phenotypic scoring. Comput Struct Biotechnol J. 2022; 20:6534-6542.

      O'Reilly FJ, Graziadei A, Forbrig C, et al. Protein complexes in cells by AI-assisted structural proteomics. Mol Syst Biol. 2023; 19(4):e11544.

      Potvin, E., Lehoux, D.E., Kukavica-Ibrulj, I., et al. In vivo functional genomics of Pseudomonas aeruginosa for high-throughput screening of new virulence factors and antibacterial targets. Environmental Microbiology. 2003; 5: 1294-1308.

      Wang N, Ozer EA, Mandel MJ, Hauser AR. Genome-wide identification of Acinetobacter baumannii genes necessary for persistence in the lung. mBio. 2014; 5(3):e01163-14.

      Yin, R, Feng, BY, Varshney, A, Pierce, BG. Benchmarking AlphaFold for protein complex modeling reveals accuracy determinants. Protein Science. 2022; 31(8):e4379.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary:

      Gómez-Borrego & Torrent-Burgas selected and modelled 1089 interactions between "essential" proteins in bacteria and generated 115 what they call "high-accuracy" models (using alphafold2). Some of the models potentially provide new insight into structure-function relationships of various biological processes and thus may serve as basis for further exploration.

      Major comments

      Methods

      The selection of "essential" interactions is a bit arbitrary, given that their main criterion for selection is that both proteins are essential. Unfortunately, it's not always clear where the essential protein data is coming from. Authors cite Mateus et al. (ref 15) as source for E. coli, but I don't see an explicit list of essential genes in this paper (nor its supplement). For Pseudomonas the citation doesn't contain author information and for Acinetobacter essentiality only seems to refer to "essentiality" in the lung.

      As a minimum, the author should provide a table with summary statistics for the essential proteins they are using, as this is the basis for the whole paper. Such a table should include the names of the species, the number of genes that are considered as essential, a very brief characterization of how essentiality was determined and the source for this information. For instance, are the genes listed in the Supplementary File congruent with the genes in the Database of Essential Genes (DEG) for these organisms? Finally, authors should indicate in that table which (essential) protein pairs are conserved across species, as this is another one of their selection criteria. Conservation is not necessary for an essential interaction, but it certainly makes it more likely.

      Author should also state whether they have verified that none of the random pairs are in the positive set.

      This is also relevant because authors "retrieved all high-confidence PPIs between these proteins from the STRING database" which provides compound scores for interactions but that has often little to do with physical interactions (given that the scores factor in co-expression and several other criteria). In fact, I find STRING scores difficult to interpret for that very reason.

      The authors "reasoned that a given interaction would only be essential if and only if both proteins forming the complex are essential" - this sounds reasonable but doesn't capture synthetically lethal (genetic) interactions, that is, interactions between two proteins that are both non-essential but are essential in combination. Admittedly, I don't have a number of how many such cases exist, but there are such cases in the literature (e.g. Hannum et al. 2009, PLoS Genet 5[12]: e1000782, for yeast, or Babu et al. 2014 PLoS Genet 10[2]: e1004120, for E. coli).

      Apart from that, one could question the selection method more generally, given that for a biological process always essential and non-essential proteins work together, so I wonder why the authors didn't include additional proteins known to be involved in specific processes as this could make their predictions much more biologically meaningful.

      In any case, to understand their choice better, authors should provide a table (in the main text) summarizing the proteins they actually analyze and discuss in more detail in their models. This would allow a reader to see which proteins are considered essential and which ones are missing. I would organize this by function / pathway / process, so these proteins are listed in a functional context.

      With regard to docking, please also discuss why you focus on iPTM, as there are other derived metrics from AF2 scores, such as pdockq based on if_plddt (e. g. Bryant et al, 2022), as well as external metrics to AF2 (physics-based methods such as Rosetta).

      Another option may be a modified versions of AF2 multimer, such as AFSample, which produces a greater diversity of models, allowing for more "shots on goal" and ultimately a higher success rate, assuming one has a reliable QC filter (I wonder how those compares to iPTM).

      These details are required to make the study truly transparent and reproducible.

      Results

      Given the methodological caveats given above, some of the results are certainly convincing and interesting to a broader readership.

      However, since their models are predictions, it would be important to provide some guidance on which interactions are the highest-scoring and thus the most promising for further validation. I would thus include a list of interactions for each functional group and their scores. This would be more useful than the rather difficult to interpret Figure 2 (even though it looks nice - or just add a table and leave Figure 2). Such a table could (and should) also include other data, such as references that support those top-ranking (but still unknown) interactions, or which structure are already known.

      Minor comments

      P. 1, 3rd last line: "the essential interactome is a potentially powerful strategy to [...] identify new targets for discovering new antibiotics"

      Figures and figure legends need to be explicit which species is represented (ideally with a Uniprot ID) and which structure was predicted by alphafold and which one has an experimental structure. Known structures should be indicated in a table, as suggested above.

      Figure 5: LptF is too dark when printed, so a lighter color may be better.

      Figure 6: The cryoEM and alphafold structures look quite different, so please discuss discrepancies between them (in terms of prediction or cryEM modeling). A schematic may be helpful to illustrate the differences in more clarity.

      Figure 7: LolC is also too dark when printed. Make lighter.

      Maybe in some cases it may be worthwhile looking at Consurf structures to see if the predicted inferfaces are indeed more conserved than the non-conserved parts.

      Significance

      The main significance of this study is its potential use for a better understanding of the protein complextes described in more detail (and the fact that alphafold can be applied in a similar fashion to many other complexes).

      This is why the individual sections need to be evaluated to process-specific experts (disclaimer: I have only worked on some of the complexes but I am not an expert on any of them).

      I wonder if it would make more sense to break out some of the sections on individual complexes into separate papers, and then discuss them in more detail and with more context from previous studies. Complexes such as the divisome have a huge body of literature and it may be worth reviewing which structures are known and which ones are not. However, the dynamic and labile nature of these complexes have made it difficult for both crystallography as well as modeling to get a good structural understanding, but some of the models proposed here may be useful for overcoming some of these hurdles.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      This study attempts to identify the 'essential interactome' through combining information in presence/absence genomics across bacteria, information in the STRING database, and predictions from alpha-fold. Overall, the strategy is clear, and I do not have concerns about reproducibility and clarity.

      Significance

      General Assessment:

      Strengths: Clever approach to get at the essential interactome.

      Weaknesses: Putative impact. It is clear why understanding which interactions are present are important. But even as the authors suggest, interactions are dynamic and there are plenty of other tools that people could use to find interactions (including AA Coev that the authors themselves cite). The counter argument the authors bring up is the high false positive rate of interactions that is solved by this method. While true, the stringency criteria for what constitutes an interaction in this paper is remarkably high: each protein within the interaction needs to be essential, and needs to have a high confidence score in STRING, and then there is a hyperparameter that dictates the level at which AlphaFold 2 is providing confident answers. In this sense, this is less about an 'essential' interactome, and more about an interactome that is present with the highest true positive rate (trading off with the ability to discover new interactions at a reasonable breadth).

      Advance: I don't know of too many studies that use AlphaFold 2 in this way. This was clever. However, there are plenty of studies that use phylogenomic information to infer interactions. In this sense, the core idea of the paper is not intrinsically novel.

      Audience: specialized. Overall, I do feel this would be worth publishing as an expose of AF2 is capable of. I'm not sure of the impact it will have on researchers however.

      Field of expertise: Statistical genomics.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      The paper provides models of essential complexes formed in bacteria. These models have been predicted by AlphaFold2 and in some of the models, information from existing experimental structures is utilized. The predicted models have been calculated based on standard workflow procedures which are explained in detail and can be reproduced by others. The figures are informative and clear.

      Suggestions for improvement:

      • a. The PDB accession codes of the experimental structures should be provided
      • b. A comparison of the predicted models with the experimental structures should be provided (e.g. same orientation, superposition). In Fig. 6 for example, a figure with superposition or use of the same orientation would be more informative.

      Significance

      The paper will certainly generate many hypotheses based on the predicted models. In this respect, it would be useful for a wide audience in the bioscience field. However, the discussed models will need experimental verification by various techniques, such as X-ray crystallography, cryo-EM, SAXS, and structural proteomics. A more thorough analysis of the literature may help to improve the paper in this respect.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In the present paper, authors study the effect of the L250P mutation on Fbxo7, leading to a severe infantile onset motor impairment.

      They show by co-IP that the mutation selectively ablates the interaction of Fbxo7 with the protesomal adaptor PI31. It induced a reduction in endogenous Fbxo7, which had a reduced half-life, and concomitantly of PI31 levels, without affecting its half-life, and a reduction in the expression of some subunits of the proteasome, and altogether, a reduction in its activity. To identify substrates of SCF Fbxo7 reliant on PI31 they used some databases and proteins arrays and identified MiD49 and MiD51, involved in mitochondrial fission machinery. Authors show PI31 acts as an adaptor and allows SCFfbxo7 ligase to ubiquitinate MiD49, therefore L250P mutation alters its substrate repertoire. It is shown Fbxo7 stabilizes Mid49 and Mid51. Importantly, reduced levels of Fbxo7 (KD) mimic the effect of the mutation.

      Despite the affectation of MiD49, mitochondrial network appeared unaffected. However they observed that Fbxo7 L250P mutation led to a general alteration of the mitochondrial function: reduction of the mitochondrial mass, leading to reduced oxygen consumption, lower mitophagy and biogenesis and increased ROS production. Data are well presented, findings are convincing and complete and discussion seems appropriate.

      I just have some minor comments:

      According to the data showing that Fbxo7 KD mimics the effects of the L250P mutation, it appears that the altered stabilization of Fbxo7 is a key event in the process and results observed. How do the authors explain the reduction of Fbxo7 half-life induced by the mutation?

      I would find more appropriate that to estimate the mitochondrial mass, the relative area or volume of Mitotracker green fluorescence is quantified, rather than its average intensity.

      It is not accurate to say TMRE is only able to enter mitochondria and fluorescence when there is an intact membrane potential. Rather, its accumulation is dependent on the mitochondrial membrane potential.

      Significance

      Authors provide a comprehensive study of the effects of the novel mutation L250P in Fbxo7 gene, leading to infantile onset PD. Findings are new and describe the mechanism this mutation changes the substrate repertoire of SCFFbxo7 ligase and affect mitochondrial function. The paper could be of interest to both clinical and basic researchers focused on PD and mitochondrial function.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary

      In this article, Sara Al Rawi and colleagues hypothesize that the homozygous L250P FBXO7 mutation identified in an infant with reduced facial and limb movements and axial hypotonia affects the Fbxo7-PI31 interaction domain. The authors used patient fibroblasts carrying the pathogenic mutation to show reduced expression of Fbxo7 and PI31 on those cells, and reduced proteasome levels and activity. Moreover, their data suggest that the L250P mutation affects the mitochondrial function and promotes increased levels of reactive oxygen species (ROS).

      Major comments:

      • The only thing that be argued is that Supplementary Table 1 containing the list of whole exome sequencing (WES) hits is missing. Please add it to the manuscript to check that the FBXO7 variant is the most plausible one considering the clinical phenotype of the affected individual.

      Minor comments:

      There are a few minor details that I would modify to improve the general readability of the manuscript: - The authors state that parents of the affected individual are "related", but do not specify the degree of consanguinity that they have. It was only in my second read of the manuscript that I realized that parents were consanguineous, and that the presence of a homozygous mutation made sense. It would help to state the degree of consanguinity between parents so that the reader can understand that a homozygous mutation is plausible. - In the clinical description of the patient, I would add the interpretation of a "developmental quotient (DQ) = 40", such as "a score <75 indicates a developmental delay", since some basic scientists may not be used to interpret those scores and cannot identify right away the degree of clinical impairment. - Many researchers are used to interpret the potential pathogenicity of a "candidate variant" using the CADD score. You can add this score to the paragraph where you mention the predicted pathogenicity of other in silico tests. - In the section "Fbxo7 stabilizes MiD49/51 protein levels", the beginning of the second paragraph: "To test whether knock-down of Fbxo7 levels phenocopies the effect of the L250P point mutation, [...]" is hard to understand. I would rewrite this first sentence in a different way to make it easier to read.

      Significance

      The manuscript is well written, and the results are coherent and supported by impressively detailed methods. The results of this manuscript are important for the advance of the movement disorders field. It shows how the novel L250P FBXO7 mutation in homozygous status can cause a very early onset (neonatal) movement disorder. Additionally, the functional analyses performed in patients' fibroblasts characterize very well the effect of this mutation on the cellular machinery showing proteasomal dysfunction, mitochondrial dysregulation, and ubiquitination alteration.

      The content of the manuscript is interesting for a broad spectrum of individuals: from pediatric movement disorders specialists to basic researchers interested in proteasomal and mitochondrial dysfunction.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      This study reports a human pediatric patient carrying a mutation in the Fbxo7/PARK15 gene. Several previous reports demonstrated that loss of Fbxo7/PARK15 gene function causes early-onset parkinsonian-pyramidal syndrome, but the precise underlying molecular mechanism remains to be elucidated. Based on studies with patient fibroblasts the authors suggest that Fbxo7 and its conserved binding partner PI31 regulate proteasomes and mitochondria, and that PI31 is an adaptor for the SCF Fbxo7 E3 ubiquitin ligase. The observations presented here are potentially interesting, but at this point they lack sufficient experimental evidence to support the main conclusions.

      A general weakness of this study is that experiments focus on patient fibroblasts, and not neurons. Fbxo7/PARK15 patients as well as mouse mutants have neurological phenotypes, but no overt defects in skin or connective tissues. Therefore, it is not clear how the reported observations relate to the clinical symptoms. This is of particular concern since a conflicting report (Kraus et al., 2023) has found no change in basal mitophagy in Fbxo7 KO iNeurons.

      The authors show that the proteasome regulatory protein PI31 is cleaved in Fbxo7 mutant cells. The cleavage and inactivation of PI31 upon inactivation of Fbxo7 was originally reported in Bader et al., 2011 (Cell 145, 371-82), but this paper is not cited. On the other hand the authors are citing a yet unpublished biorxiv preprint by Sanchez-Martinez et al. (https://www.biorxiv.org/content/10.1101/2022.10.10.511602v3) on the Drosophila Fbxo7 ortholog but another highly relevant preprint showing that transgenic expression of PI31 can extensively compensate for the inactivation of Fbxo7 in mice is not included (https://www.biorxiv.org/content/10.1101/2020.05.05.078832v1). This lack of consistency in citing prior works is concerning and should imperatively be rectified to provide a transparent and more accurate account of the novelty of the presented findings. Therefore, the bibliography of the manuscript is incomplete and relevant citations are missing.

      The idea that PI31 is an adaptor for SCF-FBXO7 ubiquitination has not sufficient experimental support. The authors use the correlation of the L250P mutation not interacting with PI31 and not ubiquitinating MiD49 to propose that PI31 is an adaptor needed for MiD49 (and TOMM22 and Rpl23) ubiquitination by FBXO7 - this is an over-interpretation; this claim should be toned down or supported by further investigations.

      FBXO7 can ubiquitinate MiD49 in vitro, but in vivo it appears to protect MiD49 from ubiquitination. Moreover, reduced FBXO7 levels (either by L250P mutation or knock down) result in decreased MiD49 and MiD51. There is no mechanistic explanation for these seemingly contradictory findings.

      Mitochondrial homeostasis of patient fibroblasts appears aberrant. In particular, there seems a reduction of mitochondrial mass, reduced basal mitophagy and reduced respiration, which contrasts the report by Krauss et al. (2023). A potential explanation for these disparate observation is suggested by the decreased transcription of two mitochondrial transcription factors, PGC1α and PPARγ. How FBXO7 inactivation leads to this decrease in PGC1α and PPARγ or a decrease in basal autophagy is not clear.

      In sum, there are some potentially interesting preliminary observations, but the study is not convincing because the results are over-interpreted and the analysis is not sufficiently rigorous.

      Specific comments:

      Figure 1 panel C has no loading control for total lysates.

      Figure 2 panel B. The authors state that this experiment suggests direct interaction of PI31 with MiD49 (in the discussion they drop "suggests"). GST-pulldown with bacterially expressed GST-PI31 with MiD49/51 in vitro transcribed in rabbit reticulocyte lysate, which is less complex than HEK293 lysate, but not a purified system (for example, they contain proteasomes and other UPS components). This does not prove direct interaction. They show a Coomassie gel of the purified GST and GST-PI31, but not the reticulocyte lysate.

      Figure 2 panels I and J. In panel I they show a decrease of Mi49 following FBXO7 KD, a main point of the paper that MiD49 is a FBXO7/PI31 substrate. However, in panel J for time zero of their hydrogen peroxide treatment time course it appears that Mi49 from the FBXO7 KD is as abundant if not greater than the Mi49 for the control time zero. Why? Even in the graph in panel K they start at the same level, though that probably is due to the way they normalize the data, which is not stated clearly.

      The legend for figure 3 panel C states that the figure shows cells from control and the patient imaged under basal conditions or following treatment with 2-deoxyglucose, yet in the figure there are only two panels!?

      For the proteasome activity assay, in the text they state that they use Suc-LLVY-AMC, which releases a fluorescent signal when proteolytically cleaved, but in the Materials and Methods they say that they use the Proteasome-Glo Chymotrypsin-like assay (Promega G8621), which is a two-step luminescent assay. These are not the same assays.

      Finally, this ms is very similar to a bioxrchive paper from the Laman-lab, but there are some notable omissions:

      1. In their bioxrchive paper they show a very clear decrease in LMP7(beta5i) protein in figure 1 panel D. This would go along with the decrease in other proteasome subunits, but this result is not mentioned in this manuscript. Why?
      2. The bioXrchive figure 1 panel E was replaced here with a considerably lower quality Western blot (Figure 1 panel F, using tubulin instead of GAPDH as the loading control). Again, the reason is not clear.

      Significance

      A better understanding of how mutations in Fbxo7/PARK15 cause juvenile onset neuronal degeneration would be very important and significant. Unfortunately, the current study is not sufficiently rigorous while the results are over-interpreted which will confuse readers.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Please see the attached pdf "Response to Reviewer" with all reviewer comments, our responses, and descriptions of the edits in the text supplementary information, and figures.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      This paper by Sharma et al describes ultrastructural changes in the polar tube (PT) of the microsporidian species Varimorpha necatrix upon PT firing. The relationship between cargo transport and the diameter of the PT, as well as the thickness of the PTP coat, are investigated. Moreover, low-resolution sub-tomogram averaging (STA) reveals that ribosome dimers occasionally arrange into spiral-like arrays on the inner surface of the bilayer lining the PTP coat. The data are well presented and, in most parts, appropriately interpreted. I have the following comments that I suggest should be addressed.

      Major:

      1. The authors suggest that the ribosomes in the arrays are dimers. Yet, figure 2c only shows a STA map of a 70S particle. A map of the dimer should be included to support this significant message of the paper.
      2. Do the authors see any 70S particles and if so, how common are they? 3D classification would clarify this.
      3. The authors put a lot of emphasis on the finding of array-like ribosomes within PTs. However, these appear to be present in only a minority of the cases. Moreover, similar ribosome arrays have previously not been seen in other microsporidian PTs. This raises the question of how significant these arrays are. Do they only occur in some microsporidia, or only at certain time points? This should be more clearly discussed, for example in lines 232 - 233. Also, do the authors suggest that this is a specific organisation or just a matter of close packing?
      4. As the arrays are only occasionally observed, the statement that ribosomes are transported through PTs in a spiral-like fashion should also be toned down in the abstract and throughout the manuscript. The fact that the arrays are only seen sometimes, makes the finding even more interesting, as it may infer a dynamic reorganisation process.
      5. The ribosome arrays appear to co-localise with the membrane. If this is the case, does the membrane show up in their STA? If so, it would be essential to show this.
      6. How do the ribosomes in the arrays differ from the free-floating ones? Are the latter not associated with the membrane, while the former are not? Can differences be visualised through 3D classification?
      7. The difference in the PTP coat in empty vs. filled PTs are very interesting. Can the authors clarify how this was measured and mention the number of measurements, mean, and standard deviation in the main text? Line plots would help substantiate the measurements.
      8. Do the authors observe any differences in the regularity of the array? This could be assessed by investigating power spectra of tomograms of STAs.
      9. How do the authors suggest such large changes in thickness come about? Is the PT coat "bunched up", as the PT compresses and stretched out, as the PT extends?
      10. How often are each of the described PT stages seen as a percentage of all data? Are some observed more often than others or is the distribution equal?
      11. Line 125. How do the authors know that they observe nuclei? Can they identify nuclear envelopes? Are nuclear pores evident?
      12. Line 168 - 169: How many measurements were taken from each state? What was the mean and SD for membranes and coats? This will be interesting, especially, as the thickness of the PT coat can vary along the length of one PT.

      Minor:

      1. Line 102 "optimal conditions" sounds obscure, please briefly mention what these are.
      2. Line 119. Are membrane-less PTs ever seen?
      3. Line 156, the word "remodelling" may be too specific, considering that only differences in thickness were measured.
      4. Line157: "Visualising PT sections ...." Sections sounds like physical cryosections were investigated. Perhaps better: "Inspecting tomograms of PT segments in different states..."
      5. Line 161: "subtomogram averaging particles picked on the tube wall from both states" better: "subtomogram averaging of the tube wall from both states"
      6. Line 162: delete "it be"
      7. Line 201: Is organ the right word here?
      8. Fig 2: Increase transparency to reveal the atomic model in C more clearly.
      9. Fig 2b. I suspect the beige ribosomes are ones that do not follow the array? If so, can you please clearly state it? Also, are these dimers too? And can you tell if they are different?
      10. Fig. 3e: The diagonal lines in the schematic infer that the data provide some level of insight into the PT lattice structure. As this is not the case, it would be better to remove these lines.
      11. A flow chart highlighting the sub-tomogram averaging workflows employed should be included.

      Significance

      This paper advances our knowledge of the microsporidian polar tube with regard to its structure, dynamics, and transported content. Ribosome arrays have not been described before in extended PTs, so this is an interesting discovery, which adds to the complexity of ribosome regulation in microsporidia.

      Strengths are the novelty of the findings, in particular the ribosome arrays, PT dynamics, and PT composition.

      As a weakness, I feel that the tomography data could have been analysed in more depth. For example, at least a low-resolution map of the ribosome dimer would be important to show that the ribosomes in the arrays are indeed dimers. In addition, 3D classification would be useful to understand, if all ribosomes occur as dimers or only a fraction.

      The paper is clearly written and well presented and thus suitable for a wider audience, including researchers studying microsporidia, infection biology, host-pathogen interactions, and ribosome biology.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      In this paper Sharma et al. use cryo-electron tomography to study structural properties of the polar tube invasion apparatus from the microsporidian parasite Vairimorpha necatrix. The main conclusions of the paper are related to the unique organization of ribosomes in the polar tube, and the organization of the surface layer of the tube. The cryo-ET data presented in this paper are of high quality, and add new insights into the structure of the polar tube, which have not been reported previously. The authors also purify an endogenous polar tube protein, PTP3, via a native cluster of histidines, and identify co-purifying proteins, which provides new insights into the proteins present in the polar tube that may interact directly or indirectly with PTP3. The endogenous purification was innovative and well carried out, a very nice result.

      Major comments:

      1. Our biggest comment on this manuscript is that we feel the cryo-ET data are often over-interpreted. We would like to request the authors to ensure that their conclusions are justified by the data. We realize that this is a general weakness of cryo-ET at the moment, and that often features that are observed may not be able to be unambiguously defined. The interpretation of the data does need to reflect this. Below are several of the main examples we found, but we urge the authors to keep this in mind as they revise the whole manuscript.
        • a) Assignment of densities: Ribosomes and lipid bilayer are reasonable to assign, because STA in Fig. S3 supports this. Fig. 1 and through the text, eg. lines 120, 126 - proteasomes, PTPs, assigning the outer layer to PTPs, is not justified based on the data. For these, it would be reasonable to speculate in the discussion, it is a reasonable hypothesis, but currently there are no data that directly support this assignment/interpretation. Statements such as in Line 184 "large-scale remodeling of the PTP layer" - are misleading, and do need to be worded with the appropriate level of certainty, currently it is only a hypothesis that this layer is, in fact, composed of PTPs.
        • b) Definition and classification of Cargo: The authors observe polar tubes with different cargos in them. From the cryo-ET data itself, it is not clear what the cargo is. Based on the timescale of the event, it is unlikely that one would catch a substantial number of tubes in the process of transporting cargo. The data are still valuable, but the authors should take care in how the cargo are interpreted, and what the relationship may be to transport of sporoplasm through the tube.
        • c) Time component in interpretation: The authors discuss data as a function of time, for example one section is entitled, "Remodeling of the polar tube protein layer during cargo transport". These data are simply 45 random snapshots of polar tubes, so currently there is no time component in these data. Such a section could be valuable to add to a discussion section, but since it is quite speculative, it would be misleading to a reader for these to be presented as results. Along these lines, Line 118 correlates a "germination phase" with tube thickness. As these experiments have no time component, there is no basis for this correlation. These data can of course be used to generate a hypothesis, which would be appropriate for the discussion section, or clearly indicated that it is speculative (not a direct conclusion from the data presented)
        • d) Line 156-158 - is an overinterpretation of the data, because in our understanding it is currently not known what is in the tubes, and what state they are in. Please re-word.
      2. One of the main conclusions of the paper is the arrangement of ribosomes in the PT. Yet, these are only observed in 5/45 tomograms. What is the authors' interpretation of this observation? Are they just stuck in the tube in some cases?
      3. We request the authors to please provide sufficient information in their methods for reproducibility of their experiments, specifically in these sections:
        • a) In the germination section please provide information on reproducibility of the spore preparation, and information on germination rates. Line 104: "with spores consistently displaying high germination efficiencies" - please clarify what "high" means.
        • b) Light microscopy: please specify rates of incomplete and complete germination, how this was evaluated, how many events were analyzed, and any differences between complete (sporoplasm visible) or incomplete (sporoplasm not visible) germination.
        • c) Line 325: please provide detailed information on CNN-based picking and segmentation, for example, parameters used for optimization
        • d) Line 330: please specify number of tomograms
        • e) Line 331: please specify how manual alignment and particle centering was achieved
        • f) Line 332: please provide information on template-matching options / thresholds used
      4. Supporting Fig 2c: we found it confusing to understand how Pempty is defined, it does not look empty in some cases, and the 3 shown look very different. On what basis is the tube labeled "empty"? The definition provided in line 131 does not seem to match the figures.

      Minor comments:

      Fig. 1: The lipid bi-layer in parts a to e seems different, and we found this confusing. Is the pink label in A not pointing to the correct layer? The corresponding segmentation is also confusing - does the lipid bilayer not go all the way around the tube? This would be important to clarify, since a lipid bilayer is one of the major components of the tube.

      The following publications have shown cryo-ET of the polar tube, and should be referenced appropriately in the introduction, as well as during interpretation: 1) BioRxiv, https://doi.org/10.1101/2023.05.01.538940 Figure 1 and 2) PMID: 31332877. The second is referenced but should be mentioned around line 70 in the introduction

      In the introduction, it would be helpful if the authors mention something about their microsporidia species of interest, and reason for choosing to study this species.

      Fig. S1C - please show individual data points

      Line 100 - the data presented do not show deformation of the cargo, so please reword to reflect the data being discussed

      Line 140: could the authors please outline how they confirmed that the handedness of the reconstructed tomogram is correct?

      Line 250: re-word to ensure that appropriate credit is given to previous work in the field; the large-scale rearrangement of the polar tube has been observed for many decades

      Line 352: out of curiosity, why could resolution not be determined for PTcargo?

      Fig S2a: diagram of the polar tube within the spore shows the polar tube with opposite handedness to what has been previously determined

      Supporting table 1 - is missing frames per movie and which mode data were collected in

      Fig 2b: We did not follow the rationale for the 3 colors of ribosomes

      Sup Fig 3a: please specify in legend and/or workflow software packages used in panel (a)

      Fig 2e: it is unclear whether averages presented are from 1 tomogram, or all tomograms where that pattern is visible - Is the measurement coming from all 5 tomograms?

      Fig 3 c-e: it is unclear how many tomograms were used for these averages. Was 1 STA per tomogram performed, or 1 STA per type of PT?

      Significance

      Overall, this paper provides interesting new insights into knowledge of the microsporidian polar tube. We thank the authors for making this paper available to the community on BioRixiv, and we summarize a few main comments below, which we hope will be helpful in preparing a revised version of the manuscript. There is a substantial advance in applying cryo-ET to studying the polar tube of microsporidian parasites. The audience this will be interesting to are those studying microsporidian parasites.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary: Sharma, et al. report the characterization of the polar tube (PT) from the microsporidian species, Vairimorpha necatrix, using a combination of optical microscopy, cryo-ET, and proteomics. The polar tube is a fascinating invasion apparatus which mediates the translocation of the parasite into the inside of a host cell to initiate infection. Similar to results obtained previously in other species, the authors show that PT firing in Vairimorpha necatrix is extremely fast, occurring on the order of 1 sec, and that the extruded PT is over 100 microns long in this species. Using cryo-ET to image the PT at a high resolution, they find that it exists in two major states: both an empty state and a state filled with cargo, and that the thickness of the tube wall changes when cargo is present. Strikingly, the authors observed that one of the cargo components, the ribosomes, are organized ordered array that may have helical symmetry. Finally, the authors took advantage of a naturally occurring "His tag" on PTP3 to affinity purify PTP3-containing protein complexes and analyze the composition using proteomics.

      Major comments

      ln 139-140: The absolute handedness of something can be very tricky to determine by cryo-ET (but certainly is possible). Variable hardware configurations between microscopes and differing conventions between software packages (e.g., for what direction is a positive tilt angle) can lead to inversion of the apparent handedness in the final tomogram. How certain are the authors that the absolute handedness is indeed right handed, as this seems to vary between the various display items in the manuscript? For example, in Fig 1c, my impression is that ribosome helices are left handed, as they are also in the supplemental movie. If this isn't known with certainty, perhaps it would be sufficient to describe the apparent helical symmetry but state that the handedness is ambiguous.

      Minor comments

      ln 39-40: Perhaps also cite the E. cuniculi genome paper?

      ln 97-98: It is interesting that the PT shortens in V. necatrix as well, and while I can pick this out in some of the individual traces in Sup Fig. 1b, it seems to get washed out in the trend line and isn't super obvious. If it isn't to laborious, it could be nice to add a panel showing the quantification of this (e.g., plotting the final length of each PT as a percentage of the maximum length achieved).

      ln 98-100: Strictly speaking, I don't think the referenced figure shows the sporoplasm being transformed into an extended conformation, only that it is spherical upon exit. Simply reword this to make clear that the deformations are inferred to occur but not directly observed.

      Because PT firing is so fast, the probability of trapping a PT in the process of transporting cargo would be pretty low. So then why does the PT still contain cellular cargo like ribosomes inside in the tomograms? Should these not have emerged in the sporoplasm which would enter the host cell? Are these "defective" spores that have failed to complete sporoplasm transport? Perhaps this is worth discussing.

      ln 118: The authors note an apparent correlation between the phase of germination and the thickness of the tube wall but don't specify what this correlation is. Is it thicker in the early phase and thinner in later phase, or vice versa? One could imagine "empty" tubes existing before or after sporoplasm transport, for example, so I'm not sure I follow how the phase is being inferred from the tomograms.

      ln 119-120: What is the evidence that the outer layer is made of PTPs, or that it is even protein (for example, as opposed to cell wall-like carbohydrate polymers)? I think this seems like a very reasonable hypothesis, but I would suggest explaining the logic and ensuring the degree of uncertainty is conveyed clearly. In light of this, I would also suggest changing figure labels, etc, that refer to the PTP layer (e.g., Fig. 3, PTPc and PTPe labels).

      ln 121, 123: "sheathed by a thin layer" and "enveloped by a thick outer layer": is this an additional layer being described? Or is this referring to the putative PTP layer, and that its thickness is variable?

      ln 125-126: While I understand how some features, like ribosomes, proteasomes, and generic membrane compartments could be identified, it is unclear to me how one would recognize the nucleus when inside the PT, nor are any examples shown. If the data is clear, perhaps the authors could show it in a figure? Otherwise, I suggest removing the claim regarding the nucleus.

      The arrangement of the ribosomes in a subset of tubes is really fascinating! While the number of observations is relatively small (n=5), it seems like it should be possible to comment preliminarily on whether there is much variability in their helical arrangement. Do the helical parameters vary much between observations? Does the til, pitch, etc vary much, are the 5 occurrences very similar? Is there any sign that they are associated with a membrane? Also, since the ribosomes form a lattice-like arrangement, it seems like it would be possible to trace ribosome helices in both the left and right handed directions. How did the authors decide between the two possibilities? This doesn't seem to be discussed.

      Fig. 2e: Are the two different colors/orientations meant to represent the two protamers of the ribosome dimer? When refined subvolumes are mapped back onto the original tomogram do the authors observe a similar crystalline arrangement of particles as in their segmentation? Are the orientations of the ribosomes correlated, and do the provide any evidence for the dimeric arrangement mentioned? The PlaceObjects plugin for Chimera can be very helpful for visualizing this: https://www.biochem.mpg.de/7939908/Place-Object

      Supp figure 4(b-d): Perhaps these models could be colored by pLDDT scores (with a key indicating the color scheme), so the reader can assess the quality of the predictions?

      How were the measurements of the membrane thickness and putative PTP layer carried out? On the tomogram projections? STAs? How were the boundaries of the layers established (e.g., map threshholding if STA?)? This information appears to be missing from the methods.

      Some tubes that are labeled as 'PTempty' actually contain cargo and look dense (example supp. Fig 2c, left and middle panels). Is it fair to classify these as empty tubes?

      Fig. 3d: I am not entirely clear on what is being shown here. Are independent reconstructions of PTcargo and PTempty superposed (aligned on membrane)? The description in the figure legend doesn't clearly say what is being displayed. I think it might be more clear to show these side-by-side instead of superposed (i.e., 4 panels instead of 2).

      Sup Fig 1: Define S and SP in legend or just spell out on figure? Missing x-axis label on panel b.

      Fig. 4b and Sup Fig 2a: The depictions of the PT in the spore here are left-handed. In a few species, the coil of the PT was found to form a right-handed helix (Jaroenlak, et al.), and it seems plausible that this may be a general feature that would be conserved across microsporidia. I appreciate that it might not be actually known to be right-handed in V. necatrix, but if there is no strong data either way, perhaps it would make sense for these depictions of the PT to be right-handed.

      I think all three of us are more or less in consensus about this manuscript, and I largely agree with the other reviewers comments. I think after addressing reviewer suggestions, this will be a pretty nice story.

      Significance

      Overall, this manuscript from Sharma, et al. presents interesting new findings about the structure and cargo transport function of the microsporidian PT. Microsporidia infect a wide range of hosts, including humans, and how the PT mediates parasite entry into cells is poorly understood. The approaches used in this study are appropriate for tackling the questions at hand, and appear to be generally well executed and interpreted. The observation that ribosomes assemble into an array within the PT is very unexpected and quite fascinating, and may be of broader interest to researchers working on ribosome structure and function, in addition to researchers studying microsporidia. The approach to investigating proteins interacting with PTP3 was quite elegant, and yielded a list of potential interactors that appears to be of very high quality and is highly plausible based on the literature field. We think this work is a substantial advance in the field and provides important new insights into the organization of the PT. - Please define your field of expertise with a few keywords to help the authors contextualize your point of view:

      Structural biology, microsporidia - Indicate if there are any parts of the paper that you do not have sufficient expertise to evaluate.

      We are not experts in proteomics/mass spectrometry

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      The authors describe a broad-scale phylogenetic survey of chemokine-related ligand and receptors from representative vertebrates, invertebrates, and viruses. They collect ligand and receptor sequences from available genome sequences, and use phylogenetic and CLANS analysis to group these into similar gene types. They then overlay these onto a validated species phylogeny in order to evaluate relationships of orthology and paralogy to pinpoint gene duplication and loss events. They carry out these analyses for canonical chemokine ligands receptors and for other closely related protein families. They conclude that the canonical chemokine system is restricted to vertebrates but that closely related ligands and receptors can be found in invertebrate chordates. More divergent but related gene systems are found in more distant invertebrates. They define more limited expansions of some ligand-receptor systems in certain jawed vertebrate groups and specifically in mammals.

      Overall, the paper addresses a complex and important system of signaling proteins with a rigorous and comprehensive set of analyses. The finding will be of interest to a diverse group of scientists. My comments listed below mainly consist of suggestions to help clarify the presentation.

      1. Pg 2, Lns 21-24: The canonical and non-canonical chemokine subclasses are introduced in the abstract without definition. A very brief explanation would be useful.

      We've included a brief description of "non-canonical" components in the abstract (lines 21-24). These non-canonical components fall into at least one of three categories: 1) molecules with sequence similarities to canonical components, 2) those that bind to a canonical component (either ligand or receptor), 3) those involved in chemokine-like functions, such as chemoattraction. More comprehensive explanations and examples of these non-canonical components are provided in the Introduction section.

      1. Some general contexts of chemokine functions are listed, including inflammation and homeostasis. A little more detail of how these signals are used and the molecular consequences of signaling may be useful in the introduction to set the biological context of the analysis (e.g., how do the signals regulate homeostasis?).

      We have added at the beginning of the introduction (lines 39 – 46) some details of how chemokine signalling typically occurs at a mechanistic level. We also provided few examples of homeostatic functions regulated by chemokine signalling and clarified different expression strategies for inflammatory versus homeostatic chemokines.

      It may help to summarize the known chemokine and chemokine-related gene systems in some type of table at the beginning of the results. This could serve as a convenient reference to guide the reader through the more detailed results. The manuscript addresses a complex set of ligands and receptors with names that may be confusing to the non-expert.

      We agree with the reviewer on this and moved Table S1 to the main text (now Table 1). This table contains all the information on ligands, receptors, and relative citations (lines 741-744).

      Pg 5, Ln 98: Fig 1C is introduced before Fig 1B. Can the panels be switched or the descriptions be rearranged?

      We have switched the panels in Figure 1. Now, Figure 1A and 1B refer to CLANS analyses and Figure 1C and 1D refer to phylogenetic trees of ligand groups. We have corrected all the references in the main text and in Figure 1 caption. Now the panels are mentioned in the correct alphabetical order within the text.

      Cytokine and chemokine ligands are small proteins that diverge quickly in different species and are difficult to identify in divergent genomes even within vertebrates. Conclusions about the absence of these types of factors are notorious for being disproven in subsequent analyses. Some discussion of what may have been missed in the survey for homologs (or reasons to think that ligands were not missed) would be useful in the Discussion.

      We concur with the reviewer's observation, and we used three distinct strategies to address the issue:

      1. E-value Threshold Adjustment: Initially, we utilized a relatively low e-value threshold of These three strategies collectively contribute to a more robust and comprehensive approach to address the challenges associated with the bioinformatic identification of canonical and non-canonical chemokines. We briefly mentioned the technical difficulty of working with short sequences in our Introduction (lines 75-76).

      Reviewer #1 (Significance (Required)):

      This paper presents a thorough analysis of chemokines and related gene systems across a wide phylogenetic landscape. The authors have expertise in these gene families and in the techniques that they use to identify and relate family members. The chemokines are an important set of signals that are used across several biological systems. These findings will be of wide interest to immunologists, neurobiologists, developmental and evolutionary biologists.

      We thank reviewer 1 for their comments – they have been very valuable to improve our manuscript.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      This paper applies phylogenetic clustering methods to a large taxonomical sampling to interrogate the relationship between canonical and non-canonical chemokine ligands and receptors. The results suggest that 1) unrelated proteins evolved "chemokine-like" ligand function multiple times independently; and 2) all the canonical and non-canonical chemokine receptors (except ACKR1) originated from a single duplication in the vertebrate stem group, which also gave rise to many GPCRs. In addition, the authors characterized the complement of canonical and non-canonical components in the common ancestor of vertebrates and identified several other ligands and receptors with potential chemokine related properties.

      Comments: 1. There are many places in the paper, too many to list, where the authors refer to chemokine receptors but call them 'chemokines'.

      We have corrected this oversight throughout the manuscript.

      In Figure 1, CX3CL is referred to as 'X3CL'

      We have corrected this. Now CX3CL is referred to correctly in Figure 1. We also found that it was incorrectly spelt in Figure 2 as well and corrected it there too.

      1. CXCL17 was originally reported to be chemokine-like based on sequence threading methods. The authors refer to a 2015 paper indicating that it has chemokine-like activity at GPR35, which had been renamed provisionally CXCR8. To my knowledge that result was not based on direct binding data but inferred from a functional response. Moreover, to my knowledge it has not been independently confirmed. Instead there is a recent paper in JI from the Pease lab showing extensive experimental results that fail to demonstrate CXCL17 activity at GPR35. This uncertainty regarding a potential mistake in the literature should be addressed and integrated in the points made about CXCL17 being an outlier.

      We thank the reviewer for pointing this out. To account for this suggestion, we have modified the text as follows:

      Lines 105-108: “The distinction between CXCL17 and all other canonical chemokines is consistent with our receptor results showing that the potential receptor for CXCL17, GPR35 (41), is also not within the canonical chemokine receptor group (see below). Although it is important to note that recent studies fail to demonstrate CXCL17 activity at GPR35 (42, 43).”

      Lines 240-241: “Another orphan GPCR, GPR35, had been proposed as a potential chemokine receptor (41); however, this was later questioned (42, 43) and GPR35 is still generally considered orphan (55–57).”

      Lines 312-315: “CXCL17 is mammal-specific and likely unrelated to canonical chemokines (similar to its controversial putative receptor, GPR35 (41-43), that is not a canonical chemokine receptor).”

      References: [41] J. L. Maravillas-Montero, et al., Cutting Edge: GPR35/CXCR8 Is the Receptor of the Mucosal Chemokine CXCL17. The Journal of Immunology 194, 29–33 (2015).

      [42] S.-J. Park, S.-J. Lee, S.-Y. Nam, D.-S. Im, GPR35 mediates lodoxamide-induced migration inhibitory response but not CXCL17-induced migration stimulatory response in THP-1 cells; is GPR35 a receptor for CXCL17? British Journal of Pharmacology 175, 154–161 (2018).

      [43] N. A. S. B. M. Amir, et al., Evidence for the Existence of a CXCL17 Receptor Distinct from GPR35. The Journal of Immunology 201, 714–724 (2018).

      [55] S. Xiao, W. Xie, L. Zhou, Mucosal chemokine CXCL17: What is known and not known. Scandinavian Journal of Immunology 93, e12965 (2021).

      [56] S. P. Giblin, J. E. Pease, What defines a chemokine? – The curious case of CXCL17. Cytokine 168, 156224 (2023).

      [57] J. Duan, et al., Insights into divalent cation regulation and G13-coupling of orphan receptor GPR35. Cell Discov 8, 1–12 (2022).

      Can the authors use alpha fold to address whether any of these non-canonical molecules actually is predicted to fold like a chemokine? More generally, based on the paper's analysis, how do the authors propose to define a chemokine? It is well-accepted that chemokines are defined by structure, not function (e.g. limited truncation of any chemokine abrogates activity, but it is still a chemokine structurally, not semantically, folds like a chemokine, aligns with other chemokines).

      In response to the recommendation from reviewer 2 to incorporate AlphaFold data, we leveraged AFDB Clusters (foldseek.com), a recently developed tool that clustered over 200 million Uniprot proteins based on their predicted AlphaFold structures (as described in this Nature paper: https://www.nature.com/articles/s41586-023-06510-w). We utilised this pre-computed dataset of clustered proteins to query with representative human proteins, both canonical and non-canonical chemokine ligands, and the results are summarised in the table below. Notably, we observed that canonical chemokines were distributed across different AlphaFold clusters, each corresponding to different ligand types (e.g., CC and CXC). Interestingly, despite this, all these clusters exhibited similar descriptions (e.g. CC or CXC), indicating that the method effectively recovers well-characterized chemokines. Conversely, when analysing non-canonical chemokine ligands, none of them were classified within the canonical chemokine clusters. This observation strongly suggests that canonical and non-canonical ligands do not share the same protein fold. Additionally, we identified intriguing correlations between these structure-based clusters and the results from our phylogenetic analyses. For instance, CXCL14 was clustered within a CC-type group, consistent with our reconciled tree positioning it within the broader CC-type clade (as shown in Figure 2A). Similarly, CXCL16 formed its own unique cluster, which aligns with our CLANS analysis, where it is the last group to connect with canonical chemokines (illustrated in Figure 1A and Figure S1). Furthermore, TAFA5 was found in a distinct cluster, mirroring our phylogenetic analyses that place it as the most basal TAFA clade (as depicted in Figure 2A and Figure S19). While these findings are intriguing, we acknowledge that additional in-depth analyses, beyond the scope of this paper, will be necessary to confirm these results.

      In response to the reviewer's inquiry regarding how to define a chemokine, it is essential to recognise that many proteins can exhibit similar 3D structures without being considered homologous. A notable example is the opsins, which are present in both bacteria and animals. Despite sharing a common 3D structure that is characterised by seven transmembrane domains (TMDs) and serves similar functions, they are not regarded as homologous, as highlighted in this study (https://doi.org/10.1186/gb-2005-6-3-213). Considering these findings, we propose that, like various other gene families, the primary criterion for assessing protein homology should be rooted in shared evolutionary ancestry and common origin, and this should take precedence over structural similarities.

      Human gene

      Uniprot Accession

      AFDB Cluster

      Accession

      Description

      Canonical CKs

      CXCL14

      O95715

      A0A3Q3M453

      C-C motif chemokine

      CCL24

      O00175

      A0A4X1T574

      C-C motif chemokine

      CX3CL1

      P78423

      A0A7J8CF84

      C-X3-C motif chemokine ligand 1

      CXCL1

      P09341

      A0A1S2ZIJ4

      C-X-C motif chemokine

      CXCL13

      O43927

      A0A1S2ZIJ4

      C-X-C motif chemokine

      CXCL8

      P10145

      A0A1S2ZIJ4

      C-X-C motif chemokine

      CCL20

      P78556

      A0A6P7X7F3

      C-X-C motif chemokine

      XCL1

      P47992

      A0A6P7X7F3

      C-X-C motif chemokine

      CXCL16

      Q9H2A7

      A0A6P8SIS6

      C-X-C motif chemokine 16

      CCL27

      Q9Y4X3

      A0A1L8GBB9

      SCY domain-containing protein

      CCL1

      P22362

      A0A3B4A358

      SCY domain-containing protein

      CCL5

      P13501

      A0A3B4A358

      SCY domain-containing protein

      CCL28

      Q9NRJ3

      A0A3Q0SB19

      SCY domain-containing protein

      CXCL12

      P48061

      A0A401SMI2

      SCY domain-containing protein

      CXCL17

      CXCL17

      Q6UXB2

      No cluster found

      No cluster found

      TAFA

      TAFA1

      Q7Z5A9

      Q96LR4

      Chemokine-like protein TAFA-4

      TAFA2

      Q8N3H0

      Q96LR4

      Chemokine-like protein TAFA-4

      TAFA3

      Q7Z5A8

      Q96LR4

      Chemokine-like protein TAFA-4

      TAFA4

      Q96LR4

      Q96LR4

      Chemokine-like protein TAFA-4

      TAFA5

      Q7Z5A7

      A0A7M4EYY1

      TAFA chemokine like family member 5

      CYTL

      CYTL1

      Q9NRR1

      A0A673GVE4

      Cytokine-like protein 1

      CKLFSF

      CMTM5

      Q96DZ9

      A0A4W2H069

      CKLF like MARVEL transmembrane domain containing 5

      CMTM8

      Q8IZV2

      U3IR50

      CKLF like MARVEL transmembrane domain containing 7

      CMTM7

      Q96FZ5

      A0A6G1PQK5

      CKLF-like MARVEL transmembrane domain-containing protein 7

      CMTM6

      Q9NX76

      A0A814ULI9

      Hypothetical protein

      CKLF

      Q9UBR5

      A0A3M0K8M7

      MARVEL domain-containing protein

      CMTM1

      Q8IZ96

      A0A3M0K8M7

      MARVEL domain-containing protein

      MAL

      P21145

      A0A402F5Z5

      MARVEL domain-containing protein

      CMTM2

      Q8TAZ6

      A0A6G1S7Y0

      MARVEL domain-containing protein

      PLP2

      Q04941

      A0A667IJ27

      Proteolipid protein 2

      CMTM3

      Q96MX0

      A0A3B1ILJ1

      Zgc:136605

      CMTM4

      Q8IZR5

      A0A3B1ILJ1

      Zgc:136605

      PLLP

      Q9Y342

      A0A3B1ILJ1

      Zgc:136605

      Chemokine genes are found on many human chromosomes with large clusters on chromosome 2 and 17. Can the authors address the syntenic relationships phylogenetically?

      There are cases where synteny data have been used to infer the relationship between species (e.g. https://doi.org/10.1038/s41586-023-05936-6); however, to our knowledge, they cannot be used to infer the pattern of gene duplications and losses, as we have done here with gene tree to species tree reconciliations. However, the two approaches are extremely powerful combined and compared as they provide independent evidence. For example, with our phylogenetic analysis of chemokine ligands, we found that CXCL1-10 plus CXCL13 form a monophyletic clade (Figure 2A); this is consistent with their location on the human chromosome 4 (Zlotnik and Yoshie 2012). Similarly, most of the CC-type chemokines, that we find monophyletic in our trees, are located in a locus in human chromosome 17. Likewise, chemokine receptor phylogenetic relationships are largely consistent with macro and micro syntenic patterns. Most of the chemokine receptors are on human chromosome 3 (Zlotnik and Yoshie 2012) and they all belong to a large monophyletic clade in our tree (Figure 4A). Smaller clusters also maintain correspondence, such as the mini cluster of CXCR1 and CXCR2 on human chromosome 2 corresponding to a monophyletic clade in our phylogenetic analysis (Figure 4A).

      We have incorporated the above considerations in our manuscript at the lines:

      • Lines 140-148 (ligands)

      • Lines 256-272 (receptors)

      • Lines 375 – 483 (discussion)

      The authors indicate that 'CXCL8 is present in all jawed vertebrates except in the cartilaginous fishes lineage'. However, they should point out that CXCL8 is not represented in mice. The notion that the repertoire of chemokine and chemokine receptor genes can be different in even closely related species as well as in individuals of the same species is well-documented but not mentioned here.


      We thank the reviewer for these suggestions, and we have modified the text in lines 137-138.

      The analysis suggests that chemokine gene repertoires start small and grow non-linearly to 45 in mammals. However DeVries et al (JI 2005) published that zebrafish have the most chemokines, 63, and chemokine receptors, 24. Do the authors disagree? This should be addressed.

      The significant increase in the number of ligands and receptors in zebrafish, compared to their last common mammalian ancestor, can be attributed to an additional round of whole-genome duplication (WGD) (https://doi.org/10.1016/S0955-0674(99)00039-3).

      Concerning ligands, the count in zebrafish varies from 63 in DeVries et al. 2005 to 111 in Nomiyama et al. 2008, and to 35 in our study. This variation can be attributed to several factors:

      1. Genome Versions: The disparities may arise from the use of different versions of the zebrafish genome. We utilised an improved version known for its higher contiguity and reduced fragmentation (https://www.nature.com/articles/nature12111). It is possible that the additional ligands identified by DeVries, Nomiyama, and others were partial sequences.
      2. Methodology: Methodological differences are at play. DeVries et al. employed tblastN, while we opted for BLASTP. Nomiyama et al. do not specify the type of BLAST performed.
      3. Stringency: We collected our sequences based on a BLASTP search using as query sequences only manually curated sequences from UniProt. This additional precaution allowed us to identify sequences with high-confidence chemokine ligand characteristics.
      4. Sequence Characteristics: Ligands typically have shorter sequences and exhibit less sequence conservation compared to receptors. Zebrafish represents a case in which working with short sequences may lead to missed homologs.
      5. Species-Specific Nature: Our approach successfully recovered the complete set of ligands in other species, such as humans and mice. Zebrafish appears to be an exception rather than the norm. When it comes to receptors, which typically have longer sequences, making it easy to identify distant homologs, our results closely mirror those of DeVries in 2005. In our study, we identified 28 canonical receptors, compared to their count of 24. However, it is worth highlighting that within our dataset, four of these receptors appear as species-specific duplications, potentially indicating that they are actually isoforms or related variants.

      Nonetheless, it is essential to emphasise that our work does not aim to precisely reconstruct the entire complement of ligands and receptors in zebrafish or other species. Achieving this would require further validation, including the expression analysis of potential transcripts.

      Did the authors find any species in which a chemokine/chemokine receptor pair are not found together? That is, if the system is irreducibly complex, requiring both a ligand and receptor, the probability of both genes arising simultaneously is essentially zero. So how do the authors theorize that such a system actually arose, and is there any evidence in their data set for convergence of separately evolved ligand and receptor?

      Our data strongly support the hypothesis that the canonical chemokine system originated within the stem group of vertebrates, likely as a consequence of two rounds of genome duplication. This likely accounts for the simultaneous emergence of both ligands and receptors. While the receptors (both canonical and non) can be traced back to a single-gene duplication event (with the exception of ACKR1), the evolution of ligand families capable of interacting with chemokine receptors occurred independently, although further experiments are required to validate this in vivo in a broader set of organisms. In our study, we successfully identified the complete set of receptors and ligands in well-established model systems like humans and mice. However, when it comes to interactions between ligands and receptors outside these model organisms, the picture becomes less clear. Similarly, the exact pairings of non-canonical components are also not fully clarified (see lines 404-406). As a result, speculating about evolutionary conservation in these contexts requires caution and further investigation. It's worth noting that chemokines and their corresponding chemokine receptors do not necessarily evolve in tandem. Since they are encoded by different genes, they evolved from separate duplication events occurring at different points in evolutionary history. In certain instances, due to the system's flexibility, chemokines binding orthologous receptors may not be orthologous themselves but may have independently acquired the ability to activate the same receptor in various species.

      Line 180, 181 and elsewhere: GPCR1 and GPCR33 should be GPR1 and GPR33

      We have corrected this throughout the manuscript.

      Line 185: ACKR1 exceptionalism is noted, but there is no discussion of the remarkable structure-function paradox that the most distantly related chemokine receptor is also the most highly promiscuous receptor, binding many but not all CC and CXC chemokines with high affinity.

      We added in the discussion section this consideration regarding the wide binding of ACKR1 (Lines 341-343) and its ability to bind both CC and CXC chemokines (DOI: 10.1126/science.7689250 and 10.3389/fimmu.2015.00279), highlighting the intriguing contrast with the fact that it is the most distantly related receptor.

      Line 196: the viral receptors cluster with the vertebrate receptors, suggesting that the viruses captured the receptor gene from the host. Authors might mention this obvious point regarding origins, and discuss how it relates to the monophyly and paraphyly that emerges from the phylogenetic analysis.

      We added a comment to the discussion section (Lines 348-352) regarding the potential origins of the viral chemokine receptors.

      Any discussion of chemokine-like convergent evolution presupposes that the activity is real and actually occurs in vivo. The authors should make clear to what extent the existing literature supports this. As mentioned above, CXCL17 interaction with GPR35 has been challenged in vitro and has never been demonstrated to occur in vivo. To what extent is the same limitation a problem in considering co-evolution of the other non-canonical chemokines? I agree that classification based solely on function is inappropriate, but so is phylogenetic analysis without direct knowledge of in vivo function. It is no feasible to address this in a phylogenetic analysis, but there ought to be at least one species in which the non-canonicals have been rigorously shown to act at specific receptors in vivo before grouping them with the canonicals in a co-evolutionary sense.


      We agree with the referee that evidence of real chemokine-like activity is important to consider the activity in vivo.

      In our work, the molecules examined were chosen based on previous evidence of chemokine-like sequence similarity, ability to bind canonical components and/or chemokine-like function. For example, CKLF (also called CKLF1) has been shown, through calcium mobilisation and chemotaxis assays using the human cell line HEK293, to bind CCR4 and to induce cell migration via CCR4 respectively (https://doi.org/10.1016/j.lfs.2005.05.070). Numerous papers are studying the in vitro and in vivo effects of CKLF in murein and human models (https://doi.org/10.1016/j.cyto.2017.12.002), therefore, we found it compelling to investigate its evolutionary relationship with canonical chemokines. Similarly, CYTL1, that had been predicted to possess an IL8-like fold (https://doi.org/10.1002/prot.22963), has been found to bind CCR2 (https://doi.org/10.4049/jimmunol.1501908) and in vitro and in vivo studies showed chemotactic activity for neutrophils (https://doi.org/10.1007/s10753-019-01116-9). Ongoing research into this molecule are focusing on a wide array of immune functions (https://doi.org/10.1007/s00018-019-03137-x).

      We mentioned these considerations in our introduction to explain why we were interested in investigating these molecules (lines 50-57). We have also added a line in the Discussion (lines 323-324) where we reinforce the idea that in vitro and in vivo experiments for all chemokine-like molecules are required to validate computation predictions.

      The discussion of homeostatic vs inflammatory chemokine/receptors in the last section of the Discussion would be enhanced by pointing out that the chemokine specificities are numerically totally different for these two groupings, homeostatics tending to have monogamous ligand-receptor relationships and inflammatories being highly promiscuous.

      To account for the reviewer’s comment, we have added this consideration in a paragraph of the discussion (see Line 389-394).

      Reviewer #2 (Significance (Required)):



      Much of the paper's results are confirmatory of previous work based on less extensive sequence analysis. One could say more generally that unrelated chemical forms, not just unrelated proteins, have chemokine-like ligand function. For example leukotriene B4 is a powerful leukocyte chemoattractant for neutrophils working through a GPCR. That proteins might also independently evolve common functions does not add insight beyond what is already appreciated. The notion that chemokine receptors have a common ancestor is also generally accepted and that ACKR1 is an outlier is already appreciated. The present work adds phylogenetic and statistical precision to these points.

      Our discoveries clarify various aspects of the chemokine system's evolution, and we are confident that the "phylogenetic and statistical precision" of our findings will provide a solid cornerstone for future research aimed at unravelling the function and evolution of the system. Specifically, our work clarified:

      1. The presence only in Vertebrates: We have confirmed, through a comprehensive taxonomic sampling (we use many more species than previous works), that the chemokine system is exclusive to vertebrates. However, intriguingly, we identified a TAFA chemokine-like family in urochordates.
      2. Relationships between Ligands: We conducted a thorough examination of the relationships between canonical and non-canonical ligands and suggested that several unrelated molecules might have evolved independently their ability to interact with the chemokine receptors. We appreciate the comment of the reviewer regarding the fact that unrelated chemical forms such as leukotriene B4 may have chemokine-like functions. However, in our work all the non-canonical components examined are proteins and as such could have an evolutionary relationship with chemokines. Furthermore, we chose to consider only proteins that showed multiple lines of evidence implicating them in the chemokine system and that are currently the topic of interest in the field (see replies to reviewer 1’s comment #5 and to reviewer 2’s comment #12). Seeing the general interest in the topic, and especially seeing as this had never been clarified before, in this work, we set ourselves the goal to investigate the evolutionary relationship amongst these non-canonical ligands and canonical chemokines.
      3. Duplication Events: We pinpoint the specific gene duplication events responsible for the emergence of chemokine receptors.
      4. Atypical Receptor Paraphyly: Our work highlights the paraphyletic nature of atypical receptors, in contrast to previous research (see https://doi.org/10.1155/2018/9065181).
      5. Viral Receptor Phylogenetics: To our knowledge, this is the first work to investigate the phylogenetic affinities of viral receptors.
      6. GPCR182 and Atypical Receptor Affinities: We clarify the affinity of GPCR182 with atypical receptor 3, offering different insights compared to prior studies (see figure S3C in https://doi.org/10.1038/s41467-020-16664-0).
      7. Additionally, our study represents the first analysis of the chemokine system in the basal vertebrate hagfish and provides insights into the ancestral form of the chemokine system.
      8. Ultimately, our research identifies numerous molecules and receptors with potential chemokine functions. In conclusion, we contribute to resolving uncertainties surrounding the system's origin, including the complex duplication events that have shaped receptor evolution. As evident from the extensive comments provided by the reviewer, our work addresses various controversies in the field (e.g. the inclusion of CXCL17 as a chemokine). Nonetheless, like any new set of findings, our work amalgamates confirmatory results (as highlighted in point 1) with innovative discoveries (as outlined in points 2-8). However, the latter category significantly outweighs the former, underscoring the richness of novel insights.

      Finally, we would like to thank reviewer 2 for their comments, as these have contributed to greatly improve our manuscript.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      This paper applies phylogenetic clustering methods to a large taxonomical sampling to interrogate the relationship between canonical and non-canonical chemokine ligands and receptors. The results suggest that 1) unrelated proteins evolved "chemokine-like" ligand function multiple times independently; and 2) all the canonical and non-canonical chemokine receptors (except ACKR1) originated from a single duplication in the vertebrate stem group, which also gave rise to many GPCRs. In addition, the authors characterized the complement of canonical and non-canonical components in the common ancestor of vertebrates and identified several other ligands and receptors with potential chemokine related properties.

      Comments:

      1. There are many places in the paper, too many to list, where the authors refer to chemokine receptors but call them 'chemokines'.
      2. In Figure 1, CX3CL is referred to as 'X3CL'
      3. CXCL17 was originally reported to be chemokine-like based on sequence threading methods. The authors refer to a 2015 paper indicating that it has chemokine-like activity at GPR35, which had been renamed provisionally CXCR8. To my knowledge that result was not based on direct binding data but inferred from a functional response. Moreover, to my knowledge it has not been independently confirmed. Instead there is a recent paper in JI from the Pease lab showing extensive experimental results that fail to demonstrate CXCL17 activity at GPR35. This uncertainty regarding a potential mistake in the literature should be addressed and integrated in the points made about CXCL17 being an outlier.
      4. Can the authors use alpha fold to address whether any of these non-canonical molecules actually is predicted to fold like a chemokine? More generally, based on the paper's analysis, how do the authors propose to define a chemokine? It is well-accepted that chemokines are defined by structure, not function (e.g. limited truncation of any chemokine abrogates activity, but it is still a chemokine structurally, not semantically, folds like a chemokine, aligns with other chemokines).
      5. Chemokine genes are found on many human chromosomes with large clusters on chromosome 2 and 17. Can the authors address the syntenic relationships phylogenetically?
      6. The authors indicate that 'CXCL8 is present in all jawed vertebrates except in the cartilaginous fishes lineage'. However, they should point out that CXCL8 is not represented in mice. The notion that the repertoire of chemokine and chemokine receptor genes can be different in even closely related species as well as in individuals of the same species is well-documented but not mentioned here.
      7. The analysis suggests that chemokine gene repertoires start small and grow non-linearly to 45 in mammals. However DeVries et al (JI 2005) published that zebrafish have the most chemokines, 63, and chemokine receptors, 24. Do the authors disagree? This should be addressed.
      8. Did the authors find any species in which a chemokine/chemokine receptor pair are not found together? That is, if the system is irreducibly complex, requiring both a ligand and receptor, the probability of both genes arising simultaneously is essentially zero. So how do the authors theorize that such a system actually arose, and is there any evidence in their data set for convergence of separately evolved ligand and receptor?
      9. Line 180, 181 and elsewhere: GPCR1 and GPCR33 should be GPR1 and GPR33
      10. Line 185: ACKR1 exceptionalism is noted, but there is no discussion of the remarkable structure-function paradox that the most distantly related chemokine receptor is also the most highly promiscuous receptor, binding many but not all CC and CXC chemokines with high affinity.
      11. Line 196: the viral receptors cluster with the vertebrate receptors, suggesting that the viruses captured the receptor gene from the host. Authors might mention this obvious point regarding origins, and discuss how it relates to the monophyly and paraphyly that emerges from the phylogenetic analysis.
      12. Any discussion of chemokine-like convergent evolution presupposes that the activity is real and actually occurs in vivo. The authors should make clear to what extent the existing literature supports this. As mentioned above, CXCL17 interaction with GPR35 has been challenged in vitro and has never been demonstrated to occur in vivo. To what extent is the same limitation a problem in considering co-evolution of the other non-canonical chemokines? I agree that classification based solely on function is inappropriate, but so is phylogenetic analysis without direct knowledge of in vivo function. It is no feasible to address this in a phylogenetic analysis, but there ought to be at least one species in which the non-canonicals have been rigorously shown to act at specific receptors in vivo before grouping them with the canonicals in a co-evolutionary sense.
      13. The discussion of homeostatic vs inflammatory chemokine/receptors in the last section of the Discussion would be enhanced by pointing out that the chemokine specificities are numerically totally different for these two groupings, homeostatics tending to have monogamous ligand-receptor relationships and inflammatories being highly promiscuous.

      Significance

      Much of the paper's results are confirmatory of previous work based on less extensive sequence analysis. One could say more generally that unrelated chemical forms, not just unrelated proteins, have chemokine-like ligand function. For example leukotriene B4 is a powerful leukocyte chemoattractant for neutrophils working through a GPCR. That proteins might also independently evolve common functions does not add insight beyond what is already appreciated. The notion that chemokine receptors have a common ancestor is also generally accepted and that ACKR1 is an outlier is already appreciated. The present work adds phylogenetic and statistical precision to these points.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      The authors describe a broad-scale phylogenetic survey of chemokine-related ligand and receptors from representative vertebrates, invertebrates, and viruses. They collect ligand and receptor sequences from available genome sequences, and use phylogenetic and CLANS analysis to group these into similar gene types. They then overlay these onto a validated species phylogeny in order to evaluate relationships of orthology and paralogy to pinpoint gene duplication and loss events. They carry out these analyses for canonical chemokine ligands receptors and for other closely related protein families. They conclude that the canonical chemokine system is restricted to vertebrates but that closely related ligands and receptors can be found in invertebrate chordates. More divergent but related gene systems are found in more distant invertebrates. They define more limited expansions of some ligand-receptor systems in certain jawed vertebrate groups and specifically in mammals.

      Overall, the paper addresses a complex and important system of signaling proteins with a rigorous and comprehensive set of analyses. The finding will be of interest to a diverse group of scientists. My comments listed below mainly consist of suggestions to help clarify the presentation.

      1. Pg 2, Lns 21-24: The canonical and non-canonical chemokine subclasses are introduced in the abstract without definition. A very brief explanation would be useful.
      2. Some general contexts of chemokine functions are listed, including inflammation and homeostasis. A little more detail of how these signals are used and the molecular consequences of signaling may be useful in the introduction to set the biological context of the analysis (e.g., how do the signals regulate homeostasis?).
      3. It may help to summarize the known chemokine and chemokine-related gene systems in some type of table at the beginning of the results. This could serve as a convenient reference to guide the reader through the more detailed results. The manuscript addresses a complex set of ligands and receptors with names that may be confusing to the non-expert.
      4. Pg 5, Ln 98: Fig 1C is introduced before Fig 1B. Can the panels be switched or the descriptions be rearranged?
      5. Cytokine and chemokine ligands are small proteins that diverge quickly in different species and are difficult to identify in divergent genomes even within vertebrates. Conclusions about the absence of these types of factors are notorious for being disproven in subsequent analyses. Some discussion of what may have been missed in the survey for homologs (or reasons to think that ligands were not missed) would be useful in the Discussion.

      Significance

      This paper presents a thorough analysis of chemokines and related gene systems across a wide phylogenetic landscape. The authors have expertise in these gene families and in the techniques that they use to identify and relate family members. The chemokines are an important set of signals that are used across several biological systems. These findings will be of wide interest to immunologists, neurobiologists, developmental and evolutionary biologists.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      There is mounting evidence pointing towards an association of HSV with ApoE and Alzheimer's disease. Although it has been shown that ApoE impacts HSV-1 spread in animal models in an isoform specific fashion, the molecular relationship between the virus and ApoE is unclear. The present study probes the role of ApoE on the viral life cycle, clearly an important aspect if one is to better understand how the virus may influence the disease. Using assays monitoring various steps of viral replication, the authors report that ApoE perturbs the interaction of the virus with the cell surface, both during the initial binding and following viral release. Furthermore, they show that ApoE 3 and 4 exert a proviral effect, with a smaller impact with ApoE 2.

      General Comments

      The comprehensive study addresses an important point that may help clarify the interaction between HSV-1 and Alzheimer's disease. It major strength is that it is systematic and elegantly performed. The paper convincingly shows that ApoE impact cell adhesion at the cell surface. In general, the data have properly been analyzed statistically. Some aspects are however enigmatic. First of all, how can ApoE be proviral if it prevents the initial binding of the virus to the cells? Second, less viral binding should mean less entry (as shown in figure 2) and subsequently fewer genome copies, but that is not what is reported in figure 3. This is not clearly stated in the discussion (lines 457-459 and again in lines 490-491). Finally, if ApoE is unstable as indicated on lines 495-497, how can it be active later on at 24 hpi and prevent viral release? How do the authors reconcile these observations? Of interest, ApoE 3 has a slightly greater impact on viral growth than other isoforms (fig 1), which is not quite fitting the model that ApoE4 is the main culprit for Alzheimer's disease. Could the authors comment? Where are the ApoE proteins normally expressed in cells? At the cell surface or intracellularly? This may provide a hint as to where the virus picks it up when incorporating it. Immunofluorescence would be a great addition (e.g., Huh-7 cell line). Similarly, does the virus impact the expression level of ApoE? One could resolve the dilemma that ApoE blocks the initial binding of the virus but stimulates viral release at later time points if the virus induces ApoE at those late times. Furthermore, if the Vero or SH-SY5Y cells don't normally express ApoE, then it should not be important for the virus in that context. How about keratinocytes, the normal host of the virus? These considerations should be addressed in the manuscript by Western blotting at different time points.

      Significance

      This study adds an interesting twist and advances the infectious etiology model of Alzheimer's disease and should appeal to a broad authorship ranging from the neurobiology to virology.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      In the manuscript "Recruitment of apolipoprotein E facilitates Herpes simplex virus 1 release", by Liu et al, the authors investigate the effect of ApoE protein on HSV-1 replication. Treatment of infected cultures with ApoE proteins appeared to increase the production of infectious titer. The authors perform several experiments to determine which steps of the virus replication cycle are affected. ApoE proteins reduce virus attachment, but subsequent reductions in entry are explained by the reduction in attachment, suggesting that the efficiency of entry is not affected. Viral DNA replication and cell-surface virus amounts appear to be unaffected, but the release of virus titer to the supernatant is increased. These results suggest that ApoE effects virus replication in two ways: reduces attachment if inoculum, but subsequently increases release of progeny. To determine whether this is the case, the authors then measure the release of attached virus particles from native membranes in the presence or absence of ApoE4, and derived from cells inducibly expressing ApoE4.

      The manuscript is generally well written and the experiments generally appear to be performed well. However, the importance and impact of this manuscript are limited by two major weaknesses:

      1. It seems that effects are only seen with high concentrations of ApoE. How does this concentration compare to what would be found in blood plasma/tissues/secreted by Huh-7 cells? Thus, these results may not be biologically relevant. It is difficult to determine what concentrations of ApoE are used in some cases, e.g. Fig 6. Please provide this information in the figure or figure caption.
      2. While there are some interesting results here, this manuscript does not get to the point of establishing mechanism. In the discussion, it is speculated that ApoE functions via GAGs/HSPGs, which are known to affect HSV-1 attachment/release. It would make the manuscript much stronger to include experiments adding soluble heparin or treating cells with heparinase, or producing gC-null virus particles, to see if this abolishes the attachment/release effects of ApoE.

      Minor points:

      Fig. 3B: It is difficult to compare virus genomes by qPCR to virus titer of supernatants. If ApoE is promoting release of cell surface virus, why does an increase in titer in the supernatants not show a corresponding decrease in cell surface virus?

      Fig. 6B: "Spdi I" term is not used in the results section or figure legend. I do not know what "Spdi I" means.

      Fig. 6E, Fig 7: Normalized values can be misleading. Please provide raw values. Please show dissociation curves, as in Fig. 6D, for Fig.7.

      It would be nice to perform the same analysis of supernatant vs. cell surface vs. intracellular virus as in Fig. 3B, and the release on ice measures as in Fig 4, using the inducible expression HEK cell line.

      Discussion: Degradation of ApoE (line 495-500). The degradation of ApoE in these infection experiments could be measured by e.g. western blot of cell supernatants. This suggestion is a bit troubling: If the ApoE is degraded during the first replication cycle, how is it able to have an ongoing effect? How can ApoE simultaneously be present to promote release of progeny, while being degraded so as not to prevent attachment to subsequent cells.

      I do not see that "GMK AH-1" cells are available from ATCC, as stated in the methods. Is this a synonym for Vero cells?

      Although I understand what is meant, "dissolvent" is not a common term. "diluent" or "vehicle" is more common.

      Significance

      General assessment: The manuscript is generally well written and the experiments generally appear to be performed well. However, the significance of this manuscript are limited by two major weaknesses:

      1. It seems that effects are only seen with high concentrations of ApoE. How does this concentration compare to what would be found in blood plasma/tissues/secreted by Huh-7 cells? Thus, these results may not be biologically relevant. It is difficult to determine what concentrations of ApoE are used in some cases, e.g. Fig 6. Please provide this information in the figure or figure caption.
      2. While there are some interesting results here, this manuscript does not get to the point of establishing mechanism. In the discussion, it is speculated that ApoE functions via GAGs/HSPGs, which are known to affect HSV-1 attachment/release. It would make the manuscript much stronger to include experiments adding soluble heparin or treating cells with heparinase, or producing gC-null virus particles, to see if this abolishes the attachment/release effects of ApoE.
    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      This manuscript attempts to identify the molecular basis for the reported interactions between apolipoprotein E (ApoE) and herpes simplex virus 1 (HSV1), known to be a significant marker for Alzheimer's disease. The authors employ a combination of cellular and in vitro assays designed to assess the effect of ApoE on different stages of the HSV1 life cycle. These experiments reveal an effect of ApoE on virus binding to and detachment from cell membranes, but not in other aspects of the viral life cycle. Further, the isoform ApoE4 was found to be the most effective in exerting these changes, possibly due to competitive binding with cell surface receptors that can associate with both ApoE and HSV1. Prior studies were referenced appropriately. For the most part, sufficient details about the data acquisition and analysis workflow were included in the study, although a couple of exceptions have been noted. More information about number of data sets for each panel and statistical analysis need to be included in the manuscript (figure legends and a separate section in Materials & Methods). Some of the key conclusions from the data require additional context and information to justify their interpretation in the present form. The additional experiments suggested are reasonable in terms of time and resources and are critical for strengthening the key conclusions in the manuscript. These have been noted below. Comments on evidence, reproducibility and clarity

      Major Comments:

      1. The authors mention in the Discussion section that they have ruled out interaction of ApoE with HSV1 glycoproteins B, C, D, and E based on immunoprecipitation data that is not included in the manuscript. In view of this, how do they justify using HSV1 gC as a marker for checking for association of HSV1 with ApoE (Fig 5)? Further, the authors should consider including said immunoprecipitation data in the manuscript, since those would be of immense value in further studies looking for other interaction partners of ApoE (as the authors have stated in the Discussion section).
      2. How strong are the interactions between ApoE and HSV-1? In other words, what fraction of the available ApoE could be expected to associate stably with HSV1? Can ApoE or ApoE-associated complexes act as a trap for the virus and therefore represent latent virus pools in cells? How were possible contributions to HSV1 detachment from other cellular factors associated with ApoE ruled out?
      3. The Discussion section of the manuscript clearly places the detected interaction of ApoE with HSV1 in the context of previous literature on related facets of the crosstalk between ApoE and viral infections. The authors may also consider including a paragraph on the more physicochemical attributes of ApoE interaction with HSV1, which would make the Discussion section more well-rounded and provide some background for understanding the biophysical experiments reported here (Fig. 6, 7). For example, how do the dissociation rates they report in Fig. 6 compare to those reported earlier for viruses on SLBs or cellular membranes? Could these dissociation rates be readily converted to (at least semi-quantitative) estimates of the thermodynamics of ApoE binding to HSV1 or would other factors need to be explicitly considered for such analytical exercises? Would it be difficult to measure binding affinities using HSV1 and purified ApoE by complementary approaches such as calorimetry or surface plasmon resonance? On a related note, what kind of ApoE concentration could HSV1 encounter in a cellular milieu and would it be in the range (5 μM) at which they report significant effects of ApoE on HSV1? What could be expected to happen at even higher concentrations of ApoE (reported for other cellular pathologies)?<br /> Why is the isoform dependence of ApoE effects observed predominantly in case of HSV1? Could this be related to the more complex fusion machinery available to this virus?
      4. It is strongly recommended that details about ApoE purification and characterization are included in the manuscript, along with appropriate references. It is also not clear how a 4h period was deemed to be sufficient for incubation with ApoE (Fig. 2).
      5. The data in Fig 4 is not entirely sufficient to support claims of ApoE enrichment in virus particles released into the supernatant. The authors may consider including additional experiments to check for (and quantify, if possible) ApoE levels in these virus fractions (since these conditions are drastically different than that used for reporting co-sedimentation of ApoE and HSV-gC in Fig. 6B).
      6. Fig 5: It is not clear why the authors tested only for gC (especially when they note that co-immunoprecipitation experiments have ruled out gC as a possible interaction partner for ApoE; also see comment 1). Is the shift in the ApoE band to higher kD values from fraction 1 to 6 significant? What do the error bars in Fig 5B represent, if data was generated from two independent replicates? How do you reconcile the very high viral titer of fraction 3 (Fig 5C) with the moderate level of gC_HSV-1 in the same fraction (Fig 5B)? Does this indicate heterogeneity in gC content across seemingly equivalent viral titers (fractions 1-3, based on Fig 5C) ?
      7. Several inconsistencies were noted in figures and figure legends that could affect a clear understanding of the data by readers. For all figures, please indicate clearly if no notation for statistical tests denote an absence of significance (ns) or that significance was not tested (such as for Fig. 2B, C). Please include sufficient information regarding number of independent replicates for each panel (i.e., what do error bars represent). For t-tests, please indicate clearly the reference data sets used for testing statistical significance and define symbols used for different p-values only for that specific figure. For example, a p-value corresponding to * is defined in the legend to Fig. 2, although that p-value is not indicated in the figure.

      Minor Comments:

      1. P. 4: abbreviation HSPG is not defined
      2. Inconsistent figure formatting noted in terms of non-uniform axis labels, color coding, inclusion of error bars, clear label of all lanes in blots. These should be reviewed and modified as appropriate.
      3. Fig 1A: The authors may consider reverting the order of ApoE concentration (ascending, instead of descending) in X-axis label to make it more intuitive.
      4. Line 167: please specify that data in Fig S1b refers only to SH-SY5Y cells.
      5. In Fig 2A, value for dissolvent should be set to 100%, since rest of the data are normalized with respect to that.
      6. Line 279 refers to Fig. 3C (not present in the manuscript).
      7. Ladders not clearly visible in some blots, such as that for 50 kD in Fig S1 and Fig 5A (HSV1 infected panel).
      8. Please indicate clearly in the Materials & Methods if ApoE induction (Fig. 7) is performed in HEK cells or HEK-293T cells.

      Significance

      This study sheds light on the molecular basis of the interaction between HSV1 and ApoE and represents a conceptual advance in the field. Since such interactions have been reported to be a marker for patients at high risk of developing Alzheimer's disease, these findings would be important in designing future clinical studies on prognostic and diagnostic advances in neurodegenerative diseases. As such, this manuscript would be of interest to a broad spectrum of scientists and clinicians including virologists, biochemists, and biophysicists.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      Hermanns et al. report a robust biochemical and structural characterization of the TSSM virulence effector of Burkholderia pseudomallei, the causative agent of melioidosis, with TSSM being the only USP-type deubiquitinase of bacterial origin. The authors demonstrate ubiquitin specificity, and the capacity of the DUB to cleave most Ubiquitin chain types in vitro. By solving crystal structures of TSSM in isolation as well as in covalent complex with Ubiquitin, the authors rationalize how the truncated fold (compared to all other eukaryotic USPs) is capable of binding ubiquitin. The most surprising finding is the conformation of the so-called little finger loop, unique to TSSM, which engages the distal Ubiquitin in a manner not seen in any other DUB. These findings are convincingly validated by point mutations in biochemical assays and bioinformatic analyses. The structures also yielded information on the fold an N-terminal Ig-like domain with unknown function.

      The authors are encouraged to address the following main points before publication can be supported:

      • On page 6, the authors state "the little finger loop contacts hydrophobic residues around Ile-44 of ubiquitin, an important interaction interface that is not observed in USP7 and is not part of the canonical USP: ubiquitin interface". The latter statement I believe is simply wrong as Ile44 is at the centre of the large canonical USP:ubiquitin interaction interface observed in all structurally studied USP proteins so far (the recognition is through varying residues, that are not always strictly hydrophobic, but it is always contacted). This is occurring at the hinge between thumb and fingers. In USP7, this is for example occurring through the hydrophobic part of Arg301. The authors are referred to O'Dea et al. Nat Chem Biol 2023, where same conformation of the equivalent residue in USP36 is discussed in the context of Ile44-Ubiquitin vs. Fubi recognition.

      We thank reviewer #1 for this detailed explanation. Initially we made this statement based on the fact that in other USPs, the interaction is not always hydrophobic. However, we now agree with reviewer #1 and have removed this statement from the manuscript.

      • This should also be phrased very precisely, as Ile44 itself is not actually contacted by the little finger loop (see Fig. 3c), but other hydrophobic residues commonly included in the Ile44 patch are. However, also those are always in the Ubiquitin:USP interface.

      These section was removed in line with the previous point. Additionally, we added the information that Ile44 itself is not contacted to the main text.

      • It appears as if the little finger loop takes up the exact position of what is commonly referred to as blocking loop 1 (terminology introduced by Hu et al EMBO J 2005, which the authors could also use when referring to canonical USPs). The connectivity in the domain is not equivalent to BL1 though (this could be shown with topology diagrams of a canonical USP and of TSM), but the relative position is. Importantly, BL1 in USPs typically engage the Ile36 patch with a large aromatic residue (e.g., a Trp in USP30 or a Tyr in USP7), however, in TSSM Ubiquitin is rotated such that the Ile44 patch is recognised at the exact spot where normally Ile36 is engaged. Can the authors comment on this interpretation? This reviewer would also find a comparison to the canonical USP recognition mode in the main figures beneficial (however one that is less crowded than in the SI) to make this very important finding come across well. Even if the loop is more like a BL1 (which is highly diverse in the USP family, see reference above), it can still be called "little finger", but the analogies should be carefully phrased throughout the text (e.g., page 9: "functionally but not structurally analogous" would not be correct if it does not replace the fingers which contact Phe4 as BL1 is not part of the fingers).

      The reviewer is correct. The positioning of BL1 from canonical USPs and the TssM Littlefinger loop is superficially similar. Since the Littlefinger is derived from a different part of the sequence (Fig 1a) and contacts a different patch of ubiquitin, it is still distinct from the BL1. We have incorporated this information into the main text and generated a new superposition to show the structural similarities (Supplementary Fig 3c). Additionally, we highlighted BL1 and Littlefinger in Fig1a to show the different position within the amino acid sequence. Since BL1 and Littlefinger are distinct from each other we still classify the Littlefinger as functionally (but not structurally) analogous to the fingers domains. Both serve as the main contacts to ubiquitin and (partially) interact with the Ile44 patch, while BL1 contacts the Ile36 patch.

      • The assessment of the molecular weight of apo TSSM in solution by SEC is flawed in its current form (page 7, Fig. 4b). There are only two, seemingly randomly chosen, comparison proteins, and the GST-Ub is unsuitable for 36 kDa because it is an obligate dimer (due to the GST) and as a fusion protein has a much higher hydrodynamic radius than a globular protein. There are commercial reference proteins that can be used which have defined oligomerisation states and are (reasonably globular) so that the retention times can be quantitatively analysed. Such a reference, which also includes proteins of smaller sizes, must be used. Alternatively, the authors should use light-scattering (SEC-MALS or SEC-RALS) to unequivocally demonstrate the molecular weight / oligomeric state of TSSM.

      The experiment has been re-done using commercially proteins routinely used for the calibration of SEC columns. Additionally, a 75pg column was used to achieve a better resolution of the proteins. The new data confirm the original conclusion that TssM behaves like a monomer in solution.

      • The abstract ends with speculation on the presence of the strand-swapping in live cells and of the role of the Ig-fold domain, but not a proper conclusion. The same applies to the ending of the results section (page 8), where it is not clear where the structural analysis of the Ig-like domains is leading. The authors then speculate about sugar binding (page 10) in the discussion. The latter could be substantiated by an analysis of the residues in the possible sugar binding site (if present in their TSSM), and the text be more rounded off at these regions.

      We admit that our manuscript does not reveal the function of the Ig-like domain and the strand swap observed in the apo structure. To really address these questions, an infection model would be required, which is outside the scope of our manuscript focussing on the TssM mechanism. As have showed that deletion of the Ig-domain does not alter the DUB properties, the remaining questions cannot be addressed in vitro. To address the concerns of the reviewer, we have changed the ending of the result section (page 8) to summarize our in vitro data on the Ig-like domain. We have also clarified the paragraph discussing the possibility of sugar binding on pages 10/11. In brief, this speculation was not based on the identification of a possible sugar binding site, but rather on the presumed positioning of the Ig-like domain relative to the bacterial surface and its evolutionary relationship to other sugar-binding domains.

      • The authors show in Fig. 1b TSSM reactivity with both Ubiquitin and Nedd8 probes but then qualify the Nedd8-reactivity with the assays shown in Figs. 1cd, which currently looks like it is an issue with the comparison of probe to substrate. However, their probe assay is very long with 18 h. It should be repeated at shorted times (for Ub and Nedd8-PA only) to test if the strong Ub preference seen in the kinetic assay can also be visualized with the probes.

      We measured the requested time curve and added the data to the newly generated Supplementary Figure 1. Using very short time points of 3 – 20min, a preferential reactivity with the ubiquitin probe became visible, which supports the AMC results.

      • Moreover, the authors prepare Ubl-PA probes by aminolysis of C-terminal thioesters but at very different stoichiometries as reported for Ub-PA (e.g., in Gersch et al. NSMB 2017). The precise amounts should be cross-checked. This reviewer would not be surprised if the conditions of only 2-fold excess of propargylamine over Ubl thioester and the high amount of NaOH led also to hydrolysis of the C-terminus, which by size exclusion chromatography would not be separated. For all probes, intact mass spectra of the used aliquots must be shown to demonstrate the identity of the used reagents. The presence of other species of course does not per se disqualify the assay in Fig. 1b.

      Our protocol for generating the Ub-PA probe follows exactly the one described in Gersch et al 2017. While this publication describes the amounts and concentrations of the individual reagents, our description of the protocol documents their final concentration in the reaction mixture. We double-checked the data and found them to be identical. Thus, there is no reason to assume elevated amounts of hydrolysis products. Moreover, the purity of our probes is regularly controlled by intact mass spectrometry (shown below for Ub-PA). The observed ~5% of hydrolysis product should not pose a problem for the assays, which routinely involve a 10x excess of probe over DUB. As documented in the Materials section, the Nedd-PA probe was obtained from Monique Mulder in Leiden.

      In addition, the following minor points should be addressed:

      • On page 2, the authors state that the 1-2 DUBs typically present in bacteria either target K63-chains or lack specificity (without reference), but on page 10 they state that bacteria typically only have 1 DUB with little specificity. This is contradicting and should be fixed.

      We have rephrased the introductory sentence on page 2 and added a reference. The issue on page 10 has been corrected

      • On page 3, the authors make the case for TSSM from B. pseudomallei by calling it representative. This reviewer would appreciate if the authors could expand on this towards the end of the manuscript and comment on whether they expect the identified Ubiquitin recognition mode to be present also in all (!) other DUB-TSSM proteins, at least all analysed bioinformatically. Importantly, they should include the sequence of TSSM of B. mallei (the only in vitro studied TSSM so far) into their analyses in the SI.

      We have expanded the paragraph (page 9) where we discuss the conservation of the Littlefinger-based ubiquitin recognition mode. Among the TssM-like DUBs that we identified, only those from other Burkholderia species contain the Littlefinger conservation and are predicted (by alphafold) to use this region for S1-ubiquitin recognition. The two non-Burkholderia TssM-like DUBs (one from Chromobacterium sinusclupearum, the other from an unidentified bacterial metagenome) lack the Littlefinger region and the associated ubiquitin recognition mode. This is documented in Supplementary Fig 4. We also added B. mallei to the alignment in Supplementary Fig 4a, although it is almost identical to the B. pseudomallei sequence.

      • On page 4, the authors start with TSSM (193-490) but do not comment on the role of the first 192 residues. What was the rational for these boundaries?

      The N-terminal 192 amino acids are predicted to be unstructured (by alphafold, IUPRED, etc). We therefore decided to use the entire folded part of TssM for the first experiments. The information has been added to the manuscript and a domain scheme was added to the supplementary data (Supplementary Figure 1a).

      • On page 4, the authors introduce the use of the fluorogenic AMC substrates with "more quantitative analysis", however, the experiments are rather minimalistic. Only one substrate concentration, and two enzyme concentrations (at least for one substrate) are used, and the data are not really analysed in a quantitative manner. Through curve fitting of the existing data (with fixed restraints) the authors may be able to determine an estimate of the Ub/Nedd8-specificity factor. Moreover, negative controls should be shown in Figure 1c to demonstrate that the Nedd8-curve is above a possible baseline drift.

      Following this reviewer’s suggestion, we estimated a 116x better cleavage of ubiquitin-AMC by determination of the initial velocities using the linear range of the data presented in Figure 1c.

      For ensuring better clarity, we have omitted the negative control data from Fig 1 panel c (comparing Ub-AMC and Nedd8-AMX) but are showing them in panel 1d (comparing Nedd8-AMC to negative control). This figure clearly shows that Nedd8-AMC is really cleaved, whereas no baseline drift is visible.

      • On page 4, the authors mention a possible relationship with the Josephin family (which they later disprove through structural comparisons, page 6). It may be helpful to briefly explain the rational (i.e., why one would even consider a relationship with the Josephin family DUB given the higher homology to the USP fold).

      The rationale for considering a relationship to the Josephin family is explained at the end of the introduction section (page 3). We never considered TssM to be closer related to Josephins than to USPs. We rather speculated that the entire USP and Josephin families are distantly related to each other, and that TssM-like USPs might form a kind of missing link. This latter aspect has been disproved (page 6), since the TssM structure is no more Josephin-like than that of any other USP.

      • On page 5, the "shortened C-terminus" compared to USP7 is mentioned. This is misleading, as USP7 has an elongated C-terminus compared to most other USPs, and so the TSSM C-terminus is the canonical ending of the USP fold.

      The section has been rephrased and now points out that TssM shares the canonical USP C-terminus.

      • On page 6, "ubiquitin has multiple specific contacts" - why are the contacts named "specific"?

      We have removed the word ‘specific’

      • On page 10, the TSSM from C. sinusclupearum appears without any context. Chromobacterium should be spelled out, and it should be discussed if this is the odd one out. It would also be appreciated if the authors could state whether their bioinformatic analysis is comprehensive (i.e., do only the known or all Burkholderia strains have TSSM with a DUB profile). And why is there a A0A1J5... sequence included in Supp Fig. 3a without any context?

      We agree that this part of the text was confusing. We have now bundled all information on other TssM-like sequences on page 9. There, we explain that TssM-like DUBs are only found in selected Burkholderia lineages, and spell out some examples. We also introduce Chromobacterium sinusclupearum with its full name and explain that the remaining non-Burkholderia TssM homolog is from an unidentified metagenomic sequence. This is also the reason why we refer to this sequence by its Uniprot accession number.

      • Some minor polishing in the methods would increase consistency (cloning is only mentioned for pOPIN-K, but TSSM is also expressed from pOPIN-S; mutants are only mentioned for the 292-490 construct, but Fig. 2d shows one in the 193-490 construct; Hampton Additive Screens I-III are likely an internal name and not used by Hampton itself; "different TSSM concentrations (as indicated in the figure legends" are mentioned in the methods, but e.g. in the caption to Fig. 1 no concentration is given).

      We have added the pOPIN-S cloning method and corrected the name of the additive screen. We now provide all mutant data in the 292-490 background (Figure 2d was updated accordingly). We made sure that all figure captions mention the enzyme concentrations.

      • Likewise, Table 1 needs polishing as commas and points are used interchangeably.

      Table 1 has been corrected

      • In Fig. 2c, it looks like the catalytic His is built such that there is no hydrogen bonding between Cys and Asp - is there a particular reason for this? If not, the side chain should be flipped so that the nitrogens are positioned for ideal hydrogen bonding.

      Fig 2c had been accidentally exported from an early version of the structure. It has now been replaced by a panel that uses the final and deposited version of the structure. Here, the His position is correct.

      • In Fig. 3, dotted lines are introduced as "hydrophobic interactions" as per the captions, but some are clearly hydrogen bonds (e.g., from the amide backbone), and for some others one does not see as they emerge from a cartoon.

      In Fig 3, dotted lines are not generally introduced as "hydrophobic interactions". Instead, the individual panels have their own definition for the dotted lines. c) hydrophobic d) hydrogen bonds e) hydrophobic.

      • In Fig. 4, context should be given to "3VYP" and why it is used here.

      We have added an explanation of 3VYP to the figure legend (The reason for showing it is also explained in the main text)

      **Referees cross-commenting**

      Reviewer comments appear to be fair, balanced and complementary.

      Re Reviewer 2's comment on the pre-print: It includes a structure of TSSM bound to ubiquitin (but not of the apo protein). I am not sure if it is appropriate to follow up on the esterase activity. Firstly, there are no tools for it commercially available or readily made in vitro, and secondly it would appear a bit "copycat"-like. Especially since the molecular determinants of what makes a DUB a good esterase are still elusive. A narrower focus of this manuscript, but done very well (also according to what reviewer 3 suggested), might be a more fitting option.

      Reviewer #1 (Significance (Required)):

      The findings are novel and of high relevance to the broad ubiquitin and bacterial pathogen communities as the study addresses an enigmatic USP-type deubiquitinase which, as the authors reveal, recognizes Ubiquitin in an entirely different way than its eukaryotic counterparts. This is basic research of pronounced conceptual and mechanistic advance, as it demonstrates that the USP domain can be much more diversified than previously assumed. The structural analysis is very thorough, the data are scholarly presented, and interactions/mechanisms carefully validated by mutations.

      The strongest point is clearly the structural analysis of Ubiquitin recognition by this extremely truncated USP fold, and the introduction of the little finger motif. The manuscript does not provide cellular validation of the findings, which is fine to this reviewer for the DUB catalysis part. For the part of the N-terminal domain, the manuscript would benefit from a cellular validation or some localisation studies, however, this is beyond what is established in the authors' lab, and therefore has not been asked. This in turn limits the study to a very thorough in-vitro analysis of this DUB for TSSMs with DUB activity, using conventional substrates like polyUb chains and fluorogenic substrates, and providing convincing conclusions.

      My expertise lies in DUBs, biochemistry, and structural biology, and I this believe to have sufficient expertise to evaluate the majority of the findings except the bioinformatic algorithms used which are however not an emphasis in this manuscript.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      In this manuscript, the authors solved crystal structures of apo-TssM and its complex with Ubiquitin. Together with the biochemical assays, the authors highlighted the differences of TssM from other USP family. TssM do not contain the classical finger domain while it has little finger domain that authors defined. The Ile44 patch on the ubiquitin is mainly used for interacting with TssM.

      For the clarity of there findings several points should be edited.

      1) In Fig 2d, the authors used different constructs for testing catalytic residues. It will be better to be consistent. Though the authors showed that the deletion of Ig-like domain does not affect the catalytic activity of TssM by showing the AMC assay, it does not guarantee that the effect of mutation on catalytic sites is same for both construct.

      The experiment has been repeated with TssM292-490 C308A and the panel in Fig 2d has been replaced

      .

      2) In fig 2d, authors need to put the label to indicate which linkage of di-Ub is used. Authors did it for figure 2f.

      Chain type was already stated in the legend, but was now also added to the respective panel.

      3) By showing AMC assay (fig 2e) and K63 Ub2 cleavage assay (fig 2f), authors concluded that the deletion of Ig-like domain does not affect the activity of TssM. However, as authors found that the Ig-like domain forms dimer at least in their crystallization condition, one cannot exclude the possibility of the role of Ig-like domain in recognising different ubiquitin chains. I would clarify the words by saying "The Ig-like domain does not affect the cleavage K63-Ub2), or authors can expand the cleavage assay with all the linkages.

      We agree with reviewer #2 and rephrased the corresponding sentence.

      4) In the apo structure, authors found a domain swapped dimer. One can expect that this dimer is crystallographic artifact and not found in the nature. Indeed, authors could not observe this dimer in the solution when they performed SEC analysis and there was no effect on the catalytic activity when the Ig-like domain is deleted. Because there is no clear evidence of functional importance of this dimer in the manuscript, authors need to clarify about this dimer.

      We agree with reviewer #2 that there is no evidence for functional importance of the dimer. We had already addressed this issue in our discussion section, where we hypothesized a potential in vivo function. We have now rephrased this section of the discussion in order to make it more precise.

      **Referees cross-commenting**

      Agree with Reviewer #1's comment on my points.

      Reviewer #2 (Significance (Required)):

      The structure of TssM is recently reported in a preprint ( https://doi.org/10.21203/rs.3.rs-2986327/v1) from Pruneda (OHSU). In this preprint, they suggested the role of TssM as Ubiquitin esterase which is not explored in the this manuscript. As it is already published and freely available, authors can explore the role of TssM in that direction as well. Because the preprint do not contain the complex structure of TssM with Ubiquitin, authors can also examine the roles of Ile44 patch-interacting residues on the catalytic activities.

      Said preprint contains the TssM~Ub complex structure, but not the structure of the apo form. The role of the Ile44-patch contacting residues is also already analysed in regards of esterase activity. As explained in the ‘general points’ at the top of the rebuttal letter, the two manuscripts were meant to be submitted simultaneously. Due to a delay in our PDB deposition/validation, we submitted our version two weeks later. Thus, we share the opinion of reviewer #1 that it would be inappropriate to use our competitors’ data and analyse esterase activity in our manuscript. Instead, we added a reference to the competing preprint to our discussion section and briefly compare the key findings. The authors of the preprint have agreed to reciprocate and reference our preprint in their revised manuscript.

      Also, authors can compare their little finger structure with the preprint.

      See point above.

      In general, this manuscript is providing several interesting points to the readers working on the ubiquitin, structures of proteins, host-pathogen interactions and especially those who studying deubiquitinases.

      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      In this study, Hermanns et al. have examined the Burkholderia TssM deubiquitinase (DUB) for its ubiquitin chain cleavage specificity using in vitro analyses and for a structural rationalization of its specificity by solving crystal structures with and without covalently bound ubiquitin. TssM was previously shown to be a DUB of the USP family capable of cleaving several ubiquitin chain types. From bioinformatic comparisons, the authors inferred that TssM lacks the 'fingers' domain of classic USP enzymes, and this was shown in the co-crystal structure to be replaced by a 'Littlefinger' loop. The work here is well described and appears to be overall technically solid.

      My enthusiasm is reduced for several reasons. First, there is no analysis in an (infected) cell model to evaluate the significance of the TssM mutations, for example, the mutations in ubiquitin-interacting surfaces that are not seen in classic USPs. Second, there is very little quantitation of cleavage rates; while I would not demand derivation of kinetic values for all mutants, the qualitative treatment was not always convincing. For example, Y443A was said to cause "strongly reduced cleavage" (Fig. 4h) whereas E378A was said to "only mildly affect cleavage" (Fig. 4i): to my eye, these cleavage rates are only slightly different (2-3 fold?).

      In order to support the findings of our gel based assay and to get more quantitative data, we tested all mutants against Ub-AMC. The results are depicted in supplementary figures 3d/f/g and correspond to results of the chain cleavage assays.

      Finally, there is a preprint available on Research Square (doi: 10.21203/rs.3.rs-2986327/v1) that shows a potent esterase activity of TssM against ubiquitinated LPS, which is probably its key role in avoiding surveillance and elimination by the host. This paper, although still a preprint, is far more quantitative, includes similar crystallographic data as in the current paper, and describes cellular assays of function. Even without the RS preprint, the Hermanns et al. study provides a fairly modest advance in our knowledge of TssM function; with the preprint, its novelty is, unfortunately, severely reduced.

      As explained in the ‘general points’ at the top of the rebuttal letter, the two manuscripts were meant to be submitted simultaneously. Due to a delay in our PDB deposition/validation, we submitted our version two weeks later. The competing work is currently under review at a top-tier journal and far from being accepted. We therefore ask to consider the significance of our own manuscript based on the peer-reviewed state-of-the-art.

      In our revised manuscript, we have added a brief discussion of the pre-published results. The authors of the preprint have agreed to reciprocate and address our data in their revised manuscript.

      Minor comments:

      Full genus names should be spelled out when they first appear in the text (such as Burkholderia and Chromobacterium).

      Genus names are now spelled out.

      Fig. 3a is described out of sequence.

      A reference to figure 3a was missing in the beginning of the chapter. The reference was added and the figure is now described in sequence.

      In Fig 4a, there still seem to be extensive contacts between monomers but the viewing angle could be misleading.

      There are no extensive contacts between the two DUB monomers in the right panel (complex structure). We slightly changed the viewing angle in Fig 4a to make this clearer.

      **Referees cross-commenting**

      I also agree with Reviewer #1's comments

      Reviewer #3 (Significance (Required)):

      Even without the Research Square preprint (doi: 10.21203/rs.3.rs-2986327/v1), the Hermanns et al. study provides a fairly modest advance in our knowledge of TssM function; but with the preprint, its novelty is, unfortunately, severely reduced.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In this study, Hermanns et al. have examined the Burkholderia TssM deubiquitinase (DUB) for its ubiquitin chain cleavage specificity using in vitro analyses and for a structural rationalization of its specificity by solving crystal structures with and without covalently bound ubiquitin. TssM was previously shown to be a DUB of the USP family capable of cleaving several ubiquitin chain types. From bioinformatic comparisons, the authors inferred that TssM lacks the 'fingers' domain of classic USP enzymes, and this was shown in the co-crystal structure to be replaced by a 'Littlefinger' loop. The work here is well described and appears to be overall technically solid.

      My enthusiasm is reduced for several reasons. First, there is no analysis in an (infected) cell model to evaluate the significance of the TssM mutations, for example, the mutations in ubiquitin-interacting surfaces that are not seen in classic USPs. Second, there is very little quantitation of cleavage rates; while I would not demand derivation of kinetic values for all mutants, the qualitative treatment was not always convincing. For example, Y443A was said to cause "strongly reduced cleavage" (Fig. 4h) whereas E378A was said to "only mildly affect cleavage" (Fig. 4i): to my eye, these cleavage rates are only slightly different (2-3 fold?). Finally, there is a preprint available on Research Square (doi: 10.21203/rs.3.rs-2986327/v1) that shows a potent esterase activity of TssM against ubiquitinated LPS, which is probably its key role in avoiding surveillance and elimination by the host. This paper, although still a preprint, is far more quantitative, includes similar crystallographic data as in the current paper, and describes cellular assays of function. Even without the RS preprint, the Hermanns et al. study provides a fairly modest advance in our knowledge of TssM function; with the preprint, its novelty is, unfortunately, severely reduced.

      Minor comments:

      Full genus names should be spelled out when they first appear in the text (such as Burkholderia and Chromobacterium).

      Fig. 3a is described out of sequence.

      In Fig 4a, there still seem to be extensive contacts between monomers but the viewing angle could be misleading.

      Referees cross-commenting

      I also agree with Reviewer #1's comments

      Significance

      Even without the Research Square preprint (doi: 10.21203/rs.3.rs-2986327/v1), the Hermanns et al. study provides a fairly modest advance in our knowledge of TssM function; but with the preprint, its novelty is, unfortunately, severely reduced.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      In this manuscript, the authors solved crystal structures of apo-TssM and its complex with Ubiquitin. Together with the biochemical assays, the authors highlighted the differences of TssM from other USP family. TssM do not contain the classical finger domain while it has little finger domain that authors defined. The Ile44 patch on the ubiquitin is mainly used for interacting with TssM.

      For the clarity of there findings several points should be edited.

      1. In Fig 2d, the authors used different constructs for testing catalytic residues. It will be better to be consistent. Though the authors showed that the deletion of Ig-like domain does not affect the catalytic activity of TssM by showing the AMC assay, it does not guarantee that the effect of mutation on catalytic sites is same for both construct.
      2. In fig 2d, authors need to put the label to indicate which linkage of di-Ub is used. Authors did it for figure 2f.
      3. By showing AMC assay (fig 2e) and K63 Ub2 cleavage assay (fig 2f), authors concluded that the deletion of Ig-like domain does not affect the activity of TssM. However, as authors found that the Ig-like domain forms dimer at least in their crystallization condition, one cannot exclude the possibility of the role of Ig-like domain in recognising different ubiquitin chains. I would clarify the words by saying "The Ig-like domain does not affect the cleavage K63-Ub2), or authors can expand the cleavage assay with all the linkages.
      4. In the apo structure, authors found a domain swapped dimer. One can expect that this dimer is crystallographic artifact and not found in the nature. Indeed, authors could not observe this dimer in the solution when they performed SEC analysis and there was no effect on the catalytic activity when the Ig-like domain is deleted. Because there is no clear evidence of functional importance of this dimer in the manuscript, authors need to clarify about this dimer.

      Referees cross-commenting

      Agree with Reviewer #1's comment on my points.

      Significance

      The structure of TssM is recently reported in a preprint ( https://doi.org/10.21203/rs.3.rs-2986327/v1) from Pruneda (OHSU). In this preprint, they suggested the role of TssM as Ubiquitin esterase which is not explored in the this manuscript. As it is already published and freely available, authors can explore the role of TssM in that direction as well.

      Because the preprint do not contain the complex structure of TssM with Ubiquitin, authors can also examine the roles of Ile44 patch-interacting residues on the catalytic activities.

      Also, authors can compare their little finger structure with the preprint.

      In general, this manuscript is providing several interesting points to the readers working on the ubiquitin, structures of proteins, host-pathogen interactions and especially those who studying deubiquitinases.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Hermanns et al. report a robust biochemical and structural characterization of the TSSM virulence effector of Burkholderia pseudomallei, the causative agent of melioidosis, with TSSM being the only USP-type deubiquitinase of bacterial origin. The authors demonstrate ubiquitin specificity, and the capacity of the DUB to cleave most Ubiquitin chain types in vitro. By solving crystal structures of TSSM in isolation as well as in covalent complex with Ubiquitin, the authors rationalize how the truncated fold (compared to all other eukaryotic USPs) is capable of binding ubiquitin. The most surprising finding is the conformation of the so-called little finger loop, unique to TSSM, which engages the distal Ubiquitin in a manner not seen in any other DUB. These findings are convincingly validated by point mutations in biochemical assays and bioinformatic analyses. The structures also yielded information on the fold an N-terminal Ig-like domain with unknown function.

      The authors are encouraged to address the following main points before publication can be supported:

      • On page 6, the authors state "the little finger loop contacts hydrophobic residues around Ile-44 of ubiquitin, an important interaction interface that is not observed in USP7 and is not part of the canonical USP: ubiquitin interface". The latter statement I believe is simply wrong as Ile44 is at the centre of the large canonical USP:ubiquitin interaction interface observed in all structurally studied USP proteins so far (the recognition is through varying residues, that are not always strictly hydrophobic, but it is always contacted). This is occurring at the hinge between thumb and fingers. In USP7, this is for example occurring through the hydrophobic part of Arg301. The authors are referred to O'Dea et al. Nat Chem Biol 2023, where same conformation of the equivalent residue in USP36 is discussed in the context of Ile44-Ubiquitin vs. Fubi recognition.
      • This should also be phrased very precisely, as Ile44 itself is not actually contacted by the little finger loop (see Fig. 3c), but other hydrophobic residues commonly included in the Ile44 patch are. However, also those are always in the Ubiquitin:USP interface.
      • It appears as if the little finger loop takes up the exact position of what is commonly referred to as blocking loop 1 (terminology introduced by Hu et al EMBO J 2005, which the authors could also use when referring to canonical USPs). The connectivity in the domain is not equivalent to BL1 though (this could be shown with topology diagrams of a canonical USP and of TSM), but the relative position is. Importantly, BL1 in USPs typically engage the Ile36 patch with a large aromatic residue (e.g., a Trp in USP30 or a Tyr in USP7), however, in TSSM Ubiquitin is rotated such that the Ile44 patch is recognised at the exact spot where normally Ile36 is engaged. Can the authors comment on this interpretation? This reviewer would also find a comparison to the canonical USP recognition mode in the main figures beneficial (however one that is less crowded than in the SI) to make this very important finding come across well. Even if the loop is more like a BL1 (which is highly diverse in the USP family, see reference above), it can still be called "little finger", but the analogies should be carefully phrased throughout the text (e.g., page 9: "functionally but not structurally analogous" would not be correct if it does not replace the fingers which contact Phe4 as BL1 is not part of the fingers).
      • The assessment of the molecular weight of apo TSSM in solution by SEC is flawed in its current form (page 7, Fig. 4b). There are only two, seemingly randomly chosen, comparison proteins, and the GST-Ub is unsuitable for 36 kDa because it is an obligate dimer (due to the GST) and as a fusion protein has a much higher hydrodynamic radius than a globular protein. There are commercial reference proteins that can be used which have defined oligomerisation states and are (reasonably globular) so that the retention times can be quantitatively analysed. Such a reference, which also includes proteins of smaller sizes, must be used. Alternatively, the authors should use light-scattering (SEC-MALS or SEC-RALS) to unequivocally demonstrate the molecular weight / oligomeric state of TSSM.
      • The abstract ends with speculation on the presence of the strand-swapping in live cells and of the role of the Ig-fold domain, but not a proper conclusion. The same applies to the ending of the results section (page 8), where it is not clear where the structural analysis of the Ig-like domains is leading. The authors then speculate about sugar binding (page 10) in the discussion. The latter could be substantiated by an analysis of the residues in the possible sugar binding site (if present in their TSSM), and the text be more rounded off at these regions.
      • The authors show in Fig. 1b TSSM reactivity with both Ubiquitin and Nedd8 probes but then qualify the Nedd8-reactivity with the assays shown in Figs. 1cd, which currently looks like it is an issue with the comparison of probe to substrate. However, their probe assay is very long with 18 h. It should be repeated at shorted times (for Ub and Nedd8-PA only) to test if the strong Ub preference seen in the kinetic assay can also be visualized with the probes.
      • Moreover, the authors prepare Ubl-PA probes by aminolysis of C-terminal thioesters but at very different stoichiometries as reported for Ub-PA (e.g., in Gersch et al. NSMB 2017). The precise amounts should be cross-checked. This reviewer would not be surprised if the conditions of only 2-fold excess of propargylamine over Ubl thioester and the high amount of NaOH led also to hydrolysis of the C-terminus, which by size exclusion chromatography would not be separated. For all probes, intact mass spectra of the used aliquots must be shown to demonstrate the identity of the used reagents. The presence of other species of course does not per se disqualify the assay in Fig. 1b.

      In addition, the following minor points should be addressed:

      • On page 2, the authors state that the 1-2 DUBs typically present in bacteria either target K63-chains or lack specificity (without reference), but on page 10 they state that bacteria typically only have 1 DUB with little specificity. This is contradicting and should be fixed.
      • On page 3, the authors make the case for TSSM from B. pseudomallei by calling it representative. This reviewer would appreciate if the authors could expand on this towards the end of the manuscript and comment on whether they expect the identified Ubiquitin recognition mode to be present also in all (!) other DUB-TSSM proteins, at least all analysed bioinformatically. Importantly, they should include the sequence of TSSM of B. mallei (the only in vitro studied TSSM so far) into their analyses in the SI.
      • On page 4, the authors start with TSSM (193-490) but do not comment on the role of the first 192 residues. What was the rational for these boundaries?
      • On page 4, the authors introduce the use of the fluorogenic AMC substrates with "more quantitative analysis", however, the experiments are rather minimalistic. Only one substrate concentration, and two enzyme concentrations (at least for one substrate) are used, and the data are not really analysed in a quantitative manner. Through curve fitting of the existing data (with fixed restraints) the authors may be able to determine an estimate of the Ub/Nedd8-specificity factor. Moreover, negative controls should be shown in Figure 1c to demonstrate that the Nedd8-curve is above a possible baseline drift.
      • On page 4, the authors mention a possible relationship with the Josephin family (which they later disprove through structural comparisons, page 6). It may be helpful to briefly explain the rational (i.e., why one would even consider a relationship with the Josephin family DUB given the higher homology to the USP fold).
      • On page 5, the "shortened C-terminus" compared to USP7 is mentioned. This is misleading, as USP7 has an elongated C-terminus compared to most other USPs, and so the TSSM C-terminus is the canonical ending of the USP fold.
      • On page 6, "ubiquitin has multiple specific contacts" - why are the contacts named "specific"?
      • On page 10, the TSSM from C. sinusclupearum appears without any context. Chromobacterium should be spelled out, and it should be discussed if this is the odd one out. It would also be appreciated if the authors could state whether their bioinformatic analysis is comprehensive (i.e., do only the known or all Burkholderia strains have TSSM with a DUB profile). And why is there a A0A1J5... sequence included in Supp Fig. 3a without any context?
      • Some minor polishing in the methods would increase consistency (cloning is only mentioned for pOPIN-K, but TSSM is also expressed from pOPIN-S; mutants are only mentioned for the 292-490 construct, but Fig. 2d shows one in the 193-490 construct; Hampton Additive Screens I-III are likely an internal name and not used by Hampton itself; "different TSSM concentrations (as indicated in the figure legends" are mentioned in the methods, but e.g. in the caption to Fig. 1 no concentration is given).
      • Likewise, Table 1 needs polishing as commas and points are used interchangeably.
      • In Fig. 2c, it looks like the catalytic His is built such that there is no hydrogen bonding between Cys and Asp - is there a particular reason for this? If not, the side chain should be flipped so that the nitrogens are positioned for ideal hydrogen bonding.
      • In Fig. 3, dotted lines are introduced as "hydrophobic interactions" as per the captions, but some are clearly hydrogen bonds (e.g., from the amide backbone), and for some others one does not see as they emerge from a cartoon.
      • In Fig. 4, context should be given to "3VYP" and why it is used here.

      Referees cross-commenting

      Reviewer comments appear to be fair, balanced and complementary.

      Re Reviewer 2's comment on the pre-print: It includes a structure of TSSM bound to ubiquitin (but not of the apo protein). I am not sure if it is appropriate to follow up on the esterase activity. Firstly, there are no tools for it commercially available or readily made in vitro, and secondly it would appear a bit "copycat"-like. Especially since the molecular determinants of what makes a DUB a good esterase are still elusive. A narrower focus of this manuscript, but done very well (also according to what reviewer 3 suggested), might be a more fitting option.

      Significance

      The findings are novel and of high relevance to the broad ubiquitin and bacterial pathogen communities as the study addresses an enigmatic USP-type deubiquitinase which, as the authors reveal, recognizes Ubiquitin in an entirely different way than its eukaryotic counterparts. This is basic research of pronounced conceptual and mechanistic advance, as it demonstrates that the USP domain can be much more diversified than previously assumed. The structural analysis is very thorough, the data are scholarly presented, and interactions/mechanisms carefully validated by mutations.

      The strongest point is clearly the structural analysis of Ubiquitin recognition by this extremely truncated USP fold, and the introduction of the little finger motif. The manuscript does not provide cellular validation of the findings, which is fine to this reviewer for the DUB catalysis part. For the part of the N-terminal domain, the manuscript would benefit from a cellular validation or some localisation studies, however, this is beyond what is established in the authors' lab, and therefore has not been asked. This in turn limits the study to a very thorough in-vitro analysis of this DUB for TSSMs with DUB activity, using conventional substrates like polyUb chains and fluorogenic substrates, and providing convincing conclusions.

      My expertise lies in DUBs, biochemistry, and structural biology, and I this believe to have sufficient expertise to evaluate the majority of the findings except the bioinformatic algorithms used which are however not an emphasis in this manuscript.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary

      In this manuscript Salvador-Garcia et al. examine how several mutations in the Dynein heavy chain (DHC) influence Dynein function in an in vitro reconstituted system and in Drosophila embryos. Most importantly, they identify a novel substitution mutation (S3372C, generated as a by-product of a targeted CRISPR mutagenesis screen) that leads to a novel phenotype specifically in early Drosophila embryos (metaphase arrest) and that only impairs DHC function under load in vitro. Most surprisingly, the metaphase arrest in embryos does not appear to be due to a failure to inactive the spindle-assembly-checkpoint (SAC), a known DHC function. This suggests that DHC has a hitherto unappreciated function in allowing spindles in the Drosophila embryo to progress from metaphase-to-anaphase.

      The manuscript is generally well written and conveys the major conclusions clearly and concisely. The data is generally of high quality, and largely supports the main conclusions, although there is one set of relatively straight-forward experiments that I think would be an important addition (see major comment #1, below).

      Major Comments

      1. The observation that the S3372C mutation causes a mitotic arrest that is not SAC dependent (i.e. it still largely occurs even in a Mad2 mutant background) is very surprising, and is the basis of the authors claim of a new, DHC-dependent, mechanism that allows embryo spindles to progress into anaphase. I think it would be important to assess whether the SAC components are still localising to the kinetochores in these S3372C, Mad2 double mutants (e.g. is Rod still recruited to high-levels in the double mutant?). If the SAC components are still being recruited to the spindle (suggesting that they are still detecting that the spindle is not ready to go into anaphase), is it worth considering that Mad2 may not be essential for SAC function in these embryos? I say this because I find it hard to imagine how any, presumably mechanical, failure at the kinetochore that leads to the improper metaphase/anaphase transition in the S3372C mutants, would signal to the rest of the spindle to not transition to anaphase if the SAC is truly inactivated. Do the authors think these embryos have a completely unrelated surveillance system that detects the S3372C-dependent error (whatever that is) and arrests the spindles specifically in embryos? Or is the error itself sufficient to cause a spindle-wide arrest, which seems improbable?
      2. I was surprised the authors made no attempt to quantify the level of over-accumulation of Dlic (Figure 6) or Rod (Figure 7) (and the lack of over-accumulation in other regions of the spindle). The images are convincing, so I don't doubt that this is the case, but I think some sort of quantification would be useful and I don't think it would be hard to come up with a way to do this (even just drawing a ROI around the approximate areas of interest). It would also be interesting to know whether other proteins like Spc25 (Figure 6) and Cdc20 (Figure S6) are recruited to normal levels at kinetochores.

      Minor Comments

      1. In the Discussion the authors state: "Our discovery of a missense mutation that strongly affects nuclear divisions in the embryo without disrupting other dynein functions offers a unique tool to study the mitotic roles of the motor". This should be reworded, as it suggests that the mutation effects all mitotic functions of DHC, which is clearly not the case (and also applies only to the embryo).
      2. I think it worth more explicitly stating that there is no evidence that the defects the S3372C mutation lead to in the in vitro reconstituted system are the cause of the in vivo defects observed in the embryo. The authors are careful not to directly claim this, and I agree with their assertion that this is the most "parsimonious explanation" for their data, but I'm sure they would agree that this is far from proven, and it might be worth emphasising this point a little more.

      Significance

      This is a well conducted study that significantly extends the author's previous work on how mutations in DHC (initially indentified in human patients) effect DHC function (Hoang et al., PNAS, 2017). The paper reports the striking central finding that the S3372C mutation produces a very unusual mitotic arrest phenotype specifically in Drosophila embryos, and the authors link this to the also striking finding that this mutation only disrupts DHC function in vitro when DHC is working under load. As mentioned above, this link is not proven here, but this is a solid working hypothesis that is potentially of significant interest to those working on molecular motors and their role in fundamental cell biology and human disease.

      I am a cell biologist with expertise in the cytoskeleton, particularly during early Drosophila embryogenesis.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      In the manuscript by Salvador-Garcia et al., the authors assess the physiological consequences of dynein mutations in flies and in vitro. In addition to characterizing the manner by which disease causing mutations affect fly development and some aspects of their cell physiology, the authors focus on sporadic mutations that arose during the course of generating their mutant fly lines. Of particular interest was a mutation in the dynein MTBD: S3722C. This mutation caused very interesting phenotypes in flies (e.g., infertility in females likely due to mitotic arrest) as well as in reconstituted motility assays (e.g., reduced stall force). The authors posit that the mitotic arrest phenotype is a consequence of a dynein's role in initiating anaphase onset, and that this role is distinct from its well established role in silencing the spindle assembly checkpoint.

      The paper is very well written, and the data are of high quality. Most of the claims - with one major exception (described below) - are well supported by the data. I have a few comments that might help to strengthen the conclusions.

      Major comment:

      1. In brief, I'm not convinced the mitotic arrest phenotype is not a consequence of impaired SAC silencing by the mutant dynein. The main tool the authors use to support their claim is a Mad2 mutant. They use this to determine if preventing SAC function (with the mutant Mad2) can override the ability of S3722C cells to progress into anaphase. The Mad2 mutant does in fact increase the proportion of cells exiting mitosis (from 0.8 to 14% of cells); however, the low number (14%) suggests that an inability to silence the SAC is not the reason the cells are not entering anaphase (i.e., it is SAC silencing-independent). My question is how penetrant the Mad2 mutant is? For example, how many cells with this Mad2 mutant would exit mitosis if the authors perturbed mitosis some other way (e.g., treatment with high concentrations of nocodazole)? If the number is still low (~14%), then this might be why the mutant can't rescue the mitotic exit phenotype for S3722C cells, and would challenge the following statements: "...it suggests that this can make, at best, a minor contribution to the mitotic arrest phenotype"; and "Remarkably, the MTBD mutation does not appear to block anaphase progression in embryos by preventing the well-characterized role of kinetochore-associated dynein in silencing the SAC, as the defect persists when the checkpoint is inactivated by mutation of Mad2. Collectively, these observations indicate that kinetochore dynein has a novel role in licensing the transition from metaphase to anaphase." Although previous studies might have assessed the penetrance of this mutant in other cell types, given the cell specificity of the mitotic arrest phenotype for S3722C (in embryonic cells, but not L3 neuroblasts), it will be important to provide such additional evidence in embryonic cells (e.g., nocodazole treatment of embryonic cells) to support these statements, especially in light of the bold conclusions and hypotheses they are making (e.g., "For example, the apparent variability in tension between sister kinetochores in S3372C embryos, which could reflect abnormal force generation by the mutant motor complex, might prevent APC/C activation through the complex series of signaling events that respond to chromosome biorientation."). Although it would be fascinating if the authors are correct that dynein provides another role in licensing anaphase onset, the well-established role for dynein in checkpoint silencing currently seems like the most parsimonious explanation.

      Minor comments:

      1. The S3722C mutant appears to accumulate to higher-than-normal levels at KTs and to some extent along the spindle MTs. In addition to the representative images, it would be helpful to see a quantitation of this phenomenon for WT, S3722C, and S3722C/+ along with statistics.
      2. Although the mean inter-KT distance was unchanged between WT and S3722C cells, the authors note that the deviation from the mean was higher. Could this simply be a consequence of more highly dynamic oscillations of KT pairs (similar to that seen with Hec1-S69D in DeLuca et al., JCB 2018)? More dynamic oscillations could potentially lead to more variable distances between KT pairs.
      3. It is interesting that the S3722C/Mad2-mutant cells are enriched in telophase (Fig. 7G). Does this not suggest another arrest point for these cells?
      4. The authors state: "Immunostaining revealed that whereas α1-tubulin was present throughout the spindle apparatus, α4-tubulin was enriched at the spindle poles (Figure S7A)." Although I agree the a4-tubulin appears somewhat enriched at the poles with respect to a1-tubulin, a quantitation (with statistics) would be needed to support this claim. That being said, I agree the isotype is unlikely to account for the S3722C phenotype.
      5. Trapping data show reduced stall force, yet increased stall time at low resistive forces for the mutant. This finding could potentially account for the reduced velocity of GFP-Rod noted in cells; however, I wonder if the authors noted altered velocity for dynein-driven bead movement under load in their trapping assays? This information would be useful to include in their manuscript.
      6. Is there a defocused spindle pole phenotype in the mutant cells? The cells in Video 1 and Fig. S6c appear to show as much, although other cells do not.
      7. The authors state: "This may reflect the relatively short length of Drosophila neurons making them less sensitive to partially impaired cargo transport." Could the extent of the phenotypes also be related to the lifespan of the flies? Do any of the diseases caused by these mutations have late-onset in patients? I wonder if a subtle defect in dynein behavior might not manifest for numerous years due to only minor changes in motility?

      Referees cross-commenting

      I wanted to reiterate my skepticism regarding the possibility that their data strongly support a SAC-independent role for dynein in the metaphase-to-anaphase transition (it seems Reviewer #3 might agree with me). I don't think it's impossible, but I'm not convinced they've made a very strong case for this model, which is noted in the title. The fact that proteins are accumulating at aligned kinetochores in the mutant cells (e.g., Rod and DLIC) in fact are consistent with a SAC silencing defect. Along these lines, I think reviewer #1's point regarding RZZ is a good one (that the mutant dynein is incapable of evicting RZZ specifically from aligned KTs), and should be tested prior to publication.

      My primary concern is that their conclusion is based entirely on the fact that the Mad2 mutant does not fully restore mitotic exit to the dynein mutant cells. Given the cell-specificity of their dynein phenotype (in embryonic cells, but not L3 neuroblasts), I think testing the penetrance of their Mad2 mutant in the embryonic cells would need to be assessed. In my review I suggested nocadazole, when I realized I meant to say reversine (oops!).

      Significance

      The manuscript by Salvador-Garcia et al. is a very interesting study dissecting the physiological consequences of dynein mutations in flies and in vitro. This study will be of high interest to those in the dynein/molecular motor field, as well as those that study mitosis and kinetochore function. One of the most interesting findings in the study is the identification of a mutation in dynein that specifically impacts its motility in conditions of high load. This mutant provides a novel tool to dissect load-dependent transport for dynein in other systems. Moreover, the study suggests a novel role for dynein in promoting anaphase onset; if the authors can provide additional support for this claim, the impact of this study would be greater.

      Field of expertise: molecular motors, kinetochore function

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      The authors start out by examining the cellular and organismal effects of 6 human disease-linked mutations, as well as the mouse legs-at-odd-angles (Loa) mutation, after introducing the mutations into the D. melanogaster dynein heavy chain (Dhc) by genome editing. This reveals an overall correlation between the severity of the effect on dynein motor activity in vitro (determined in a previous study) and the penetrance of the corresponding mutant phenotype in the fly, with a couple of interesting exceptions that illustrate the value of performing structure-function analysis of dynein in animal models. The authors then focus on an additional missense mutation in the Dhc microtubule binding domain, fortuitously generated by imprecise editing, that results in a striking phenotype. The S3372C mutation supports normal development, including normal axonal transport of mitochondria and asymmetric mitosis of larval neuroblasts, but female flies are infertile. Through elegant genetics, ectopic disulfide bond formation with a nearby residue is ruled out as the cause of the maternal effect. S3372C results in metaphase arrest of early embryonic divisions, characterized by over-accumulation of dynein light intermediate chain (Dlic) and the dynein recruitment factor Rod at kinetochores, as well as by reduced poleward streaming of Rod along spindle microtubules. Surprisingly, the S3372C-induced metaphase arrest cannot by bypassed by inhibiting the spindle assembly checkpoint, implying that dynein promotes the metaphase-to-anaphase transition not solely through its known function in spindle assembly checkpoint silencing. In vitro motility and optical trapping experiments show that the mutant motor performs normally in a load-free regime but exhibits reduced peak force production and excessive pausing under load. Furthermore, molecular dynamics simulations reveal how the mutation affects dynein's interaction with microtubules, including a change in the positioning of the stalk. The authors conclude that the S3372C mutation specifically perturbs high-load functions of dynein, explaining the selective phenotype observed in vivo.

      The experiments are technically on a very high level, the results are presented in a clear manner, and the conclusions are fully supported by the data.

      Minor suggestions (optional):

      • In the first part of the paper, where Dhc mutations associated with neurological disease are examined, the H3808P and F579/Loa mutations are shown to cause mis-accumulation of synaptic vesicles in axons. The authors may want to perform this assay for the K129I, R1557Q, and K3226T mutations, as this would strengthen the comparative analysis of in vitro versus in vivo effects, summarized in Figure 1C. For example, K129I has a more severe effect in vitro than the Loa mutation, but the Loa mutation has a more pronounced phenotype on the organismal level. Would this also be the case in a cell-based assay?
      • The observation that the metaphase arrest of S3372C mutant embryos cannot be alleviated by the checkpoint-defective Mad2 mutant is very intriguing, as is the observation that Dlic and the RZZ subunit Rod over-accumulate at/near kinetochores. As discussed by the authors, one possibility is that the arrest is a consequence of dynein's failure to disassemble the corona by stripping, but, surprisingly, in a manner unrelated to dynein's role in SAC silencing. In this regard, it is interesting to note that fly RZZ mutants do not undergo metaphase arrest in the early embryo (Williams and Goldberg, 1994; Défachelles et al., 2015), whereas knockdown of Spindly, which functions in dynein recruitment downstream of RZZ, does lead to arrest (see Figure 2 in Clemente et al., 2018; PMID 29615558). Taken together, this raises the possibility that it is the failure to remove RZZ (and other associated corona components) from kinetochores that inhibits anaphase onset in S3372C embryos. It would therefore be interesting to test whether the metaphase arrest in S3372C embryos is alleviated in RZZ mutants.

      Referees cross-commenting

      The Mad2 mutant the authors use is a P-element insertion that was described by Buffin et al 2007 as a null mutant with regards to SAC signaling (it also does not produce any detectable protein by Western blot; Figure 1b). Nevertheless, since the analysis in Buffin et al was restricted to larval brains, I agree with reviewer #2 that it remains to be formally demonstrated that this Mad2 mutant fully abolishes the SAC in the early embryo. Unfortunately, as far as I am aware, reversine does not work well in Drosophila. An alternative would be to combine Dhc(S3372C) with the other Mad2 mutant used by Buffin et al, which (besides not producing detectable protein) lacks the Mad1 binding domain and can therefore be expected to be a definitive checkpoint null in all tissues.

      Significance

      The cytoplasmic dynein 1 motor complex participates in a multitude of cellular processes that require microtubule minus-end-directed motility. Whereas in vitro reconstitution efforts have led to a detailed understanding of the motor's motile properties, the essential requirement of dynein for development has made it challenging to dissect how the motor contributes to specific aspects of intracellular organization and cell division in vivo. The need for a mechanistic understanding of how dynein motility is used for diverse functions in vivo is underscored by missense mutations in the motor subunit that cause human neurological disease. In this interesting and insightful study, Salvador-Garcia and colleagues characterize several missense mutations in dynein heavy chain (Dhc) using biochemical assays and genetic approaches is the fly, which reveals the distinct effects of disease-causing mutations in vivo and uncovers an unanticipated novel function of dynein in regulating mitotic progession.

      This beautifully executed study has important implications for dynein's role in mitosis, in particular its role at the kinetochore, and is of broad interest to cell biologists studying the cytoskeleton, as it demonstrates that examining motor mutants with altered mechanical properties in vivo can reveal specific motor functions.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Response to Reviewers

      We are grateful to the Reviewers for their insightful thoughts and suggestions for improving the manuscript for publication. We have addressed all Reviewers’ comments, and detailed responses have been provided below (in blue font). We have uploaded a revised manuscript version, and have made a few small improvements to the text to improve readability. Line and figures numbers refer to the revised version of the manuscript.

      ‘Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      In this study, Wenner et al. used various in vitro methods, including transposon mutagenesis, screening of known regulatory proteins and isolation of spontaneous mutants to discover 11 mutations in genes that promote bacterial growth under succinate-mediated inhibition. Through additional experiments, the manuscript provides evidence for factors that underlie several layers of succinate regulation. These layers include sRNAs, OxyRS, succinate transport antibiotics and rRNA. The study then characterized the molecular mechanisms regulating succinate utilization by these mutations, revealing a RpoS-independent mechanism for succinate uptake via the dctA transporter and mechanisms for RpoS regulation.

      Overall, the manuscript is very unfocused and uneven in the level of details of each of these factors and could be much more compelling if more focus was given to several factors and providing more mechanistic insight of these factors.

      We thank Reviewer #1 for the constructive criticism and suggestions. We do recognize the limitations of our study, clearly more work is required to unravel the complex phenomenon of the inhibition of succinate utilisation by Salmonella. We welcome Reviewer #1’s suggestions to shorten the manuscript, which has allowed us to focus the paper on our key findings.

      Major comments

      1. The authors discuss virulence-mediated succinate but disregard some important features of succinate utilization, only referring to dctA and disregarding the overlap with other C4-dicaroxy transporters (Spiga, wolf, PMID). Furthermore, the study found that a mutation in the IscR binding site on the DctA promoter region reversed the effects of succinate-dependent growth inhibition generated under aerobic conditions but other succinate transporters are expressed under different physiological conditions (Janausch et al. 2002, Spiga et al. 2017). Does the IscR binding site motif can be found in promoters of other succinate transporters? Analysis of IscR in aerobic/ anaerobic conditions can be useful. Do mutations in IcsR lead to increased expression of other succinate transporters in aerobic or anaerobic conditions?

      The Reviewer’s question of the regulatory role of IscR on anaerobic C4-dicarboxylate transporters is particularly relevant in the context of the role of succinate catabolism in pathogenesis and could be studied in a follow-up investigation. However, further analysis of the influence of mutations that modulate the expression or activity of IscR are beyond the scope of our study. Here, we have focused on succinate utilisation under in vitro, aerobic conditions: under these conditions, growth upon succinate is robustly repressed, allowing the selection of Succ+ mutants. To emphasise that our study was done under aerobic conditions, we have rephrased the Introduction (line 93).

      Transposon screen - There is no comprehensive description of the results and it is not clear why mutations found in the evolution experiments or regulatory proteins that were shown to allow bacteria growth under succinate treatment were not detected in the transposon screening?

      Different selection protocols were used to isolate the Succ+ mutants and the experimental approaches are detailed in the Methods and in the strain list for each mutant (Supplementary_Resource_Table S1). Selection was performed in liquid M9+Succ for Tn5 mutagenesis (in the rpoS2X background), or in solid and liquid M9+Succ media for the spontaneous mutants (the mutations are all listed and detailed in Table 1).

      Therefore, the different selection conditions and the presence of an extra rpoS copy may have favored certain mutants, especially when the pools of Tn5 mutants were grown with succinate together (mutants in competition).

      We recognize that our experimental approach had limitations, and that a Tn-seq methodology would have been more comprehensive. However, the robustness of the phenotypes of the mutants (all re-constructed and complemented, when possible) demonstrated that the genes of interest had direct impact upon the control of succinate metabolism with novel implications for the field.

      Figure 4: The authors claim: "that the fast growth of the Δhfq and Δpnp strains reflected both the dysregulation of the sRNA-mediated repression of sdh and the activation of rpoS translation". However, they provide no evidence for SDH regulation. The experiment is correlative, the activity of pnp regulating rpoS was done with overexpression without the proper controls. The authors should look at rpoS expression in Δpnp. It does not seem reasonable that transcription of SDH mRNA can explain lack of succinate utilization. What about the SDH protein? is it at all changed? The authors claim "none of the sRNA mutants tested displayed the same fast-growing pattern of the Δhfq mutant" but they action can involve completely different mechanisms, that the authors do not study. This part does not seem to contribute any novel information on Δhfq and Δpnp on Succ+ with the sRNAs seem not to provide any clear mechanism. The authors should consider removing this part or moving to supplementary.

      We appreciate this comment, and agree that this section does not provide critical novel insight. However, our findings provide valuable data concerning the role that Hfq, PNPase and sRNAs play in succinate utilisation. Therefore, we have briefly mentioned the role of Hfq, PNPase and sRNAs in the main text (Lines 333-338) and moved the original Figure 4 to the Supplementary (Figure S5), with a supplementary text section (Supplementary Text T1).

      If OxyS, an Hfq-binding sRNA, is related to Succ+ in Δhfq, then why all the other sRNAs are relevant? This is not clear. The authors could have focused here on the oxyS instead of other sRNAs. "The same plasmid did not stimulate the growth of the ΔoxyR strain indicating that a functional OxyR is required for growth in M9+Succ (Fig 5D)" - is it because of other targets of OxyR?

      The reviewer’s interpretation is correct. To clarify this point, we have rephased the sentence (Lines 274-276) to “The same plasmid did not stimulate the growth of the ∆oxyR strain indicating that other OxyR-dependent genes are required to grow under this condition”

      It seems that an RNA-seq analysis in the conditions of succinate growth with OxyRmut vs. WT could hint towards this.

      Indeed, it would be very interesting to compare the transcriptomic landscape of the WT and of the oxyRmut mutant and other Succ+ mutants in succinate minimal medium. However, the lack of growth of S. Typhimurium WT in M9+Succ, would make these experiments unlikely to succeed.

      "We previously showed that Hfq inactivation boosted succinate utilization (Fig 4A), but in the oxyRmut genetic background the same Hfq inactivation dramatically reduced growth and extended the duration of lag time in M9+Succ (Fig 5 E)"

      The reviewer is correct, we had hypothesised that Hfq is necessary to stimulate succinate utilisation by OxyS. Therefore, we have rephrased to: “We previously showed that Hfq inactivation boosted succinate utilisation, but in the oxyRmut genetic background the same Hfq inactivation dramatically reduced growth and extended the duration of lag time in M9+Succ (Fig 4E). Collectively, our findings show that the OxyS sRNA orchestrates the de-inhibition of succinate utilisation in concert with Hfq” (Lines 278-281)

      • this seems like an interesting finding, but the authors don't offer any follow-up? Is it related to oxyS activity?

      The role of Hfq on succinate utilisation appeared to be dual, we have added a sentence to this effect (Lines 335-338).

      Figure 6: "OxyS acts as an indirect repressor of RpoS expression, probably via the titration of Hfq". the yobF::sfgfp activity was significantly lower in the oxyRmut strain (~2-fold repression), confirming that OxyS represses the expression of the yobF cspC operon in Salmonella - can the authors show this directly with oxyS in succinate?

      Because Salmonella WT and ∆oxyS strains do not grow in succinate media (M9+Succ), we had to investigate the regulation of yobF-cspC operon with a translational gene fusion in non-selective LB media.

      Why use OxyRmut here? This is indirect.

      In Figure 5C we first used the oxyRmut Succ+ strain to demonstrate that this mutation leads to the repression of yobF-cspC. In Figure 6F, we used the oxyRmut allele to allow a constitutive expression of oxyS WT or oxySGG : allele oxySGG was introduced into the chromosome and relies on an active OxyR to be transcribed. The direct role of OxyS is demonstrated in Figure 5 E &F.

      The authors already show that OxyRmut does not act solely via Oxys...can the authors directly show RpoS and SDH levels by qRT-PCR in ΔcspC? Again - the appropriate control for RpoS overexpression in the WT was not done (Fig. 6G). Furthermore, expression analysis of the sdhCDAB operon over the background of the oxyR mutant will confirm the author suggestion for the mechanism by which the OxyS-driven inhibition of CspC expression impacts upon the catabolism of succinate.

      The reviewer’s comments are valid, more work is required to understand how OxyS stimulates succinate utilisation via the repression of cspC. The fact that Salmonella WT does not grow with succinate as a sole carbon source makes such comparisons technically challenging. Yes, the repressive role of CspC remains enigmatic. However, RNA-seq data following growth in LB media have already been provided by others, suggesting that CspEC may repress TCA cycle genes in Salmonella (PMID: 28611217), consistent with the repression of succinate catabolism by CspC.

      The fact that the plasmid-borne overexpression of rpoS completely represses growth upon succinate in the ∆rpoS background (Figure S3 B) validated the usage of the prpoS plasmid in other genetic backgrounds, in order to reveal whether the other Succ+ mutations were stimulating succinate utilisation via rpoS repression or not. Because WT Salmonella does not grow in M9+Succ, presenting the growth curve of the WT strain carrying the prpoS plasmid would not be informative here, and would make the figure overly complex.

      Figure 7: the authors check growth in M9+succ in the absence of DctA - but the experiment duration should be carried out for longer, as previous experiments with WT (intact dctA in Fig. 2A) and check if in the absence of dctA there are mutations that allow succinate growth.

      We agree with the reviewer’s comment and we have performed a new growth curve (over 65 hours) of the ∆dctA strain to clarify that DctA is the only succinate transporter involved in Salmonella growth under our experimental conditions (Figure S8).

      It seems that the results here contradict some of the previous - if succinate uptake through dctA is intact then there is no repression of SDH? rpoS? In figure 7E - is this difference only through dctA activity?

      The reviewer is raising an important point and it is possible that the de-repression of succinate uptake via DctA could impact upon the expression of the succinate catabolic genes and more work is required to understand this phenomenon. We have discussed this possibility in the main text (Lines 424-432) and in Figure 8C.

      It seems that icsR is not repressing dctA expression to WT levels - are there other factors? Can the authors show that dctA repression by IscR is direct?

      We agree with the reviewer, we have not shown that IscR represses dctA directly. Electrophoretic mobility shift assays could be performed to prove that IscR interacts with the dctA promoter region, but this would be beyond the scope of the paper. We have clearly stated in the discussion that indirect effects of iscR on dctA expression cannot be ruled out (Lines 419-422).

      Figure 9 is very descriptive and does not provide any evidence to support the authors hypothesis. The authors should either provide more substantial evidence connecting ribosomal RNA levels and succinate utilization and similarly Cm concentrations or either remove this part or move it to the supplementary.

      We agree that the data do not conclusively support the hypothesis, but we believe that the impact of anti-SD mutation and chloramphenicol on Salmonella carbon metabolism are valuable observations for the community. Therefore, we have moved the data to supplementary Figures S11 and S12 in the revised version, with a supplementary text section (Supplementary Text T2). We also removed this aspect from the model Figure (Figure 8) and only mentioned the phenomenon briefly in the main text, Lines 482-485.

      Can any of the mutations characterized in this work be found in the genome of Newport or LT2 strains that can grow with succinate as a sole carbon source? (Fig 1)

      Very good questions. Yes, S. Typhimurium strain LT2 has an altered rpoS allele that attenuates virulence of the strain in the murine infection model (PMID: 8975913) and promotes growth with succinate (PMID: 33593945). We have added a sentence and cited the reference at Lines 129-131.

      To address the S. Newport question, we performed an analysis of the genome of the S. Newport strain LSS-48, and did not identify any mutations in regulatory or catabolic genes that could explain the faster growth on M9+succinate. However, in comparison with fast-growing enteric bacteria (i.e. E. coli MG1655) or Succ+ S. Typhimurium mutants, S. Newport LSS-48 grows much slower on succinate and has an intermediate growth phenotype. It remains unclear why S. Newport does grow better than other serovars.

      Although the author suggested that regulation of succinate uptake is critical for Salmonella colonization and virulence in various metabolic conditions, the study lacks sufficient evidence to support these claims and further research is necessary to establish these statements.

      We agree that our findings are not directly linked to Salmonella host colonisation or virulence. However, we do believe that our study will contribute to a better understanding of Salmonella metabolic control, in the context of pathogenesis. To address Reviewer #3’s comment, we have moderated our claims about the likely impact of our findings on the understanding of Salmonella pathogenesis in the Perspective section.

      Minor comments

      1. Table summarizing the growth curves lag phase of the different mutants might help in the data interpretation.

      We appreciate the Reviewer’s suggestion and have prepared a supplementary figure (Figure S4) indicating the average lag time of the Succ+ mutants and of the complemented mutants.

      In lines 245-248 the author describes the eleven novel Succ+ mutations however in this gene list only ten gene names are mentioned. DctA is missing from this list.

      We appreciate the Reviewer’s comment and we have modified the sentences in the revised manuscript (Line 244).

      ** Referees cross-commenting**

      I agree with both reviewer that there is a large amount of data in the paper, and willing to accept their point that asking for further experiments would exceed the scope of the paper. In that case, the authors should address the mechanistic options in the discussion

      Reviewer #1 (Significance (Required)):

      In this work, Wenner et al. characterized the molecular mechanisms regulating Salmonella growth inhibition when succinate is the sole carbon source in the culture. This work revealed new layer of regulations for rpoS activation, the sigma factor previously characterized to control this growth inhibition mechanism. In addition, this work revealed novel RpoS-independent mechanisms for succinate utilization and highlighted the crucial role of succinate processing in Salmonella physiology.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      In the manuscript titled "Salmonella succinate utilisation is inhibited by multiple regulatory systems", Wenner et al., explored how Salmonella regulates the utilization of succinate, an important carbon source for Salmonella gut colonization as well as a molecule that regulates intracellular adaptation in the SCV. As Salmonella exhibits a slow growth rate when succinate is provided as the sole carbon source, the authors explored the underlying genetic regulation by isolating fast-growing mutants (Succ+) using an experimental evolution approach. By combining the screen for mutants lacking key regulatory proteins, an elegantly designed Tn5 transposon mutagenesis, and selection of spontaneous Succ+ mutants, the authored identified a library of mutations that led to the Succ+ phenotype. Using classical bacterial genetics, Wenner et al characterized how Hfq, PNPase and cognate sRNA inhibit succinate utilization. They went on to show, clearly and convincingly, that IscR inhibits growth upon succinate by repressing DctA expression, and succinate utilization can also be repressed by RbsR and FliST via RpoS. Lastly, they provided evidence supporting that anti-Shine-Dalgarno mutations and low concentrations of chloramphenicol can boost succinate utilization. Overall, this paper is well written, and the experiments were rigorously designed and executed. This is a beautiful example of deciphering complex regulatory nodes in the succinate utilization using elegant genetics approaches. Very nicely done!

      We thank the Reviewer #2 for the very positive evaluation of our work and the constructive comments.

      Minor issues:

      1. While rpoS2X strain is an clever way to avoid the selection of Succ+ rpoS mutants, it is unclear why "identified an iraP::Tn5 mutant was an effective validation of the use of the rpoS2X genetic background". IraP stabilizes Rpos, and this mutant could have been selected in the wild-type background (rpoS1X).

      The reviewer’s comment is helpful, we have removed this sentence from the revised manuscript.

      The description between line 356-357 is confusing as it reads like the author constructed a "oxyRmut oxySGG pPL-OxySGG" strain, while the experiments that followed actually used a " ∆oxyS, yobF::sfgf, pPL-OxySGG" strain.

      We have modified these sentences in the revised manuscript (Lines 303-308).

      An alternative explanation for the Succi+ phenotype in aSD mutant and bacteria treated with low Cm is the reduced translation fidelity, which leads to selectively degradation of inhibitors of succinate utilization.

      We thank Reviewer #2 for the suggestion. This phenomenon is really enigmatic and as previously discussed in Reviewer #1’s section, we have now moved Figure 9 to supplementary data. Further discussion of how the aSD mutations and chloramphenicol can affect Salmonella succinate metabolism would require a lot more experimental data.

      ** Referees cross-commenting**

      Most of the comments from Reviewer 1 are valid but excessive. Most of the experiments presented in this paper were rigorously controlled and executed. While some parts of the paper could be more mechanistic but they could also leave room for future studies. Also, some of the points raised, the 1st major concern, for example, may have exceeded the scope of the paper.

      We agree. We have performed a new experiment (Figure S8) to address Reviewer #1’s comments.

      Reviewer #2 (Significance (Required)):

      Overall, this paper is well written, and the experiments were rigorously designed and executed. This is a beautiful example of deciphering complex regulatory nodes in the succinate utilization using elegant genetics approaches.

      We appreciate Reviewer #2’s feedback that the quality of the text and our experiments was viewed so highly.

      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      In this work, Wenner and colleagues use experimental evolution to define a range of spontaneous mutations in Salmonella that allow it to overcome its aversion to using succinate as a carbon source in vitro.

      This work cites the literature extensively and the scholarship is very very good. I appreciate the effort they put into the manuscript, which made it easy to read. Quite a relief to get a paper in this good of shape compared to most.

      We appreciate Reviewer #3’s positive comments on our work and the constructive suggestions.

      Shortcomings - although I don't think they are necessary for *this* paper to be published include:

      • not defining what could be 'bad' about eating succinate in the wrong place. The fact that succinate import is a problem (dctA is what is being regulated ant its a transporter) suggests one of the following: (1) excess succinate would block the utilization of fumarate by fumarate reductase, (2) succinate is a powerful buffer and, if protonated, would acidify the cytoplasm of Salmonella if it were brought in - note that there is a lot of work on RpoS controlling cytoplasmic acidification, (3) a drop in succinate (because Salmonella eats it) would allow more flux by macrophages or the microbiota in a bad way...maybe the Salmonella 'wants' macrophages to have lots of succinate *because* its pro-inflammatory (and therefore more tetrathionate for its friends...etc), (4) it could be the transporter that also bring in antimicrobial itaconate?...so the succinate phenotype is a red herring and really this is about preventing taconite from getting into the cell?

      We thank the reviewer for all these suggestions and for highlighting the reasons why the avoidance of Salmonella utilising succinate is a key point. We have emphasized this key question to conclude our manuscript (Lines 500-501). Whilst all the hypotheses are valid, we believe that further speculation should not be added to the “Perspective” section.

      • no proof that any of this is relevant in infection except citing old papers. Again - this work is already VERY expansive and we could propose experiments until the end of time. Next paper should take the dctA and other mutations and put them into mice to see if they fail in either germ free mice (no microbial produced succinate around) or in systemic infections.

      The reviewer’s comment is welcomed. As discussed in our response to Reviewer #1, we have scaled back our discussion of the impact of our findings for the understanding of Salmonella pathogenesis*. *

      Most of the mutations they find are 'regulatory' and the only proximal effector of succinate utilization seems to be dctA...suggesting that dctA expression is the 'rate limiting' or 'blocked' step that decides whether succinate is being used or not.

      We agree that dctA regulation is a central element of the story. As discussed in Reviewer #1 comments, it is not clear how de-repression of dctA leads to the increased catabolism of succinate in the presence of RpoS (particularly because RpoS represses several succinate catabolic genes, PMID: 24810289 and PMID: 25578965). We also discovered other Succ+ mutants that did not affect DctA expression but stimulated growth on succinate as a sole carbon source. Consequently, it is uncertain whether the uptake of succinate is really the limiting factor. We have added sentences about this paradox, Lines 424-432.

      The data is extensive and generally well controlled. Where appropriate they either complement mutations or reconstruct them denovo. The findings of the various genes range in novelty but many are new.

      ** Referees cross-commenting**

      I agree that the work was valid and well controlled. The 'story' was a bit disjointed at times primarily because the range of mutations identified were diverse and pleiotropic. Given the large amount of data already in the paper and the nature of the mutations identified I worry about embarking on an endless cycle of new experiments. I think it's at a publishable stopping point.

      In response to Reviewer #3 & #1’s comments, we have now improved the flow of the manuscript.

      Reviewer #3 (Significance (Required)):

      This seemingly mundane phenotype (Salmonella 'choosing' to not use succinate even though it's perfectly capable of doing so) has been known for years but only recently has its potential relevance become more clear in the context of infection and microbiota metabolism.

      The authors propose that succinate utilization is to be used at the right time and right place.

      I sympathize with the authors that they keep hitting very pleiotropic regulators (RpoS has ten million upstream inputs and outputs. The ribosome? How is that going to be figured out in one or two simple experiments?). My money is on figuring out exactly how dctA is regulated and whether there's differences in the dctA regulation between E. coli and Klebsiella/Salmonella.

      So I think the work is extensive and generally well done. I think the paper will be well cited...and I think it's importance will grow over time and it will continue to be relevant years from now. I can't say that about most work in the field.

      We agree with Reviewer #3’s assessment that other scientists in the Salmonella field are likely to cite our paper, and to perform experiments that will build on our findings in the future.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In this work, Wenner and colleagues use experimental evolution to define a range of spontaneous mutations in Salmonella that allow it to overcome its aversion to using succinate as a carbon source in vitro.

      This work cites the literature extensively and the scholarship is very very good. I appreciate the effort they put into the manuscript, which made it easy to read. Quite a relief to get a paper in this good of shape compared to most.

      Shortcomings - although I don't think they are necessary for this paper to be published include:

      • not defining what could be 'bad' about eating succinate in the wrong place. The fact that succinate import is a problem (dctA is what is being regulated ant its a transporter) suggests one of the following: (1) excess succinate would block the utilization of fumarate by fumarate reductase, (2) succinate is a powerful buffer and, if protonated, would acidify the cytoplasm of Salmonella if it were brought in - note that there is a lot of work on RpoS controlling cytoplasmic acidification, (3) a drop in succinate (because Salmonella eats it) would allow more flux by macrophages or the microbiota in a bad way...maybe the Salmonella 'wants' macrophages to have lots of succinate because its pro-inflammatory (and therefore more tetrathionate for its friends...etc), (4) it could be the transporter that also bring in antimicrobial itaconate?...so the succinate phenotype is a red herring and really this is about preventing taconite from getting into the cell?
      • no proof that any of this is relevant in infection except citing old papers. Again - this work is already VERY expansive and we could propose experiments until the end of time. Next paper should take the dctA and other mutations and put them into mice to see if they fail in either germ free mice (no microbial produced succinate around) or in systemic infections.

      Most of the mutations they find are 'regulatory' and the only proximal effector of succinate utilization seems to be dctA...suggesting that dctA expression is the 'rate limiting' or 'blocked' step that decides whether succinate is being used or not.

      The data is extensive and generally well controlled. Where appropriate they either complement mutations or reconstruct them denovo. The findings of the various genes range in novelty but many are new.

      ** Referees cross-commenting**

      I agree that the work was valid and well controlled. The 'story' was a bit disjointed at times primarily because the range of mutations identified were diverse and pleiotropic. Given the large amount of data already in the paper and the nature of the mutations identified I worry about embarking on an endless cycle of new experiments. I think it's at a publishable stopping point.

      Significance

      This seemingly mundane phenotype (Salmonella 'choosing' to not use succinate even though it's perfectly capable of doing so) has been known for years but only recently has its potential relevance become more clear in the context of infection and microbiota metabolism.

      The authors propose that succinate utilization is to be used at the right time and right place.

      I sympathize with the authors that they keep hitting very pleiotropic regulators (RpoS has ten million upstream inputs and outputs. The ribosome? How is that going to be figured out in one or two simple experiments?). My money is on figuring out exactly how dctA is regulated and whether there's differences in the dctA regulation between E. coli and Klebsiella/Salmonell.

      So I think the work is extensive and generally well done. I think the paper will be well cited...and I think it's importance will grow over time and it will continue to be relevant years from now. I can't say that about most work in the field.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      In the manuscript titled "Salmonella succinate utilisation is inhibited by multiple regulatory systems", Wenner et al., explored how Salmonella regulates the utilization of succinate, an important carbon source for Salmonella gut colonization as well as a molecule that regulates intracellular adaptation in the SCV. As Salmonella exhibits a slow growth rate when succinate is provided as the sole carbon source, the authors explored the underlying genetic regulation by isolating fast-growing mutants (Succ+) using an experimental evolution approach. By combining the screen for mutants lacking key regulatory proteins, an elegantly designed Tn5 transposon mutagenesis, and selection of spontaneous Succ+ mutants, the authored identified a library of mutations that led to the Succ+ phenotype. Using classical bacterial genetics, Wenner et al characterized how Hfq, PNPase and cognate sRNA inhibit succinate utilization. They went on to show, clearly and convincingly, that IscR inhibits growth upon succinate by repressing DctA expression, and succinate utilization can also be repressed by RbsR and FliST via RpoS. Lastly, they provided evidence supporting that anti-Shine-Dalgarno mutations and low concentrations of chloramphenicol can boost succinate utilization. Overall, this paper is well written, and the experiments were rigorously designed and executed. This is a beautiful example of deciphering complex regulatory nodes in the succinate utilization using elegant genetics approaches. Very nicely done!

      Minor issues:

      1. While rpoS2X strain is an clever way to avoid the selection of Succ+ rpoS mutants, it is unclear why "identified an iraP::Tn5 mutant was an effective validation of the use of the rpoS2X genetic background". IraP stabilizes Rpos, and this mutant could have been selected in the wild-type background (rpoS1X).
      2. The description between line 356-357 is confusing as it reads like the author constructed a "oxyRmut oxySGG pPL-OxySGG" strain, while the experiments that followed actually used a " ∆oxyS, yobF::sfgf, pPL-OxySGG" strain.
      3. An alternative explanation for the Succi+ phenotype in aSD mutant and bacteria treated with low Cm is the reduced translation fidelity, which leads to selectively degradation of inhibitors of succinate utilization.

      ** Referees cross-commenting**

      Most of the comments from Reviewer 1 are valid but excessive. Most of the experiments presented in this paper were rigorously controlled and executed. While some parts of the paper could be more mechanistic but they could also leave room for future studies. Also, some of the points raised, the 1st major concern, for example, may have exceeded the scope of the paper.

      Significance

      Overall, this paper is well written, and the experiments were rigorously designed and executed. This is a beautiful example of deciphering complex regulatory nodes in the succinate utilization using elegant genetics approaches.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      In this study, Wenner et al. used various in vitro methods, including transposon mutagenesis, screening of known regulatory proteins and isolation of spontaneous mutants to discover 11 mutations in genes that promote bacterial growth under succinate-mediated inhibition. Through additional experiments, the manuscript provides evidence for factors that underlie several layers of succinate regulation. These layers include sRNAs, OxyRS, succinate transport antibiotics and rRNA. The study then characterized the molecular mechanisms regulating succinate utilization by these mutations, revealing a RpoS-independent mechanism for succinate uptake via the dctA transporter and mechanisms for RpoS regulation.

      Overall, the manuscript is very unfocused and uneven in the level of details of each of these factors and could be much more compelling if more focus was given to several factors and providing more mechanistic insight of these factors.

      Major comments

      1. The authors discuss virulence-mediated succinate but disregard some important features of succinate utilization, only referring to dctA and disregarding the overlap with other C4-dicaroxy transporters (Spiga, wolf, PMID). Furthermore, the study found that a mutation in the IscR binding site on the DctA promoter region reversed the effects of succinate-dependent growth inhibition generated under aerobic conditions but other succinate transporters are expressed under different physiological conditions (Janausch et al. 2002, Spiga et al. 2017). Does the IscR binding site motif can be found in promoters of other succinate transporters? Analysis of IscR in aerobic/ anaerobic conditions can be useful. Do mutations in IcsR lead to increased expression of other succinate transporters in aerobic or anaerobic conditions?
      2. Transposon screen - There is no comprehensive description of the results and it is not clear why mutations found in the evolution experiments or regulatory proteins that were shown to allow bacteria growth under succinate treatment were not detected in the transposon screening?
      3. Figure 4: The authors claim: "that the fast growth of the Δhfq and Δpnp strains reflected both the dysregulation of the sRNA-mediated repression of sdh and the activation of rpoS translation". However, they provide no evidence for SDH regulation. The experiment is correlative, the activity of pnp regulating rpoS was done with overexpression without the proper controls. The authors should look at rpoS expression in pnp. It does not seem reasonable that transcription of SDH mRNA can explain lack of succinate utilization. What about the SDH protein? is it at all changed? The authors claim "none of the sRNA mutants tested displayed the same fast-growing pattern of the Δhfq mutant" but they action can involve completely different mechanisms, that the authors do not study. This part does not seem to contribute any novel information on Δhfq and Δpnp on Succ+ with the sRNAs seem not to provide any clear mechanism. The authors should consider removing this part or moving to supplementary.
      4. If OxyS, an Hfq-binding sRNA, is related to Succ+ in Δhfq, then why all the other sRNAs are relevant? This is not clear. The authors could have focused here on the oxyS instead of other sRNAs. "The same plasmid did not stimulate the growth of the ΔoxyR strain indicating that a functional OxyR is required for growth in M9+Succ (Fig 5D)" - is it because of other targets of OxyR? It seems that an RNA-seq analysis in the conditions of succinate growth with OxyRmut vs. WT could hint towards this. "We previously showed that Hfq inactivation boosted succinate utilization (Fig 4A), but in the oxyRmut genetic background the same Hfq inactivation dramatically reduced growth and extended the duration of lag time in M9+Succ (Fig 5 E)" - this seems like an interesting finding, but the authors don't offer any follow-up? Is it related to oxyS activity?
      5. Figure 6: "OxyS acts as an indirect repressor of RpoS expression, probably via the titration of Hfq". the yobF::sfgfp activity was significantly lower in the oxyRmut strain (~2-fold repression), confirming that OxyS represses the expression of the yobF cspC operon in Salmonella - can the authors show this directly with oxyS in succinate? Why use OxyRmut here? This is indirect. The authors already show that OxyRmut does not act solely via Oxys...can the authors directly show RpoS and SDH levels by qRT-PCR in ΔcspC? Again - the appropriate control for RpoS overexpression in the WT was not done (Fig. 6G). Furthermore, expression analysis of the sdhCDAB operon over the background of the oxyR mutant will confirm the author suggestion for the mechanism by which the OxyS-driven inhibition of CspC expression impacts upon the catabolism of succinate
      6. Figure 7: the authors check growth in M9+succ in the absence of DctA - but the experiment duration should be carried out for longer, as previous experiments with WT (intact dctA in Fig. 2A) and check if in the absence of dctA there are mutations that allow succinate growth. It seems that the results here contradict some of the previous - if succinate uptake through dctA is intact then there is no repression of SDH? rpoS? In figure 7E - is this difference only through dctA activity? It seems that icsR is not repressing dctA expression to WT levels - are there other factors? Can the authors show that dctA repression by IscR is direct?
      7. Figure 9 is very descriptive and does not provide any evidence to support the authors hypothesis. The authors should either provide more substantial evidence connecting ribosomal RNA levels and succinate utilization and similarly Cm concentrations or either remove this part or move it to the supplementary.
      8. Can any of the mutations characterized in this work be found in the genome of Newport or LT2 strains that can grow with succinate as a sole carbon source? (Fig 1)
      9. Although the author suggested that regulation of succinate uptake is critical for Salmonella colonization and virulence in various metabolic conditions, the study lacks sufficient evidence to support these claims and further research is necessary to establish these statements.

      Minor comments

      1. Table summarizing the growth curves lag phase of the different mutants might help in the data interpretation.
      2. In lines 245-248 the author describes the eleven novel Succ+ mutations however in this gene list only ten gene names are mentioned. DctA is missing from this list.

      ** Referees cross-commenting**

      I agree with both reviewer that there is a large amount of data in the paper, and willing to accept their point that asking for further experiments would exceed the scope of the paper. In that case, the authors should address the mechanistic options in the discussion

      Significance

      In this work, Wenner et al. characterized the molecular mechanisms regulating Salmonella growth inhibition when succinate is the sole carbon source in the culture. This work revealed new layer of regulations for rpoS activation, the sigma factor previously characterized to control this growth inhibition mechanism. In addition, this work revealed novel RpoS-independent mechanisms for succinate utilization and highlighted the crucial role of succinate processing in Salmonella physiology.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      __Reviewer #1 (Evidence, reproducibility and clarity (Required)): __

      The manuscript investigates the role of PAT1 gene family in Arabidopsis thaliana. Though the PAT1 protein has been previously investigated and displayed immune-related and developmental phenotypes, the other two members of the family, PATH1 and PATH2, have not been well studied. The authors set out to understand the role of these proteins in relation to the role of PAT1. They thus generated single, double, and triple mutants of the possible combinations of PAT1 genes and examined their phenotypes. As the study focused on the developmental effects of PAT1, the mutants were generated on the background of the summ2 mutant to avoid phenotypes related to immune response. The authors notice a developmental difference between the pat1 mutant combinations, suggesting that PAT1 acts differently than PATH1 and PATH2 and that the PATH proteins serve a redundant function. They also performed RNA-seq analysis to identify differentially-regulated genes in the mutant combinations. The study is interesting and well-executed, yet I believe some questions should still be addressed:

      __Our response: __We thank the reviewer for acknowledging the significance of our findings. Please see our detailed answers to the reviewer’s suggestions in the following.

      1. The research mainly focuses on the developmental phenotype of pat mutants but also tests the interaction of PATH proteins with RNA decapping enzymes to check their function and localization during different treatments. I found it a bit confusing since Figure 1 also shows the developmental phenotype of the mutants. I think editing the order of the figures would make the overall story more coherent.

      __Our response: __We agree with the reviewer thus we moved old Fig 1C to new Fig 3A, we believe the new figure orders make the overall story more coherent.

      My main concern is the correlation between the developmental phenotype of the mutants and the gene expression. Leaf samples for RNA extraction were taken when the plants were 6 weeks old, and the developmental phenotype is very evident. It is thus not possible to tell whether the differences in gene expression are a cause or effect of the developmental phenotype. I think performing qPCR of selected candidates at earlier developmental times might help solve this issue, as well as the characterization of younger plants for the developmental phenotypes (such as leaf number).

      __Our response: __We followed the reviewer’s suggestions and performed qRT-PCR on IAA19, IAA29, SAUR23 and PIL2 in pats mutants under different developmental stages (Line 162, 169; Fig S4), we also characterized leaf number of pats mutants from younger stages (Line 109; new Fig 3C).

      Overall, the manuscript is missing data regarding replicate numbers in the IP and confocal microscopy experiments.

      __Our response: __We thank the reviewer for pointing this it out, the replicate numbers are provided now in our new figure legends.

      Minor comments:

      1. Figure 1C - the authors should add a picture of Col0 plants as well as the mutants.

      Our response: To be reader friendly, the picture of Col-0 plant is added in Fig S1A. For the reviewer’s information, plant pictures in FigS1A and old Fig1C (new Fig 3A) were taken at the same time. 2.

      Figure 3 - Calculating the leaf-to-petiole ratio in the different mutants would be good.

      Our response: We now calculate PBR (petiole blade ratio) of all pats mutants in Fig3F (Line 121).

      Figure 4 - the details in the figure are very unclear, especially in the PCA. It would be good to display the data in 2D for PC1 and PC3 and change the colors a bit.

      Our response: We agree with the reviewer; thus, we remade the PCA plot from RNA-seq reads data in a 2D style and also changed the colors for each mutant (Fig 4A). We need to point out that the PCs number also changed because the old PCA plot were made by mistake from expression data.

      Reviewer #1 (Significance (Required)): Both PATH proteins have been less investigated than PAT1, and in that sense, the work is novel. However, it seems that most of the phenotype is attributed to PAT1 rather than the other family members, limiting the interest to the broad plant science community.

      Our response: We appreciate the reviewer think our work is novel. We agree that PAT1 plays the main role during plant development (old Line 171), however the pat triple mutant exhibit the most severe dwarfism as well as the most mis-regulated genes compared to any single or double mutants, indicating all 3 PATs are essential for development.

      __Reviewer #2 (Evidence, reproducibility and clarity (Required)): __

      Zuo et al., characterize the role of three cytoplasmic mRNA-decay activator proteins PAT1, PATH1 and PATH2 in the context of plant development and leaf morphology in Arabidopsis thaliana and Nicotiana benthamiana. The authors show that the triple pat mutant displays the most severe dwarfism of all combinatorial mutants. Through treatment with different stimulants the authors found that only IAA treatment induces the three homologues to form condensates (possibly PBs), while PAT1 forms condensates upon every tested stimulus. An extensive RNA seq experiment revealed miss-regulation of several hundred genes in the higher order mutants, several of which were involved in auxin responsive and leaf morphology determinant genes.

      __Our response: __We thank the reviewer for the peer review. Please see our detailed answers to the reviewer’s suggestions in the following.

      Major points: 1.Title is not meaningful as is and, in my opinion, does not reflect the main findings in the manuscript.

      Our response: We now changed our title into “PAT mRNA decapping factors are required for proper development in Arabidopsis”.

      The results section could benefit from improved flow between the paragraphs and more reasoning for the next steps taken to help readers understand the aims of the authors.

      Our response: We followed the reviewer’s suggestion and modified the wording in our result part(Line 79,81,94,146-151).

      L46: "So far little is known about the functions of these three PATs in plant development.", The authors themselves have studied these proteins in the context of seed germination and ABA control, as well as apical hook formation and auxin responses. Should at least be mentioned and the results discussed in this context.

      Our response: We thank the reviewer for noticing our other work and we now included this information in the new introduction and discussion part (Line56&237).

      What are the expression levels and patterns of PATH1 and PATH2 compared to PAT1? Is anything known about spatial or temporal regulation of these proteins?

      Our response: All three PATs are expressed in roots, stems, leaves, flowers, siliques, and seeds during the whole developmental stages, PAT1 has higher expression level in leaves but lower expression levels in petals. (Klepikova et al., 2016;

      https://www.arabidopsis.org/servlets/TairObject?id=138009&type=locus for PAT1; https://www.arabidopsis.org/servlets/TairObject?id=38646&type=locus for PATH1 and https://www.arabidopsis.org/servlets/TairObject?id=128694&type=locus for PATH2).

      Figure 1:

      o I do not agree that the authors have shown that "PATH1 and PATH2 are also mRNA decapping factors", rather that these proteins can co-localize (and possibly interact) with LSM1. Decapping assays for example with the known PAT1 de-capping targets from their previous work and their extensive mutant collection could be used to test this.

      Our response: We thank the reviewer for pointing it out and reminding us about the characterized mRNA decapping target from our previous work, we now include the decapping assays in new Fig5 (Line 197).

      From the BiFC experiment (Figure 1B) it looks like PATs are mostly soluble in the cytoplasm (like LSM1) and might be stress-induced components of PBs (like LSM1). Do PATs co-localize with other canonical PB markers that are more prone to condensation, like DCPs or VCS? BiFC could be performed after IAA treatment to confirm that the cytoplasmic foci are indeed LSM1-positive PBs.

      Our response: We agree with the reviewer that PATs behave more like LSM1. Given time limit of the project, we unfortunately are not able to check the colocalization of PATs with DCPs or VCS. However, we performed BIFC after IAA treatment, and the cytoplasmic foci are indeed LSM1-positive foci (new Fig1B).

      A: please provide uncropped images of all Western blots in supplemental data.

      Our response: To be reader friendly, we decide to show the original western blots here (see in the file named "RC-Full-revision"), instead of in supplemental data. However, we will leave the final decision to the editor.

      I applaud the authors for establishing this great higher order mutant collection that will be very useful for researchers in the field. However, I am confused about the description of these mutants. If I understood it correctly, these mutants were already used in a previous study by the authors, namely “Zuo, Z., et al., Molecular Plant-Microbe Interactions, 35(2), 125-130.” & Zuo, Z., et al., (2021). FEBS letters, 595(2), 253-263.” In this study the authors refer to a BioRxiv “Zuo, Z., et al., (2019).” As the reference for these Arabidopsis lines. Is this current manuscript a continuation of the BioRxiv? Please elaborate whether these lines have been used and described In previous studies.

      Our response: We truly appreciate the reviewer for acknowledging the significance of our work. These pats mutants have been used in the FEBS letters paper (2021), MPMI paper (2022), and the new published paper in Life Science Alliance (2023, but preprinted in BioRxiv 2019 and 2022). However, they have not been fully described or characterized in any of the mentioned published stories. Characterization of these pats mutants were originally only included in preprint 2019 which was cited in FEBS letters paper (2021) and MPMI paper (2022).

      L72: Is the strong developmental phenotype of the higher order mutants persistent under long day conditions? Considering the strong developmental phenotypes of the mutants, the flowering transition and morphology could be an interesting trait to study. Why did you choose short day conditions for this study?

      Our response: The pat triple mutant also has strong developmental phenotype under long day condition and exhibits early flowering phenotype. We are currently preparing a manuscript regarding mRNA decay and flowering. We did not “choose” short day condition, we just started with short day condition and observed phenotypical differences hence we kept this condition.

      L78: This statement is hard to see in Figure 1C and best described for Figure 3A.

      Our response: We now change this statement for Fig 3.

      L82: Please include a reasoning for testing PATs localization after hormone treatment. Do you have any indication that other PB proteins behave similar to either PAT1 or the PATHs after hormone treatment to substantiate that these foci observed are indeed PBs? What is known about PBs after hormone treatment in planta?

      Our response: We were interested in investigating if all three PAT proteins may also form PBs in Arabidopsis thus we tested PATs localization with/without hormone treatment (old Line 84, new line 81). For the reviewer’s interest we also observe LSM1 localization after hormone treatment (Fig 2). PBs have been published to respond to light, cold treatment, PAMPs, ABA, ACC and auxin (Line 39-42).

      Figure 2:

      o How does the localization of LSM1 change under the same treatments? Does ist behave like PAT1 or the homologues?

      Our response: Please see our new Fig 2 for LSM1 localization, and it behaves more like PAT1.

      Which part of the root was imaged for this experiment? Is it possible that the observed foci are ARF-condensates as reported by Jing et al., 2022? Do you observe a gradual change in numbers or morphology along the root?

      Our response: We use root elongation zone for this experiment. We don’t know if the foci are ARF-condensates, but it’s possible to study in the future. If the reviewer is interested, we are happy to share our materials. We do observe more foci in the cell division zone and less in the mature zone.

      How did the authors decide on the concentrations for the stimulant treatments? Have you tried different doses, and could the responses be dose-dependent?

      Our response: We did not try different doses; we searched for and applied the commonly used concentrations for different hormones.

      A representative image is not sufficient for quantitative responses, like RNA granule condensation. Please provide a quantification of stimulant-induced foci after the different treatments.

      Our response: Please see the quantification in our new Fig 2.

      L91: Does that mean that most co-precipitated signal comes from the soluble fraction and not PB-localized? Would an RNAse treatment step eliminate the co-precipitation (optional)?

      Our response: We believe it means LSM1 and PATs are in the same complex regardless of PB localization.

      L92/93: Or alternatively that PAT1 localizes to PBs independent of the stress, while PATHs are signal-specific PB components?

      Our response: We think PAT1 aggregates upon broad stimuli/stress, while PATHs respond to specific/limited stimuli, for example, auxin.

      Figure 3:

      o I wonder if these results fit better in conjunction with Figure 1, either as a combined figure or move before Figure 2.

      Our response: We agree with the reviewer thus we moved old Fig 1C into Fig 3.

      It is interesting that path2/pat1, while being dwarfed, is less serrated compared to pat1 or path1/pat1. Can you find any indications in your RNAseq set which genes might be involved?

      Our response: ANAC016 might be involved, but more research needs to be done to confirm it and this is not the focus of the current project.

      Indicate statistical test used to determine p-value

      Our response: We now indicate the statistic test in Materials and Methods part (Line 369).

      L116/L117: Doesn't the result in Figure 3E indicate that PATH1 and PATH2 are not fully redundant, but that PATs have specific and narrow roles in leaf development? L116 goes against your statement in L150 & L160. What is known about the expression patterns of PAT1, PATH1 and PHATH2?

      Our response: We agree and thus modified our statement (Line 137). All three PATs are expressed in roots, stems, leaves, flowers, siliques, and seeds during the whole developmental stages. Please also see our answer to major comment #4.

      L123: PC3 only explains 0.55% of the variance, so differences along this axis will be overinflated. In my interpretation the pat1/path2 mutant is clustering apart from the other higher order mutants, which is also reflected in the leaf phenotypes. A 2D PCA would be sufficient to describe most of the variation.

      Our response: We agree and thus we changed the PCA plot into a 2D style, please also see our response to reviewer 1 minor comment #3.

      Figure 4: o A: The 3D-PCA inflates the differences between higher order mutants along PC3, even though this axis explains only 0.55% of the variance, maybe a 2D-PCA would more intuitively cluster the samples together?

      Our response: Please see our new PCA plot in Fig4A.

      B: Please explain the scale in the figure legend and which genes were included? Only DEGs between triple mutant and summ2-8 or DEGs that were different in at least one higher order mutant?

      Our response: We now explained more details in the figure legends. The genes which were included in Fig4B were DEGs that were differently expressed in at least one of the pat mutants.

      C: several comparisons are missing from the upset-plot. Please show the complete plot, also is there a white box laid over the second bar in the upper graph? It would help the reader, if the results section would explain the plots and the comparisons took. Which differences are the authors interested in?

      Our response: We covered all the comparisons we wanted to show, but we thank the reviewer for suggesting a more detailed explanation and we therefore explain Fig4C more in detail in Line 146. There is no white box over the second bar, it’s only 1 gene mis-regulated specifically by PATH1 (mis-regulated in plants with path1 mutation).

      From Figure 4B, the triple mutant has an almost inverted expression of mis-regulated genes. High expression genes are now lowly expressed and vice-versa. Has this been reported for other RNA decay mutants before?

      Our response: Our RNA-seq data indicate the pat tripe mutant has more than 1000 mis-regulated genes and based on microarray data on 2-week-old lsm1alsm1b plants (Perea-Resa et al, 2012), more than 600 genes are misregulated in lsm1alsm1b mutant.

      How do you explain that mutants in RNA decay have a large group of repressed transcripts and a large group of enriched transcripts? Wouldn't you suspect a general higher expression in RNA decay mutants or which kind of feedback loop would you propose is happening here? Also, since both kinds of expression changes are recorded in your RNA seq can you speculate on the specificity? Why are some genes up- and others downregulated? Would you suspect that transcription factors are under PATs control?

      Our response: We assume that the mRNA decapping machinery target genes should accumulate in mRNA decapping mutants, pat mutants in our case. On the other hand, the down-regulated genes could be target genes of other mRNA degradation pathways such as exosome pathway (Line 257); We agree with the reviewer that the down regulated genes in pat triple could also be negatively regulated by the mRNA decapping targets which could be transcription factor genes. For example, our previous research indicates the transcription factor gene ASL9/LBD3 is mRNA decapping targets under PATs control.

      Where is the sequencing data deposited? This dataset can be of great value for researchers in the field, but the raw data needs to be made commonly available.

      Our response: We thank the reviewer for acknowledging the significance of our work. The raw data has been submitted to NCBI, accession number is PRJNA1006171(Line 307)

      Minor points:

      1. Check order and nomenclature for protein / gene names in Abstract and Introduction

      Our response: We now carefully double check the order and nomenclature for protein / gene names in abstract and introduction (Line 8,11,14,18,19,24)

      L26 / L83 "aggregate" implies non-functionality, I would use "concentrate", "condensate" or "accumulate".

      Our response: We thank the reviewer for pointing it out, we now use “concentrate” (Line 29&80)

      L35, L45 & L54 all state the same. Maybe remove at least one mention to reduce redundancy?

      Our response: We modified these statements hopefully in a satisfactory way. (Line 56)

      L211: Did you use the same imaging settings for all lines?

      Our response: We used the same settings for all the lines and treatment (Line 284)

      L217: RNA quality "control" word missing?

      Our response: The word “control” is added in Line 296

      L477: Authors should cite the newest version of their BioRxiv: Zuo, Z., Roux, M. E., Chevalier, J. R., Dagdas, Y. F., Yamashino, T., H�jgaard, S. D., ... & Petersen, M. (2022). The mRNA decapping machinery targets LBD3/ASL9 to mediate apical hook and lateral root development in Arabidopsis. bioRxiv, 2022-07.

      Our response: The latest version is cited in our new manuscript (Line 42)

      Figure 3B-F, Figure 4C: check spelling on the axis titles.

      Our response: We carefully checked the spelling on the axis titles in our new manuscript.

      Reviewer #2 (Significance (Required)):

      This manuscript represents a continuation of the author's characterization of the 3 PAT1s in Arabidopsis development after Zuo et al., 2021; Zuo et al., 2022a; Zuo et al., 2022b. The mutants and the corresponding RNA sequencing experiments are of value to the community working on RNA regulation and degradation or plant development. While the initial findings are interesting, the authors do not explore the stimulus-induced condensation differences between the homologues or try to link the extreme differences in expression profiles mechanistically or functionally. I think the manuscript could greatly benefit from contextualizing their work within the frame of their previous studies and what is known about PBs in terms of plant development. While the RNA seq is a comprehensive data set, a closer examination and a better representation of the results would help readers to access the findings.

      __Our response: __We thank the reviewer for the constructive criticism. We hope the reviewer is satisfied by our modified manuscript.

      Reviewer expertise: RNA granule biology, Arabidopsis, molecular biology

      __Reviewer #3 (Evidence, reproducibility and clarity (Required)): __

      Summary:

      In the study "PAT mRNA decapping factors function specifically and redundantly during development in Arabidopsis" authors investigate potential specific functions of Arabidopsis PAT1 orthologs in plant development. Authors observe differences in rosette phenotypes (leaf size, serration and number) of single and multiple mutants of PAT1 gene family, show variation in translocation of the corresponding PAT1 proteins to processing bodies under a set of stress conditions and perform transcriptomics on the established mutants to elucidate the impact of individual PATs on posttranscriptional regulation of plant gene expression. Authors conclude that PAT1 orthologs have both overlapping and specific roles in plant development.

      __Our response: __We thank the reviewer for the peer review. Please see our detailed answers to the reviewer’s suggestions in the following.

      Major comments:

      1. The study contains intersting transcriptomics data that will be of use for the scientific community. However, analysis of the transcriptomics results could be discussed a bit more in depth. Authors could express their opinion about what gene expression changes might be caused by direct degradation via PAT1-dependent decapping mechanism and what changes are more likely to have occurred indirectly via other factors.

      __Our response: __We followed the reviewer’s suggestion and thus we analysed and discussed more in depth about the transcriptomic data (Line145, 220 &232)

      The intersting phenotypic observations are currently poorly linked to the transcriptomics/qPCR data provided, resulting in a somewhat fragmented story flow.

      __Our response: __We appreciate the reviewer thought the pat mutants’ phenotype are interesting, however we disagre with the reviewer on the statement of “poorly linked to the transcriptomics/ qPCR data”. For instance, downregulation of developmental and auxin responsive genes could explain the stunt growth phenotype in the pat triple mutant. Furthermore, the published petiole elongation regulator genes XTR7/XTH15 and PIL2/PIF6 exhibit decreased expression level only in mutants with shorter petioles. Nevertheless, we hope our new data and analysis will satisfy the reviewer.

      The transcriptomics was performed on the 6-weeks old plants. It would be helpful to learn more about authors reasoning for choosing this developmental stage for sampling. Why did authors decide against sampling at the earlier stages, before the observed leaves phenotypes were established?

      __Our response: __The pat mutants growth phenotypes showed bigger difference among each other at the late stage, therefore we performed RNA-seq on these samples. But we agree with the reviewer (also reviewer 1, major comment #2), transcriptomic shift at earlier stage could also be responsible for the observed phenotype, thus we performed qRT-PCR on the pat mutants at earlier stages for certain genes to examine this (Line 162 &169)

      Authors obtained intriguing results on specific translocation of PAT1, PATH1 and PATH2 to processing bodies in the root cells upon various stresses. Perhaps root transcriptomics of single PAT1, PATH1 and PATH2 knockouts under control conditions, treatment that translocate all three proteins to PBs(IAA) and selectively translocate only PAT1 (e.g. cytokinin) could shed more light on the redundancy an specificity of these proteins as the mRNA decapping factors.

      __Our response: __We appreciate the reviewer found our findings interesting. The specific translocation of PAT1, PATH1 and PATH2 to PBs in the root cells upon various stimuli indicates functional specificity and redundancy in cellular level which correlates with mutants’ growth phenotype. However, we agree with the reviewer that root transcriptomic data on pat mutants are very interesting, we are more than willing to share these mutants with peers who want to persue this in more detail.

      Do authors consider PAT1, PATH1 and PATH2 to be localized to different PBs sub-populations? It could be intersting to check co-localization of PAT1, PATH1 and PATH2 under various stress conditions. Could authors elaborate on their view of PBs composition and fate to which different PAT1s are recruited?

      __Our response: __We agree with the reviewer that it’s interesting to check co-localization of PAT1, PATH1 and PATH2. We observed partial localization of CFP-PATH2(in blue) and Venus-PAT1(in yellow) when transiently expressed in Benthmiana. But for permanent lines, we failed at observing separate CFP-PATH2(Blue) signal due to too much signal leakage from Venus-PAT1(Green). Given the fact that PATs function redundantly, we would assume they are partially co-localized in cellular level.

      Could authors speculate what features in the PAT1 protein might cause it being recruited to PBs more efficiently (or better to say, under a broader range of stresses) in comparison to PATH1 and 2?

      __Our response: __The release of ribosome-free mRNPs induces PB formation (Brengues et al., 2005). We suspect PAT1 could bind broader mRNAs compared to PATH1 and PATH2, therefor PAT1-mRNPs could form PBs more efficiently. Moreover, Sachdev et al found yeast PAT1 enhances the condensation of Dhh1 and RNA and PAT1-DHH1 interaction is essential for PB assembly (Sachdev et al., 2019), we assume PAT1 might have better interaction with DHH1 compared to PATH1 and PATH2 thus promote PB formation more efficiently. Please see our discussion part (Line 252)

      Are all three Arabidopsis PAT paralogs co-expressed in the same tissues /developmental stages?

      __Our response: __Please see our response to reviewer 2 major comment #4.

      Could authors elaborate a bit more why the triple pat1 knockout has a much more severe phenotype in comparison to a single pat1 loss-of-function mutant or any of the double pat1 mutants. Do authors observe complementary changes in the PAT1 genes expression in the mutant lines, e.g. is PATH1 expressed at a higher level in the absence of PAT1 and PATH2?

      __Our response: __We now elaborate more about the reason why triple pat1 knockout has the most severe phenotype in the multiple pat mutants (Line 210). We do see higher transcriptional level of PAT1 in path1-4path2-1summ2-8 and also higher transcriptional level of PATH1 in pat1-1path2-1summ2-8 but the same PATH2 transcriptional level in pat1-1path1-4summ2-8 compared to summ2-8 (Fig S1C, Line 104)

      Please provide the name of the used statistical test in all figure legends.

      __Our response: __We now provide the statistical test in “Material and Methods” part (Line 367).

      Minor comments:

      1. Authors might want to reconsider the title as it is somewhat too vague in its current form.

      __Our response: __We now changed our title into “ PAT mRNA decapping factors are required for proper developmental in Arabidopsis

      Line 9: explanation of PAT1 and PATH1 and 2 abbreviations is best placed at the first mentioning of the name.

      __Our response: __We carefully followed the reviewer’s suggestion (Line 10)

      Line 10: mRNA degradation is rather a posttranscriptional regulation of gene expression.

      __Our response: __We agree and changed our statement in the new ms (Line 9).

      Lines 11 and 12: path1 and path2 abbreviation are not explained. Please note that on the Figure 1A the same proteins are labelled as PAT1H1 and PAT1H2

      __Our response: __We thank the reviewer for pointing it out, we now have PATH1 and PATH2 abbreviations explained in Line 10 and also correct the labels in Fig 1A.

      Lines 22-25: Would you be so kind to rephrase or elaborate on what yoPBu mean. LSM1-7/PAT1 complex are known to bind oligoadenylated transcripts indeed and even stabilize their 3' ends, it is not clear what "engage transcripts containing deadenylated tails" means in this context.

      __Our response: __We hope we now rephrase the statement in a clear way (Line 25)

      Line 29: for the sake of clarity, it might be beneficial to list the known activators of the decapping DCP2 enzyme, including the VCS. Generally the introduction could benefit from a bit more in depth review of the decapping mechanism.

      __Our response: __We hope the more detailed introduction will satisfy the reviewer (Line 27).

      Line 51:"other 2 PATs" => "other two PATs". Generally the text is quite well written, but might need a bit of polishing.

      __Our response: __The text is corrected now (Line 64).

      Authors are absolutely correct in their attempt to provide full information about mutant backgrounds. However, for the sake of comprehension, it would be great to grant the double and triple mutants in the summ2 background shorter and more legible names. For example, the pat1-1path1-4path2-1summ2-8 mutant could be named as pat1/h1/h2/s.

      __Our response: __We originally used pat1/h1/h2/s for the triple but a colleague pointed out “h1” or “h2” are not proper gene names and suggested us to rename them. But we agree that the double and triple pat names are comprehensive, to compromise we change the triple pat mutants into pat triple.

      Figure 1B:

      • it would be intersting to have authors opinion on why PBs are formed in this case under non-stress(?) conditions.

      __Our response: __Forming PBs is a dynamic process, and we assume that even under normal conditions, there is still ongoing mRNA decay and translational repression which should be seen as some background level of PBs (Line 85).

      Please note that expressing only the N-terminal part of CFP is a weak negative control for BiFC. No restoration of CFP can occur in such case and thus it is a given that no fluorescence can be observed in these samples. For example, co-expression of nCFP-PAT1 with cCFP-GUS, would be a more rigorous negative control, better aligned with the coIP experiments.

      __Our response: __We had nCFP-Gus with cCFP-LSM1 as real negative control in old Fig 1B (bottom lane). We also agree with the reviewer that only the N-terminal part of CFP is a weak negative control for BiFC, therefore we removed the weak control and only left the rigorous negative control (new Fig 1B).

      Please note that some arrows point at a structure that seems to be not discernible a signal.

      __Our response: __It’s due to the poor quality of the picture from the PDF file, arrows in the original high-resolution figure do point at discernible foci.

      Figure 1C: It might be helpful to also include a Col-0 WT plant

      __Our response: __Col-WT plant is now included in Fig S1A.

      It is not clear how qPCR data and complementation lines help to characterize the established PATH1 and PATH2 loss-of-function mutants. There is no immunodetection of the corresponding proteins in the knockouts, qPCR shows no dramatic decrease in the transcript level of PATH1 and H2 and the phenotypes of complemented lines presented in the Fig S1E at a glance look quite similar to the phenotypes of the corresponding knockout mutants. Complementation lines are not used for any other experiments in this study and it is not clear why authors decided to include this material into the article.

      __Our response: __To characterize the path1 and path2 mutants, we first did qRT-PCR to check the transcriptional level expression, but like the reviewer mentioned, there was no dramatic decrease indicating the mutations of path1-4 and path2-1 did not change PATH1 and PATH2 transcriptional level expression. We also tried to raise antibodies against PATH1 and PATH2, however the antibodies failed to recognize any PAT proteins. Therefore, we used the complementation lines to characterize the mutations in PATH1 and PATH2. Since path1 and path2 single mutants don’t have obvious growth phenotype and the dwarf pat triple is barely possible to transform, we had to complement the pat1path1 and pat1path2 double mutants. If the reviewer takes a closer look, the growth phenotype of the complementation lines Venus-PATH1/ pat1-1path1-4summ2-8 and Venus-PATH2/ pat1-1path2-1summ2-8 are similar to pat1-1summ2-8 but not the background pat double mutants. The complementation lines were also used to study PATH1 and PATH2 cellular localization.

      Figure S1C misses labels indicating what detection of what gene is shown on what chart.

      __Our response: __We thank the reviewer for pointing it out, the gene names are indicated now in new FigS1C.

      Experiments to visualize PBs under various stress stimuli were conducted on roots for the Figure 2 while coIP was performed on the green tissue. Could authors elaborate on whether PB formation could be expected to be the same in different plant organs? Somewhat related to the same topic, Figure 2 contains micrographs obtained on meristematic, transition and elongation root zones, in which epidermal cells are present at various developmental stages. Since PAT proteins are suggested to impact plant development, it might be prudent to obtain observations for all samples at the same developmental stage. Could authors provide their opinion about how representative the provided micrographs are for all root zones? Furthermore, Venus-PATH2 under ACC treatment shows punctate localization only in a single cell out of the three-ish cells visible on the micrograph, potentially indicating differences in PAT2 recruitment to PBs in trichoblasts and atrichoblasts. This in itself could be an intersting observation helpful for elucidating the specific roles of PAT1 orthologs.

      __Our response: __CoIP results from Benthamiana leaves indicate Arabidopsis PATs and LSM1 are in the same complex, and PB visualization in root area suggests PATs respond to different hormone treatments. flg22 treatment has been published to induce PB formation in Arabidopsis root but dissemble PBs in Arabidopsis protoplasts, indicating a tissue specific manner of PB formation. We randomly chose 1 picture/treatment from 9 (3 plants * bio-triplicates) which showed the same. However, we thank the reviewer for pointing out the confocal pictures we chose were not all from elongation zone, we now carefully checked all our confocal pictures and made sure they are from the same developmental stages. We also discuss more of PATH2 localization in response to ACC (Line 251).

      Figure 4C would greatly benefit from a more detailed description in the main text and figure legend of what authors show/conclude.

      __Our response: __We thank the reviewer for the suggestion hence we describe Fig 4C in more detail in our new manuscript (Line 146).

      Figure 5, please avoid using the same color for the bars for the triple pat knockout and the control summ2-8 line

      __Our response: __We changed the colour scheme for all the mutants (new Fig 4E).

      Figure 5B legend should include the name of the statistical test.

      __Our response: __We now include the name of the statistical test in “Material and Methods” (Line 367).

      Figure S2: The coIP experiment is a bit difficult to interpret due to the extremely low protein quantities in some of the input samples. Perhaps a repetition with more balanced input quantities would be beneficial. The figure legend does not contain information on how normalized intensity values were obtained.

      __Our response: __We used the same amount of total protein for each sample (3mg) for each IP, PATH1 and PATH2 don’t express as high as PAT1. The numbers indicate the comparative ratio between PAT-HA protein signal and LSM1-GFP signal, and PAT1-HA/LSM1-GFP under non-treatment condition is normalized as 1.

      Line 130: Fig S2 is referenced but Fig S3 is meant

      __Our response: __We thank the reviewer for pointing out our mistake, the correct figure is now referenced.

      Reviewer #3 (Significance (Required)):

      Strength:

      Regulation of gene expression by mRNA decay is an extremely intersting topic and is highly relevant in plant stress and developmental biology. This study provides a more in depth view on the potential specific roles of the three PAT1 orthologs in Arabidopsis plants. Authors established loss-of-function mutants of the corresponding genes and performed transcriptomics analysis that will be a valuable source for future studies. Furthermore, microscopy analysis of PATH1 and PATH2 translocation to PBs indicates their potential specific roles in plant stress response.

      Weakness: The current version of this study suffers from vague presentation of the results. Starting from the title and ending with discussion authors provide a "general" view on their results and do not go into detailed interpretations. Thus, no mechanistic insight has been derived or at least suggested from the wealth of the transcriptomics, phenotypic and microscopy data.

      The introduction should provide more detailed information on what is known on the PAT1 role in the mRNA decapping pathway and its relevance for plant stress response and development.

      Please note, that the above mentioned suggestion of different sampling for transcriptomics analysis is not meant as a request for this particular study, but rather as an illustration of an expectation a reader would built while following the current version of the text. A thorough description of the strategy for transcriptomics and a more in depth analysis might significantly strengthen the study's coherence and impact.

      Advance:

      At this stage, the study looks more like an incremental advance of the work from the same laboratory performed for the single PAT1 protein. However, as mentioned in the comments above, the study might be made significantly stronger by elaborating the results analysis and highlighting potential discoveries.

      Audience:

      The topic of this study is of a significant interest to a broad audience performing research in plant stress biology and also developmental plant biology.

      __Our response: __We thank the reviewer for acknowledging the significance of our work and the structural criticism. We hope our detailed answers to the reviewer’s suggestions and the additional data we included in the manuscript will satisfy the reviewer.

      Reviewer's and co-reviewer's fields of expertise:

      Molecular Biology, Plant cell biology, Plants Stress response, Autophagy, Stress granules

      __Reviewer #4 (Evidence, reproducibility and clarity (Required)): __

      PAT1 (Protein Associated with Topoisomerase II) are RNA-binding proteins involved in the control of mRNA decay in the cytoplasm. Plants possess multiple PAT1 family members, three in Arabidopsis, PAT1, PATH1 and PATH2. According to the literature, the pat1 mutant shows dwarfism and de-repressed immunity. In this paper, Zou et al. describe the function of PATH1 and PATH2. Two pieces of evidence are consistent with their role in the control of mRNA decay. First, Co-IP and bimolecular Fluorescence Complementation assays in tobacco indicate physical interaction and co-localization of PAT1, PATH1 or PATH2 with LSM1 (Fig. 1), which is a protein present in decapping complexes that form the cytoplasmic foci involved in mRNA decay. Second, PAT1, PATH1 and PATH2 are present in these cytoplasmic Processing Bodies (Fig. 2). Zou et al. generated path1 and path2 mutants, double mutants with pat1 and the triple mutant using independent alleles and the summ2 background to avoid autoimmunity interference. The mutants show leaf growth (Fig. 3) and gene expression (Fig. 4) phenotypes that are not exactly similar among the different family members, but there is significant redundancy revealed by these phenotypes.

      __Our response: __We thank the reviewer for the peer review. Please see our detailed answers to the reviewer’s suggestions in the following.

      1. The conclusions are straight forward and, apparently, well supported by the data. However, the authors should confirm that when they provide the number of replicates (n) in the legends to the figures, this actually refers to the number of biological replicates. The statements should be based on true biological replicates (not technical replicates). The statistical tests should also be explicitly indicated (including that used to identify DEG in the RNAseq experiment).

      __Our response: __We carefully went through our figures and made sure the number of replicates (n) were correctly stated in figure legends and the statistical tests were indicated (Line 367)

      Reviewer #4 (Significance (Required)):

      The results are useful but mainly descriptive. Personally, I am interested in the mechanisms involved in the control of growth and the manuscript does not mechanistically link the action of PAT1, PATH1 and PATH2 to the transcriptome and the latter to the growth patterns.

      __Our response: __We thank the reviewer for acknowledging the significance of our work of characterizing PATs and we hope our new data could satisfy the reviewer in regarding to “mechanistical link”.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #4

      Evidence, reproducibility and clarity

      PAT1 (Protein Associated with Topoisomerase II) are RNA-binding proteins involved in the control of mRNA decay in the cytoplasm. Plants possess multiple PAT1 family members, three in Arabidopsis, PAT1, PATH1 and PATH2. According to the literature, the pat1 mutant shows dwarfism and de-repressed immunity. In this paper, Zou et al. describe the function of PATH1 and PATH2. Two pieces of evidence are consistent with their role in the control of mRNA decay. First, Co-IP and bimolecular Fluorescence Complementation assays in tobacco indicate physical interaction and co-localization of PAT1, PATH1 or PATH2 with LSM1 (Fig. 1), which is a protein present in decapping complexes that form the cytoplasmic foci involved in mRNA decay. Second, PAT1, PATH1 and PATH2 are present in these cytoplasmic Processing Bodies (Fig. 2). Zou et al. generated path1 and path2 mutants, double mutants with pat1 and the triple mutant using independent alleles and the summ2 background to avoid autoimmunity interference. The mutants show leaf growth (Fig. 3) and gene expression (Fig. 4) phenotypes that are not exactly similar among the different family members, but there is significant redundancy revealed by these phenotypes.

      The conclusions are straight forward and, apparently, well supported by the data. However, the authors should confirm that when they provide the number of replicates (n) in the legends to the figures, this actually refers to the number of biological replicates. The statements should be based on true biological replicates (not technical replicates). The statistical tests should also be explicitly indicated (including that used to identify DEG in the RNAseq experiment).

      Significance

      The results are useful but mainly descriptive. Personally, I am interested in the mechanisms involved in the control of growth and the manuscript does not mechanistically link the action of PAT1, PATH1 and PATH2 to the transcriptome and the latter to the growth patterns.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary:

      In the study "PAT mRNA decapping factors function specifically and redundantly during development in Arabidopsis" authors investigate potential specific functions of Arabidopsis PAT1 orthologs in plant development. Authors observe differences in rosette phenotypes (leaf size, serration and number) of single and multiple mutants of PAT1 gene family, show variation in translocation of the corresponding PAT1 proteins to processing bodies under a set of stress conditions and perform transcriptomics on the established mutants to elucidate the impact of individual PATs on posttranscriptional regulation of plant gene expression. Authors conclude that PAT1 orthologs have both overlapping and specific roles in plant development.

      Major comments:

      • The study contains intersting transcriptomics data that will be of use for the scientific community. However, analysis of the transcriptomics results could be discussed a bit more in depth. Authors could express their opinion about what gene expression changes might be caused by direct degradation via PAT1-dependent decapping mechanism and what changes are more likely to have occurred indirectly via other factors.
      • The intersting phenotypic observations are currently poorly linked to the transcriptomics/qPCR data provided, resulting in a somewhat fragmented story flow.
      • The transcriptomics was performed on the 6-weeks old plants. It would be helpful to learn more about authors reasoning for choosing this developmental stage for sampling. Why did authors decide against sampling at the earlier stages, before the observed leaves phenotypes were established?
      • Authors obtained intriguing results on specific translocation of PAT1, PATH1 and PATH2 to processing bodies in the root cells upon various stresses. Perhaps root transcriptomics of single PAT1, PATH1 and PATH2 knockouts under control conditions, treatment that translocate all three proteins to PBs(IAA) and selectively translocate only PAT1 (e.g. cytokinin) could shed more light on the redundancy an specificity of these proteins as the mRNA decapping factors.
      • Do authors consider PAT1, PATH1 and PATH2 to be localized to different PBs sub-populations? It could be intersting to check co-localization of PAT1, PATH1 and PATH2 under various stress conditions. Could authors elaborate on their view of PBs composition and fate to which different PAT1s are recruited?
      • Could authors speculate what features in the PAT1 protein might cause it being recruited to PBs more efficiently (or better to say, under a broader range of stresses) in comparison to PATH1 and 2?
      • Are all three Arabidopsis PAT paralogs co-expressed in the same tissues /developmental stages?
      • Could authors elaborate a bit more why the triple pat1 knockout has a much more severe phenotype in comparison to a single pat1 loss-of-function mutant or any of the double pat1 mutants. Do authors observe complementary changes in the PAT1 genes expression in the mutant lines, e.g. is PATH1 expressed at a higher level in the absence of PAT1 and PATH2?
      • Please provide the name of the used statistical test in all figure legends.

      Minor comments:

      • Authors might want to reconsider the title as it is somewhat too vague in its current form.
      • Line 9: explanation of PAT1 and PATH1 and 2 abbreviations is best placed at the first mentioning of the name.
      • Line 10: mRNA degradation is rather a posttranscriptional regulation of gene expression.
      • Lines 11 and 12: path1 and path2 abbreviation are not explained. Please note that on the Figure 1A the same proteins are labelled as PAT1H1 and PAT1H2
      • Lines 22-25: Would you be so kind to rephrase or elaborate on what you mean. LSM1-7/PAT1 complex are known to bind oligoadenylated transcripts indeed and even stabilize their 3' ends, it is not clear what "engage transcripts containing deadenylated tails" means in this context.
      • Line 29: for the sake of clarity, it might be beneficial to list the known activators of the decapping DCP2 enzyme, including the VCS. Generally the introduction could benefit from a bit more in depth review of the decapping mechanism.
      • Line 51:"other 2 PATs" => "other two PATs". Generally the text is quite well written, but might need a bit of polishing.
      • Authors are absolutely correct in their attempt to provide full information about mutant backgrounds. However, for the sake of comprehension, it would be great to grant the double and triple mutants in the summ2 background shorter and more legible names. For example, the pat1-1path1-4path2-1summ2-8 mutant could be named as pat1/h1/h2/s.
      • Figure 1B:
      • it would be intersting to have authors opinion on why PBs are formed in this case under non-stress(?) conditions.
      • Please note that expressing only the N-terminal part of CFP is a weak negative control for BiFC. No restoration of CFP can occur in such case and thus it is a given that no fluorescence can be observed in these samples. For example, co-expression of nCFP-PAT1 with cCFP-GUS, would be a more rigorous negative control, better aligned with the coIP experiments.
      • Please note that some arrows point at a structure that seems to be not discernible a signal.
      • Figure 1C: It might be helpful to also include a Col-0 WT plant
      • It is not clear how qPCR data and complementation lines help to characterize the established PATH1 and PATH2 loss-of-function mutants. There is no immunodetection of the corresponding proteins in the knockouts, qPCR shows no dramatic decrease in the transcript level of PATH1 and H2 and the phenotypes of complemented lines presented in the Fig S1E at a glance look quite similar to the phenotypes of the corresponding knockout mutants. Complementation lines are not used for any other experiments in this study and it is not clear why authors decided to include this material into the article.
      • Figure S1C misses labels indicating what detection of what gene is shown on what chart.
      • Experiments to visualize PBs under various stress stimuli were conducted on roots for the Figure 2 while coIP was performed on the green tissue. Could authors elaborate on whether PB formation could be expected to be the same in different plant organs? Somewhat related to the same topic, Figure 2 contains micrographs obtained on meristematic, transition and elongation root zones, in which epidermal cells are present at various developmental stages. Since PAT proteins are suggested to impact plant development, it might be prudent to obtain observations for all samples at the same developmental stage. Could authors provide their opinion about how representative the provided micrographs are for all root zones? Furthermore, Venus-PATH2 under ACC treatment shows punctate localization only in a single cell out of the three-ish cells visible on the micrograph, potentially indicating differences in PAT2 recruitment to PBs in trichoblasts and atrichoblasts. This in itself could be an intersting observation helpful for elucidating the specific roles of PAT1 orthologs.
      • Figure 4C would greatly benefit from a more detailed description in themain text and figure legend of what authors show/conclude.
      • Figure 5, please avoid using the same color for the bars for the triple pat knockout and the control summ2-8 line
      • Figure 5B legend should include the name of the statistical test.
      • Figure S2: The coIP experiment is a bit difficult to interpret due to the extremely low protein quantities in some of the input samples. Perhaps a repetition with more balanced input quantities would be beneficial. The figure legend does not contain information on how normalized intensity values were obtained.
      • Line 130: Fig S2 is referenced but Fig S3 is meant

      Significance

      Strength: Regulation of gene expression by mRNA decay is an extremely intersting topic and is highly relevant in plant stress and developmental biology. This study provides a more in depth view on the potential specific roles of the three PAT1 orthologs in Arabidopsis plants. Authors established loss-of-function mutants of the corresponding genes and performed transcriptomics analysis that will be a valuable source for future studies. Furthermore, microscopy analysis of PATH1 and PATH2 translocation to PBs indicates their potential specific roles in plant stress response.

      Weakness: The current version of this study suffers from vague presentation of the results. Starting from the title and ending with discussion authors provide a "general" view on their results and do not go into detailed interpretations. Thus, no mechanistic insight has been derived or at least suggested from the wealth of the transcriptomics, phenotypic and microscopy data.<br /> The introduction should provide more detailed information on what is known on the PAT1 role in the mRNA decapping pathway and its relevance for plant stress response and development. Please note, that the above mentioned suggestion of different sampling for transcriptomics analysis is not meant as a request for this particular study, but rather as an illustration of an expectation a reader would built while following the current version of the text. A thorough description of the strategy for transcriptomics and a more in depth analysis might significantly strengthen the study's coherence and impact.

      Advance: At this stage, the study looks more like an incremental advance of the work from the same laboratory performed for the single PAT1 protein. However, as mentioned in the comments above, the study might be made significantly stronger by elaborating the results analysis and highlighting potential discoveries.

      Audience: The topic of this study is of a significant interest to a broad audience performing research in plant stress biology and also developmental plant biology.

      Reviewer's and co-reviewer's fields of expertise:

      Molecular Biology, Plant cell biology, Plants Stress response, Autophagy, Stress granules

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Zuo et al., characterize the role of three cytoplasmic mRNA-decay activator proteins PAT1, PATH1 and PATH2 in the context of plant development and leaf morphology in Arabidopsis thaliana and Nicotiana benthamiana. The authors show that the triple pat mutant displays the most severe dwarfism of all combinatorial mutants. Through treatment with different stimulants the authors found that only IAA treatment induces the three homologues to form condensates (possibly PBs), while PAT1 forms condensates upon every tested stimulus. An extensive RNA seq experiment revealed miss-regulation of several hundred genes in the higher order mutants, several of which were involved in auxin responsive and leaf morphology determinant genes.

      Major points:

      • Title is not meaningful as is and, in my opinion, does not reflect the main findings in the manuscript.
      • The results section could benefit from improved flow between the paragraphs and more reasoning for the next steps taken to help readers understand the aims of the authors.
      • L46: "So far little is known about the functions of these three PATs in plant development.", The authors themselves have studied these proteins in the context of seed germination and ABA control, as well as apical hook formation and auxin responses. Should at least be mentioned and the results discussed in this context.
      • What are the expression levels and patterns of PATH1 and PATH2 compared to PAT1? Is anything known about spatial or temporal regulation of these proteins?
      • Figure 1:
        • I do not agree that the authors have shown that "PATH1 and PATH2 are also mRNA decapping factors", rather that these proteins can co-localize (and possibly interact) with LSM1. Decapping assays for example with the known PAT1 de-capping targets from their previous work and their extensive mutant collection could be used to test this.
        • From the BiFC experiment (Figure 1B) it looks like PATs are mostly soluble in the cytoplasm (like LSM1) and might be stress-induced components of PBs (like LSM1). Do PATs co-localize with other canonical PB markers that are more prone to condensation, like DCPs or VCS? BiFC could be performed after IAA treatment to confirm that the cytoplasmic foci are indeed LSM1-positive PBs.
        • A: please provide uncropped images of all Western blots in supplemental data.
      • I applaud the authors for establishing this great higher order mutant collection that will be very useful for researchers in the field. However, I am confused about the description of these mutants. If I understood it correctly, these mutants were already used in a previous study by the authors, namely "Zuo, Z., et al., Molecular Plant-Microbe Interactions, 35(2), 125-130." & Zuo, Z., et al., (2021). FEBS letters, 595(2), 253-263." In this study the authors refer to a BioRxiv "Zuo, Z., et al., (2019)." as the reference for these Arabidopsis lines. Is this current manuscript a continuation of the BioRxiv? Please elaborate whether these lines have been used and described in previous studies.
      • L72: Is the strong developmental phenotype of the higher order mutants persistent under long day conditions? Considering the strong developmental phenotypes of the mutants, the flowering transition and morphology could be an interesting trait to study. Why did you choose short day conditions for this study?

      • L78: This statement is hard to see in Figure 1C and best described for Figure 3A.

      • L82: Please include a reasoning for testing PATs localization after hormone treatment. Do you have any indication that other PB proteins behave similar to either PAT1 or the PATHs after hormone treatment to substantiate that these foci observed are indeed PBs? What is known about PBs after hormone treatment in planta?
      • Figure 2:
        • How does the localization of LSM1 change under the same treatments? Does ist behave like PAT1 or the homologues?
        • Which part of the root was imaged for this experiment? Is it possible that the observed foci are ARF-condensates as reported by Jing et al., 2022? Do you observe a gradual change in numbers or morphology along the root?
        • How did the authors decide on the concentrations for the stimulant treatments? Have you tried different doses, and could the responses be dose-dependent?
        • A representative image is not sufficient for quantitative responses, like RNA granule condensation. Please provide a quantification of stimulant-induced foci after the different treatments.
      • L91: Does that mean that most co-precipitated signal comes from the soluble fraction and not PB-localized? Would an RNAse treatment step eliminate the co-precipitation (optional)?
      • L92/93: Or alternatively that PAT1 localizes to PBs independent of the stress, while PATHs are signal-specific PB components?
      • Figure 3:
        • I wonder if these results fit better in conjunction with Figure 1, either as a combined figure or move before Figure 2.
        • It is interesting that path2/pat1, while being dwarfed, is less serrated compared to pat1 or path1/pat1. Can you find any indications in your RNAseq set which genes might be involved?
        • Indicate statistical test used to determine p-value
      • L116/L117: Doesn't the result in Figure 3E indicate that PATH1 and PATH2 are not fully redundant, but that PATs have specific and narrow roles in leaf development? L116 goes against your statement in L150 & L160. What is known about the expression patterns of PAT1, PATH1 and PHATH2?
      • L123: PC3 only explains 0.55% of the variance, so differences along this axis will be overinflated. In my interpretation the pat1/path2 mutant is clustering apart from the other higher order mutants, which is also reflected in the leaf phenotypes. A 2D PCA would be sufficient to describe most of the variation.
      • Figure 4:
        • A: The 3D-PCA inflates the differences between higher order mutants along PC3, even though this axis explains only 0.55% of the variance, maybe a 2D-PCA would more intuitively cluster the samples together?
        • B: Please explain the scale in the figure legend and which genes were included? Only DEGs between triple mutant and summ2-8 or DEGs that were different in at least one higher order mutant?
        • C: several comparisons are missing from the upset-plot. Please show the complete plot, also is there a white box laid over the second bar in the upper graph? It would help the reader, if the results section would explain the plots and the comparisons took. Which differences are the authors interested in?
        • From Figure 4B, the triple mutant has an almost inverted expression of mis-regulated genes. High expression genes are now lowly expressed and vice-versa. Has this been reported for other RNA decay mutants before?
      • How do you explain that mutants in RNA decay have a large group of repressed transcripts and a large group of enriched transcripts? Wouldn't you suspect a general higher expression in RNA decay mutants or which kind of feedback loop would you propose is happening here? Also, since both kinds of expression changes are recorded in your RNA seq can you speculate on the specificity? Why are some genes up- and others downregulated? Would you suspect that transcription factors are under PATs control?
      • Where is the sequencing data deposited? This dataset can be of great value for researchers in the field, but the raw data needs to be made commonly available.

      Minor points:

      • Check order and nomenclature for protein / gene names in Abstract and Introduction
      • L26 / L83 "aggregate" implies non-functionality, I would use "concentrate", "condensate" or "accumulate".
      • L35, L45 & L54 all state the same. Maybe remove at least one mention to reduce redundancy?
      • L211: Did you use the same imaging settings for all lines?
      • L17: RNA quality "control" word missing?
      • L477: Authors should cite the newest version of their BioRxiv: Zuo, Z., Roux, M. E., Chevalier, J. R., Dagdas, Y. F., Yamashino, T., Højgaard, S. D., ... & Petersen, M. (2022). The mRNA decapping machinery targets LBD3/ASL9 to mediate apical hook and lateral root development in Arabidopsis. bioRxiv, 2022-07.
      • Figure 3B-F, Figure 4C: check spelling on the axis titles.

      Significance

      This manuscript represents a continuation of the author's characterization of the 3 PAT1s in Arabidopsis development after Zuo et al., 2021; Zuo et al., 2022a; Zuo et al., 2022b. The mutants and the corresponding RNA sequencing experiments are of value to the community working on RNA regulation and degradation or plant development. While the initial findings are interesting, the authors do not explore the stimulus-induced condensation differences between the homologues or try to link the extreme differences in expression profiles mechanistically or functionally. I think the manuscript could greatly benefit from contextualizing their work within the frame of their previous studies and what is known about PBs in terms of plant development. While the RNA seq is a comprehensive data set, a closer examination and a better representation of the results would help readers to access the findings.

      Reviewer expertise: RNA granule biology, Arabidopsis, molecular biology

    5. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      The manuscript investigates the role of PAT1 gene family in Arabidopsis thaliana. Though the PAT1 protein has been previously investigated and displayed immune-related and developmental phenotypes, the other two members of the family, PATH1 and PATH2, have not been well studied. The authors set out to understand the role of these proteins in relation to the role of PAT1. They thus generated single, double, and triple mutants of the possible combinations of PAT1 genes and examined their phenotypes. As the study focused on the developmental effects of PAT1, the mutants were generated on the background of the summ2 mutant to avoid phenotypes related to immune response. The authors notice a developmental difference between the pat1 mutant combinations, suggesting that PAT1 acts differently than PATH1 and PATH2 and that the PATH proteins serve a redundant function. They also performed RNA-seq analysis to identify differentially-regulated genes in the mutant combinations. The study is interesting and well-executed, yet I believe some questions should still be addressed:

      • The research mainly focuses on the developmental phenotype of pat mutants but also tests the interaction of PATH proteins with RNA decapping enzymes to check their function and localization during different treatments. I found it a bit confusing since Figure 1 also shows the developmental phenotype of the mutants. I think editing the order of the figures would make the overall story more coherent.
      • My main concern is the correlation between the developmental phenotype of the mutants and the gene expression. Leaf samples for RNA extraction were taken when the plants were 6 weeks old, and the developmental phenotype is very evident. It is thus not possible to tell whether the differences in gene expression are a cause or effect of the developmental phenotype. I think performing qPCR of selected candidates at earlier developmental times might help solve this issue, as well as the characterization of younger plants for the developmental phenotypes (such as leaf number).
      • Overall, the manuscript is missing data regarding replicate numbers in the IP and confocal microscopy experiments.

      Minor comments:

      • Figure 1C - the authors should add a picture of Col0 plants as well as the mutants.
      • Figure 3 - Calculating the leaf-to-petiole ratio in the different mutants would be good.
      • Figure 4 - the details in the figure are very unclear, especially in the PCA. It would be good to display the data in 2D for PC1 and PC3 and change the colors a bit.

      Significance

      Both PATH proteins have been less investigated than PAT1, and in that sense, the work is novel. However, it seems that most of the phenotype is attributed to PAT1 rather than the other family members, limiting the interest to the broad plant science community.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      The study largely focuses on the use of a 293 cell line that lacks a functional Dicer gene originally identified by the Cullen group. Baldaccini use this cell line, referred to as NoDice cells, to reconstitute various Dicer isoforms that have thus far been described in a variety of settings (e.g., stem cells and oocytes). Collectively, these data demonstrate the capacity of certain N-terminal truncations of Dicer to inhibit Sindbis virus and reduce the presence of viral dsRNA, supporting some of the observations made thus far concerning an antiviral role for mammalian Dicer. For other viruses, this impact was significantly more modest (SFV reduction is less than a log) or was not observed at all (VSV and SARS-CoV-2). The authors then go on to characterize the nature of the observed antiviral activity and ultimately implicate PKR and the induction of NF-kB in priming the cell's antiviral defenses. Importantly, the group also found that this antiviral activity neither required the nuclease activity of Dicer nor the kinase activity of PKR - providing evidence against antiviral RNAi in mammals. In all, the data would seem to suggest that Dicer can act as a dsRNA sensor and can mediate the activation of an NF-kB response - akin to what is observed in response to NOD or some TLR engagement. In all, it is the opinion of this reviewer that this work brings additional clarity to a concept that remains controversial in the field and therefore embodies something meaningful for the community.

      With that said, there are a few issues that require additional attention. The first of these is textual. The introduction of the paper accurately describes the evidence in support of mammalian RNAi but does not invest the same time in discussing the data to the contrary. For example, Seo et al demonstrated that virus infection results in poly-adp-ribosylation of RISC preventing RNAi activity (PMID: 24075860), Uhl et al showed that IFN-induced ADAR1 resolves dsRNA in the cell and prevents RNAi (PMID: 37017521), and Tsai et al showed that virus-derived small RNAs are not loaded into the RISC in a manner that would enable antiviral activity (PMID 29903832). None of this work is referenced in this manuscript and it generates an unbalanced introduction as it relates to the controversy surrounding the idea of RNAi in mammals.

      Reply: We thank the reviewer for their positive comments and suggestions. In the revised version of this manuscript, we will rewrite the introduction to take into account the published data that are not in favor of an antiviral role of RNAi in mammals and we will add the suggested references

      The second issue that would further strengthen this paper relates to the fact that the authors spend a considerable amount of time discussing the data of Figure 6 and 7 as conditions that are defined by a Dicer that can not be processive in its nuclease activity (WT) vs. one that can (N1). However, there seems to be little consideration about the fact that the introduction of WT Dicer into these cells also restores miRNA biology whereas N1 appears to remain only partially functional (based on the data of Fig 3E). Given this, it seems the authors should verify that the high baseline of NFkB signaling that is being observed when comparing WT to N1 is not a product of restored miRNA function in WT cells, in contrast to the hypotheses outlined in the manuscript. This could be addressed by silencing Drosha or DGCR8 in the Dicer knockout cells prior to their reconstitution of Dicer. In the opinion of this reviewer, this experimental control would significantly strengthen the conclusions the authors are making here.

      Reply: This would indeed be an ideal experiment to rule out the contribution of miRNAs in the observed phenotype. We believe however that this particular experiment would prove difficult to realize given that we reconstitute Dicer expression by lentiviral transduction and keep the cells under selection for a couple of weeks before using them for further experiments. This time frame is therefore not compatible with the use of siRNA to knock-down Drosha or DGCR8. Alternatively, we could knock them out by CRISPR-Cas9, but this would take too long and is not feasible in the frame of this work.

      We can however address the concern regarding the role played by miRNAs in the observed phenotype of the Dicer N1 cells. Indeed, we can determine the miRNA profile from our small RNA sequencing data and compare them between the Dicer WT and Dicer N1 cells. We have done this comparison and could not find striking differences in miRNA expression between the two cell lines. We will add this additional piece of evidence in our revised manuscript.

      Reviewer #1 (Significance (Required)):

      In the manuscript entitled, "Canonical and non-canonical contributions of human Dicer helicase domain in antiviral defense" Baldaccini et al. describe their findings concerning the ability of certain N-terminal deletion variants of Dicer in contributing to mammalian antiviral activity. The concept of a functional antiviral RNAi system in mammals is a contentious one with many publications including data both in support of its existence and opposing this idea. In this manuscript, Baldaccini et al. perform a wide range of well-controlled experiments to specifically address aspects of those reports to both provide clarity in what has been documented thus far and to expand on those concepts further.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      Summary

      Whether RNAi is used as an antiviral mechanism in mammals has been a hotly debated issue. The research team previously published several papers on the roles of Dicer in siRNA/miRNA biogenesis and in antiviral responses. They have recently reported that the helicase domain of human Dicer specifically interacts with several proteins that are involved in the IFN response, including PKR. In this study, Baldaccini et al. investigated the involvement of Dicer in antiviral response using various mutants of human Dicer. They showed that deletion mutants of helicase domain exhibit antiviral activity that requires the presence of PKR. They further demonstrated that one of the mutants, N1-Dicer showed antiviral activity in an RNAi-independent manner but depending on the presence of either native PKR or kinase deficient mutants. Transcriptomic analysis revealed that numerous genes involved the IFN and inflammatory response were upregulated in the cells that express N1-Dicer, which is likely due to an increased activation of the NFκB pathway. Based on these findings, the authors propose that Dicer may act as antiviral molecule using its helicase domain, which representing a novel non-canonical function of Dicer.

      Major comments:

      1.The results from experiments with SARS-CoV2 are intriguing (Fig.2). The authors speculated that NFkb activation is in favor of the replication of this virus. It would be interesting to see the infection and replication of SARS-CoV2 in PKR deficient cells and cells expressing PKR mutants (as described in Fig.5). The results may prove/disapprove the authors' speculation and yield additional findings.

      Reply: We thank the reviewer for this suggestion. We have cells that are double knock-out for Dicer and PKR (NoDice/∆PKR) that were transduced to stably express Dicer WT or Dicer N1 and further transduced to express ACE2. We will infect those cell lines with SARS-CoV-2, which will allow us to see whether the difference in viral accumulation can still be observed in the absence of PKR. However, it might prove more difficult to reconstitute PKR expression (WT or mutants) in these cells since they are already transduced twice with two different constructs (Dicer and ACE2).

      Western blot analysis. In the method section, it is stated that proteins were quantified with Bradford method and equal loading was verified by Ponceau S staining. The members of also probed with gamma-tubulin (It was stated that antibodies against alpha-tubulin was used in the method section) as a loading control, however, the bend intensity of tubulin shows great variations among different lanes in several figures while Ponceau S staining is similar (Fig.s, 4, 5, and 8). The differences compromise the accuracy of the results.

      Reply: We apologize for the difference in Tubulin signal in some of our western blots. There are several possibilities to explain those inconsistencies between Ponceau staining and Tubulin blotting, including an effect of viral infection on Tubulin expression. To remove ambiguities around this issue, we could quantify the signal across several blot replicates and provide the quantification after normalization. In addition, we would like to stress that regarding quantification of the infection, we think that the plaque assay experiments are more reliable than quantification of western blot signals.

      3.RNA-seq analysis revealed that Dicer N1 cells have significantly increased expression levels of signaling molecules in type I IFN response even in uninfected cells. While this provides a potential explanation for the antiviral phenotype of N1-Dicer cells. I wonder why the expression levels of type I IFNs (probably the most potent antiviral molecules) were not analyzed in WT and Dicer N1 cells. Measurement of the levels of IFNα and IFNβ by ELISA in the cells before and after infection could provide the important and direct data to support their conclusion.

      Reply: This an interesting suggestion but unfortunately, we do not believe that it would possible to quantify IFNα and IFNβ by ELISA in the cell line that we used in our experiments. Indeed, the level of expression might just be too low to be able to measure something meaningful. We could measure the induction of IFNβ expression at the mRNA level by RT-qPCR though. However, we do not believe that the observed increased expression of genes that belong to the type I IFN response is solely the effect of an increased production of IFN. These genes are also under the control of other transcription factors, including NF-kB for some of them, and it might prove difficult to make a direct link with IFNα or IFNβ production.

      4.While the data presented in Fig. 5 provides convincing evidences that the antiviral activity of mediated by PKR against SINV is independent of its kinase activity in N1-Dicer cells. An interesting question is that whether antiviral activity associated with PKR is N1-Dicer dependent, which could be addressed by comparing the viral infection of NoDice∆PKR and NoDicer expressing PKR mutants.

      Reply: Yes indeed, we have generated NoDice/∆PKR cells expressing PKR WT or mutant and we will infect them with SINV to confirm whether the presence of Dicer N1 is needed for the observed phenotype.

      5.In the concluding paragraph of the discussion, the authors presented an oversimplified discerption of a complex model that involves a crosstalk between IFN-I and RNAi and Dicer-PKR interaction, which is difficult for the reader to compose a clear picture of mechanisms involved. It could be helpful to use a schematic illustration to summarize the action model of PKR incorporated with the canonical and non-canonical Dicer functions.

      Reply: We will add a schematic model in the revised version of our manuscript to summarize our main findings.

      Minor comments:

      1.It stated that NoDice FHA-Dicer WT #4 and NoDice FHA:Dicer N1 110 #6 are referred to as Dicer WT and Dicer N1 cells (p.6). For simplicity, Dicer WT and Dicer N1 cells should be used throughout manuscript, including in all figures. The labels in the figures are difficult to read and are confusing in some cases.

      Reply: This will be changed in the revised version to increase the clarity of the figures.

      2.It is to note that p-PKR was only detected at in N1-Dicer cells at 24 hpi (Fig.8A). This is an interesting observation that was not discussed. It appears that this could be due to a delayed viral replication since these cells are already in an elevated antiviral state. This possibility could be tested by examining viral replication and dsRNA accumulation at more time points in the experiments described in Fig.1.

      Reply: We have performed a kinetic of infection at more time points and we will incorporate these experiments in the revision.

      3.The authors may point out the limitations of the studies. For examples, all cells used in the study are engineered HEK cell lines and were tested with limited number of viruses. As such, the observations may reflect Dicer-PKR interaction under artificially overexpressed conditions, but how the model established from the current study applies to primary cells require further investigation.

      Reply: This is indeed important, we will add a sentence about this in the discussion.

      Reviewer #2 (Significance (Required)):

      The findings reported in this study shed some new light on a long-debated issue regarding the potential roles of RNAi as physiologically relevant antiviral mechanism in mammals. Identification of a new antiviral function of Dicer helicase domain via interaction with PKR is a new advancement of the field, and it also adds a new dimension to a complex subject that overlaps of innate immunity , RNA biology, and developmental biology associated with Dicer.

      Field of expertise: Innate immunity, cell signaling, cytokine biology

      Areas that that I do not have sufficient expertise to evaluate: Small RNA cloning, sequencing and, analysis.

      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      This work by Baldaccini et al. explores the interplay between Dicer and the antiviral protein PKR in the context of viral infection. It builds on a previous publication of the team which demonstrates that the Dicer helicase interacts with multiple RNA binding proteins, including PKR (see Montavon et al.). In this work from 2021, they demonstrate that an artificially-truncated form of Dicer (Dicer-N1) lacking part of the helicase is antiviral against RNA viruses in a PKR-dependent fashion. This was an interesting finding because the field largely assumed that Dicer-N1 performs its antiviral function via canonical dicing of dsRNA, as part of an antiviral RNAi pathway. The present manuscript follows up on this initial discovery and deciphers the specifics of Dicer-N1 antiviral phenotype, as well as delineates the interplay between Dicer's helicase and PKR. The authors main claims are as follow:

      1. i) Dicer-N1 antiviral effect does not require its catalytic activity, therefore is completely RNAi-independent.
      2. ii) Neither does it require canonical PKR activation, but relies instead on NF-kB-driven inflammation. The origin of this inflammation is not studied.
      3. ii) Truncated Dicers other than Dicer-N1 are antiviral through RNAi, but are also PKR-dependent. The authors claims are mostly supported by the data, although I suggest below some improvements regarding experimental approaches and data presentation. This work details in an interesting manner the interplay between the machinery of RNAi and the classical pathway of innate immunity (PKR). As explained by the authors, there is solid data in the literature demonstrating the mutual exclusivity of IFN and antiviral RNAi in differentiated cells. This mostly goes through the receptors LGP2, which inhibits dsRNA dicing by Dicer. The authors data suggest that, conversely, Dicer may play a role in preventing the unwanting activation of PKR (a non-canonical activation leading to inflammation). Given that PKR activation does not depend on virus, the authors discuss potential mechanisms of PKR triggering. This is an interesting topic that deserves further investigation (not necessarily within the frame of this work - it can be a follow-up). Another interesting piece of information is that different truncated Dicers behave differently with respect to implementing antiviral RNAi. Whilst Dicer-N1 isn't proficient in doing so, the other forms are. It shows that lab-generated truncations do not fully recapitulate what is observed with existing truncated Dicers (DicerO and aviD).

      Experimental design and data interpretation

      1. The authors should compare infection between different cell lines across a range of time points (ie, a virus growth curve). In Fig 4E for example, I worry that cells expressing or not PKR will reach the plateau of viral particle accumulation at different time points. One could imagine that cells lacking PKR do not show any differences in particle production at 24h, but do at earlier time points.

      Reply: This is an interesting suggestion, we can perform a kinetic experiment by looking at more time points to address this point. This will allow us to determine the time needed for every cell line to reach the plateau of infection.

      Western blots should be accompanied with proper quantifications plotted as bar graph with biological replicates (p-PKR, p-eIF2a and capsid).

      Reply: We have biological replicates for our western blot experiments, and we will quantify those to better determine the observed changes. However, in the case of p-eIF2a, we do not think it is pertinent to measure it since there are other kinases than PKR that are known to induce eIF2a phosphorylation upon SINV infection. It might therefore not prove very informative to precisely quantify this particular signal.

      Microscopy images should be properly quantified across biological replicates (Fig 1&2 for the J2 staining, for example).

      Reply: We could do a proper quantification of the J2 signal across replicates, but we do not think it would bring much to our message. Here, we mostly used J2 staining as a qualitative indication that the infection was impacted or not. We have a proper quantification of the effect with our plaque assay experiments, which are way more robust to determine the levels of infection between conditions.

      Confounding factors hinder the interpretation of siRNA accumulation (Suppl Fig 2): i) the efficiency of dsRNA dicing from different Dicers will generate different amounts of siRNAs from a given amount of dsRNA and ii) the higher antiviral response translates into decreased infection, so decreased dsRNA substrate. I suggest that the authors normalise the amount of viral siRNAs over the total amount of viral genomes. This should allow to assess if Dicer-N1 is better at dicing dsRNA than WT in these conditions.

      Reply: This is a valid concern and we agree that it is important to be able to normalize small RNA reads between conditions before reaching a conclusion. The problem is that there is no easy way to do this since we do not get a direct measurement of viral genomes accumulation from our small RNA sequencing data. To better compare the two conditions, we could normalize the individual viral siRNA to the total number of viral reads. Another problem that we face is that we are looking here at the AGO-loaded small RNAs, which makes it more difficult to assess dicing efficiency since not every generated siRNA might be loaded into an Argonaute protein. In fact, this has been proposed by the Cullen laboratory in a paper published in 2018 (Tsai et al. doi: 10.1261/rna.066332.118). They showed that although viral siRNAs were generated during IAV infection, those were inefficiently loaded and thus did not significantly impacted the infection.

      In Fig 8, the authors should verify that phospho-p65 increase depends on PKR by repeating the experiment in PKR KO cells.

      Reply: Yes, good point. We will check what happens to phosphorylation of p65 in PKR KO cells. In addition, we can also measure the effect on a known NF-kB target by RT-qPCR (e.g. PTGS2).

      Data representation

      1. Levels of phospho-PKR and eIF2a need to be normalised on the total amount of PKR and eIF2a, respectively. The authors should quantify the blots and present bar graphs with biological replicates and statistics.

      Reply: As mentioned above in our reply to point 2, we can add the quantification for phospho PKR, but we do not think it is pertinent to do it for eIF2a.

      Could the authors add the names of representative genes on the volcano plots of Fig 7?

      Reply: Yes, this will be done.

      Points of discussion

      1. In Fig 4C, catalytically-dead mutants of truncated Dicers (other than N1) do not display an antiviral effect. Presumably, such proteins implement canonical antiviral RNAi. Is there a reason why the authors interpret this data as Dicers being "partially" antiviral through RNAi (l. 92). This data instead suggest that is it totally dependent on RNAi.

      Reply: Indeed, and we do not say the contrary. It seems that some of this helicase-truncated Dicer proteins can act through RNAi. However, they also depend on PKR, so in the end it might be a combination of the two that allows their antiviral effect.

      Gurung et al. demonstrate that PKR is activated in Dicer KO mouse ES cells, which results in phosphorylation of eIF2a at steady-state. This is different from the authors' data, in which PKR activation does not affect eiF2a phosphorylation. Could the authors discuss this discrepancy?

      Reply: The problem that we face here is that SINV is known to also activate GCN2 and therefore eIF2a phosphorylation does not strictly rely on PKR in our experimental conditions. In addition, we did not check eIF2a phosphorylation in Dicer KO cells, but we always compare Dicer WT and Dicer N1 expressing cells.

      Do the authors expect that truncated Dicers other than N1 trigger an inflammatory response such as the one described for N1? Would it be possible to have this antiviral inflammatory response in conjunction with antiviral RNAi?

      Reply: This goes back to Point 1 mentioned previously. We think indeed that there might be a dual action of Dicer and that it will be important to check whether in other cellular systems or animal model such a phenomenon can be observed as well. This is a point that we did address in the discussion of our manuscript (line 522-525).

      Reviewer #3 (Significance (Required)):

      This is a study that conceptually advances the field of antiviral RNAi in mammals, including its interplay with the machinery of innate immunity. It is of interest for virologists and immunologists. My expertise is centered on the mechanisms of innate immunity in mammalian cells, including antiviral RNAi.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      This work by Baldaccini et al. explores the interplay between Dicer and the antiviral protein PKR in the context of viral infection. It builds on a previous publication of the team which demonstrates that the Dicer helicase interacts with multiple RNA binding proteins, including PKR (see Montavon et al.). In this work from 2021, they demonstrate that an artificially-truncated form of Dicer (Dicer-N1) lacking part of the helicase is antiviral against RNA viruses in a PKR-dependent fashion. This was an interesting finding because the field largely assumed that Dicer-N1 performs its antiviral function via canonical dicing of dsRNA, as part of an antiviral RNAi pathway. The present manuscript follows up on this initial discovery and deciphers the specifics of Dicer-N1 antiviral phenotype, as well as delineates the interplay between Dicer's helicase and PKR. The authors main claims are as follow:

      i) Dicer-N1 antiviral effect does not require its catalytic activity, therefore is completely RNAi-independent.

      ii) Neither does it require canonical PKR activation, but relies instead on NF-kB-driven inflammation. The origin of this inflammation is not studied.

      ii) Truncated Dicers other than Dicer-N1 are antiviral through RNAi, but are also PKR-dependent.

      The authors claims are mostly supported by the data, although I suggest below some improvements regarding experimental approaches and data presentation. This work details in an interesting manner the interplay between the machinery of RNAi and the classical pathway of innate immunity (PKR). As explained by the authors, there is solid data in the literature demonstrating the mutual exclusivity of IFN and antiviral RNAi in differentiated cells. This mostly goes through the receptors LGP2, which inhibits dsRNA dicing by Dicer. The authors data suggest that, conversely, Dicer may play a role in preventing the unwanting activation of PKR (a non-canonical activation leading to inflammation). Given that PKR activation does not depend on virus, the authors discuss potential mechanisms of PKR triggering. This is an interesting topic that deserves further investigation (not necessarily within the frame of this work - it can be a follow-up). Another interesting piece of information is that different truncated Dicers behave differently with respect to implementing antiviral RNAi. Whilst Dicer-N1 isn't proficient in doing so, the other forms are. It shows that lab-generated truncations do not fully recapitulate what is observed with existing truncated Dicers (DicerO and aviD).

      Experimental design and data interpretation

      1. The authors should compare infection between different cell lines across a range of time points (ie, a virus growth curve). In Fig 4E for example, I worry that cells expressing or not PKR will reach the plateau of viral particle accumulation at different time points. One could imagine that cells lacking PKR do not show any differences in particle production at 24h, but do at earlier time points.
      2. Western blots should be accompanied with proper quantifications plotted as bar graph with biological replicates (p-PKR, p-eIF2a and capsid).
      3. Microscopy images should be properly quantified across biological replicates (Fig 1&2 for the J2 staining, for example).
      4. Confounding factors hinder the interpretation of siRNA accumulation (Suppl Fig 2): i) the efficiency of dsRNA dicing from different Dicers will generate different amounts of siRNAs from a given amount of dsRNA and ii) the higher antiviral response translates into decreased infection, so decreased dsRNA substrate. I suggest that the authors normalise the amount of viral siRNAs over the total amount of viral genomes. This should allow to assess if Dicer-N1 is better at dicing dsRNA than WT in these conditions.
      5. In Fig 8, the authors should verify that phospho-p65 increase depends on PKR by repeating the experiment in PKR KO cells.

      Data representation

      1. Levels of phospho-PKR and eIF2a need to be normalised on the total amount of PKR and eIF2a, respectively. The authors should quantify the blots and present bar graphs with biological replicates and statistics.
      2. Could the authors add the names of representative genes on the volcano plots of Fig 7?

      Points of discussion

      1. In Fig 4C, catalytically-dead mutants of truncated Dicers (other than N1) do not display an antiviral effect. Presumably, such proteins implement canonical antiviral RNAi. Is there a reason why the authors interpret this data as Dicers being "partially" antiviral through RNAi (l. 92). This data instead suggest that is it totally dependent on RNAi.
      2. Gurung et al. demonstrate that PKR is activated in Dicer KO mouse ES cells, which results in phosphorylation of eIF2a at steady-state. This is different from the authors' data, in which PKR activation does not affect eiF2a phosphorylation. Could the authors discuss this discrepancy?
      3. Do the authors expect that truncated Dicers other than N1 trigger an inflammatory response such as the one described for N1? Would it be possible to have this antiviral inflammatory response in conjunction with antiviral RNAi?

      Significance

      This is a study that conceptually advances the field of antiviral RNAi in mammals, including its interplay with the machinery of innate immunity. It is of interest for virologists and immunologists. My expertise is centered on the mechanisms of innate immunity in mammalian cells, including antiviral RNAi.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary

      Whether RNAi is used as an antiviral mechanism in mammals has been a hotly debated issue. The research team previously published several papers on the roles of Dicer in siRNA/miRNA biogenesis and in antiviral responses. They have recently reported that the helicase domain of human Dicer specifically interacts with several proteins that are involved in the IFN response, including PKR. In this study, Baldaccini et al. investigated the involvement of Dicer in antiviral response using various mutants of human Dicer. They showed that deletion mutants of helicase domain exhibit antiviral activity that requires the presence of PKR. They further demonstrated that one of the mutants, N1-Dicer showed antiviral activity in an RNAi-independent manner but depending on the presence of either native PKR or kinase deficient mutants. Transcriptomic analysis revealed that numerous genes involved the IFN and inflammatory response were upregulated in the cells that express N1-Dicer, which is likely due to an increased activation of the NFκB pathway. Based on these findings, the authors propose that Dicer may act as antiviral molecule using its helicase domain, which representing a novel non-canonical function of Dicer.

      Major comments:

      1.The results from experiments with SARS-CoV2 are intriguing (Fig.2). The authors speculated that NFkb activation is in favor of the replication of this virus. It would be interesting to see the infection and replication of SARS-CoV2 in PKR deficient cells and cells expressing PKR mutants (as described in Fig.5). The results may prove/disapprove the authors' speculation and yield additional findings. 2. Western blot analysis. In the method section, it is stated that proteins were quantified with Bradford method and equal loading was verified by Ponceau S staining. The members of also probed with gamma-tubulin (It was stated that antibodies against alpha-tubulin was used in the method section) as a loading control, however, the bend intensity of tubulin shows great variations among different lanes in several figures while Ponceau S staining is similar (Fig.s, 4, 5, and 8). The differences compromise the accuracy of the results. 3.RNA-seq analysis revealed that Dicer N1 cells have significantly increased expression levels of signaling molecules in type I IFN response even in uninfected cells. While this provides a potential explanation for the antiviral phenotype of N1-Dicer cells. I wonder why the expression levels of type I IFNs (probably the most potent antiviral molecules) were not analyzed in WT and Dicer N1 cells. Measurement of the levels of IFNα and IFNβ by ELISA in the cells before and after infection could provide the important and direct data to support their conclusion. 4.While the data presented in Fig. 5 provides convincing evidences that the antiviral activity of mediated by PKR against SINV is independent of its kinase activity in N1-Dicer cells. An interesting question is that whether antiviral activity associated with PKR is N1-Dicer dependent,, which could be addressed by comparing the viral infection of NoDice∆PKR and NoDicer expressing PKR mutants. 5.In the concluding paragraph of the discussion, the authors presented an oversimplified discerption of a complex model that involves a crosstalk between IFN-I and RNAi and Dicer-PKR interaction, which is difficult for the reader to compose a clear picture of mechanisms involved. It could be helpful to use a schematic illustration to summarize the action model of PKR incorporated with the canonical and non-canonical Dicer functions.

      Minor comments:

      1.It stated that NoDice FHA-Dicer WT #4 and NoDice FHA:Dicer N1 110 #6 are referred to as Dicer WT and Dicer N1 cells (p.6). For simplicity, Dicer WT and Dicer N1 cells should be used throughout manuscript, including in all figures. The labels in the figures are difficult to read and are confusing in some cases. 2.It is to note that p-PKR was only detected at in N1-Dicer cells at 24 hpi (Fig.8A). This is an interesting observation that was not discussed. It appears that this could be due to a delayed viral replication since these cells are already in an elevated antiviral state. This possibility could be tested by examining viral replication and dsRNA accumulation at more time points in the experiments described in Fig.1. 3.The authors may point out the limitations of the studies. For examples, all cells used in the study are engineered HEK cell lines and were tested with limited number of viruses. As such, the observations may reflect Dicer-PKR interaction under artificially overexpressed conditions, but how the model established from the current study applies to primary cells require further investigation.

      Significance

      The findings reported in this study shed some new light on a long-debated issue regarding the potential roles of RNAi as physiologically relevant antiviral mechanism in mammals. Identification of a new antiviral function of Dicer helicase domain via interaction with PKR is a new advancement of the field, and it also adds a new dimension to a complex subject that overlaps of innate immunity , RNA biology, and developmental biology associated with Dicer.

      Field of expertise: Innate immunity, cell signaling, cytokine biology

      Areas that that I do not have sufficient expertise to evaluate: Small RNA cloning, sequencing and, analysis.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      The study largely focuses on the use of a 293 cell line that lacks a functional Dicer gene originally identified by the Cullen group. Baldaccini use this cell line, referred to as NoDice cells, to reconstitute various Dicer isoforms that have thus far been described in a variety of settings (e.g., stem cells and oocytes). Collectively, these data demonstrate the capacity of certain N-terminal truncations of Dicer to inhibit Sindbis virus and reduce the presence of viral dsRNA, supporting some of the observations made thus far concerning an antiviral role for mammalian Dicer. For other viruses, this impact was significantly more modest (SFV reduction is less than a log) or was not observed at all (VSV and SARS-CoV-2). The authors then go on to characterize the nature of the observed antiviral activity and ultimately implicate PKR and the induction of NF-kB in priming the cell's antiviral defenses. Importantly, the group also found that this antiviral activity neither required the nuclease activity of Dicer nor the kinase activity of PKR - providing evidence against antiviral RNAi in mammals. In all, the data would seem to suggest that Dicer can act as a dsRNA sensor and can mediate the activation of an NF-kB response - akin to what is observed in response to NOD or some TLR engagement. In all, it is the opinion of this reviewer that this work brings additional clarity to a concept that remains controversial in the field and therefore embodies something meaningful for the community.

      With that said, there are a few issues that require additional attention. The first of these is textual. The introduction of the paper accurately describes the evidence in support of mammalian RNAi but does not invest the same time in discussing the data to the contrary. For example, Seo et al demonstrated that virus infection results in poly-adp-ribosylation of RISC preventing RNAi activity (PMID: 24075860), Uhl et al showed that IFN-induced ADAR1 resolves dsRNA in the cell and prevents RNAi (PMID: 37017521), and Tsai et al showed that virus-derived small RNAs are not loaded into the RISC in a manner that would enable antiviral activity (PMID 29903832). None of this work is referenced in this manuscript and it generates an unbalanced introduction as it relates to the controversy surrounding the idea of RNAi in mammals.

      The second issue that would further strengthen this paper relates to the fact that the authors spend a considerable amount of time discussing the data of Figure 6 and 7 as conditions that are defined by a Dicer that can not be processive in its nuclease activity (WT) vs. one that can (N1). However, there seems to be little consideration about the fact that the introduction of WT Dicer into these cells also restores miRNA biology whereas N1 appears to remain only partially functional (based on the data of Fig 3E). Given this, it seems the authors should verify that the high baseline of NFkB signaling that is being observed when comparing WT to N1 is not a product of restored miRNA function in WT cells, in contrast to the hypotheses outlined in the manuscript. This could be addressed by silencing Drosha or DGCR8 in the Dicer knockout cells prior to their reconstitution of Dicer. In the opinion of this reviewer, this experimental control would significantly strengthen the conclusions the authors are making here.

      Significance

      In the manuscript entitled, "Canonical and non-canonical contributions of human Dicer helicase domain in antiviral defense" Baldaccini et al. describe their findings concerning the ability of certain N-terminal deletion variants of Dicer in contributing to mammalian antiviral activity. The concept of a functional antiviral RNAi system in mammals is a contentious one with many publications including data both in support of its existence and opposing this idea. In this manuscript, Baldaccini et al. perform a wide range of well-controlled experiments to specifically address aspects of those reports to both provide clarity in what has been documented thus far and to expand on those concepts further.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      Authors used organoid technology to study the effects of the serum from lupus patients on intestinal epithelium. By culturing organoids derived from human colon crypts, they specifically determined the response of epithelial cells to inflammatory mediators present in lupus serum. Using bulk and scRNA-seq, authors found that secretory cells function and differentiation were impaired as well as the mitochondrial metabolism. These effects were shown to be mediated by type 1 interferon in combination with other pro-inflammatory cytokines present in lupus serum.

      The reduction of mucus secretion after SLE-serum treatment and the downregulation of tight junctions' genes seem to indicate an increased permeability of the epithelial barrier, thus it would be interesting to determine the expression and distribution of tight junction proteins and to test in the organoids whether the paracellular permeability is increased upon SLE-serum treatment. These analyses will give a functional result of this in vitro model.

      If the organoids take a few days to culture and the material is available, the measurement of paracellular permeability may take no more than 2 weeks. It is true that they will need a microneedle to inject the FITC-Dextran 4K into the organoids and record the images for 24h.

      • We thank the reviewer for suggesting this experiment. Reviewer #2 had the same suggestion. The results obtained elevate our overall results and the quality of our research.
      • Tight junction protein expression is cell-type dependent as shown in literature1,2 and in our scRNA-seq analysis (Suppl. Table 7). Additionally, we observed that the expression changes of ZO-1(TJP1; Fig. 7A) are accumulated in colonocytes. That might be the reason we could not detect significant changes in organoid sections with staining for tight junction proteins ZO-1 and Occludin and analyzing all cell types. The data of the permeability assay however was able to show that the function of the tight junctions is altered. If this change is caused by changes in protein abundance as suggested by reported transcriptomic changes remains to be elucidated in future research using single-cell proteomic approaches.
      • For the permeability assay we stimulated organoid monolayers for 72h with SLE or control serum. The measured translocation of FITC showed an increased barrier leakiness in SLE compared to control condition. These functional results not only support our findings presented in our study that the epithelial barrier is altered upon SLE serum stimulation, but they also provide the definitive proof of concept highlighting the crucial connection between SLE and intestinal barrier integrity. Furthermore, it shows that changes on transcriptional level and alterations in cell type composition translate into a barrier dysfunction which could have potentially detrimental effects in vivo. The data has been added to Figure 1H, line 722-731; 746-751.

        I would like to know which of the donor's cells were used from figure 2 on and why.

      • Organoid line I was used for the 24h stimulation and for the 72h stimulation whereas organoid line II was used for the 72h stimulation only. Due to limitations in serum availability we had to limit the experiments that exceeded the initial transcriptomic analysis to one organoid line. After confirming that the serum was affecting both organoid lines, we continued using organoid line II.

        The bioinformatics analyses using gene expression data and scRNASeq were well done. No comments.

        Reviewer #1 (Significance (Required)):

        For the field of autoimmunity, to study the crosstalk between the systemic response and the gut epithelium response results quite important as the increased permeability of the gut epithelial barrier has been suggested to fuel the systemic inflammation in lupus. However, as the author mention, there is not enough information about the interaction of epithelial cells and the systemic inflammatory mediators in lupus. This system can be useful to determine a personalized treatment for patients by testing the effect of individual serum on organoids. Moreover, the use of organoids can be extended to study the gut epithelium response in other autoimmune diseases mediated by type 1 interferon.

        Increased permeability of the gut epithelial barrier has been related with lupus development. In humans, it is not known whether it is a cause or consequence, but in lupus mouse models it has been demonstrated that there is a reduction of the systemic autoimmune response concomitant with a reduction of gut permeability. The authors have validated an in vitro model that can be used to study how gut epithelium is affected by systemic inflammatory mediators and that will help to develop novel therapeutic approaches or personalize treatments.

      Thank you for your insightful comments. We are encouraged to see that the reviewer has accurately grasped the core purpose and implications of our research. The intricate relationship between gut epithelial barrier permeability and lupus development is indeed vital for expanding our scientific knowledge and for future therapeutic breakthroughs. We are happy that the overall message we aimed to convey with our research was well captured and appreciated by the reviewer. We believe our in vitro model will serve as a foundation for further detailed studies and for the development of therapeutic strategies in this field. Your acknowledgment of our work inspires us to persist in our research efforts.

      Interest stakeholders: Clinical and basic researchers in autoimmunity, gastroenterology, and rheumatology.

      My field of expertise is systemic and organ-specific autoimmunity at cellular and molecular level. My work covers autoimmunity and gut microbiota. I study how B cells regulate the microbiota composition and how that microbiota impacts gut permeability and inflammation in mouse lupus models. On the other hand, the bioinformatics analyses are well-done for both bulk RNASeq and scRNASeq.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      The group of Dr. Resnik-Docampo provides a very elegant study on two patient lines for SLE. The study is definitely very interesting and opens many scientific avenues that are worthy of being explored further. Major comments: -Barrier integrity or its alterations can be tested in organoids with specific dyes, I feel this would give definitive proof of concept.

      • We thank the reviewer for the suggestion. Reviewer #1 had the same suggestion. The results obtained elevate our overall results and the quality of our research.
      • For the permeability assay we stimulated organoid monolayers for 72h with SLE or control serum. The measured translocation of FITC showed an increased barrier leakiness in SLE compared to control condition. These functional results not only support our findings presented in our study that the epithelial barrier is altered upon SLE serum stimulation, but they also provide the definitive proof of concept highlighting the crucial connection between SLE and intestinal barrier integrity. Furthermore, it shows that changes on transcriptional level and alterations in cell type composition translate into a barrier dysfunction which could have potentially detrimental effects in vivo. The data has been added to Figure 1H, line 722-731; 746-751.

        -In supplementary figure 1 a caspase 3 staining is presented, please show a positive control for caspase 3 staining on organoids or alternstively use a different method to prove no differential cell death.

      • Due to the processing of the organoids it is difficult to have a positive control. However, we can confirm that the used cleaved Caspase 3 antibody is able to detect cell death by the following staining. There are positive cells in the center of the organoid where dead cells accumulate. Additionally in Figure 1C we show with a cytotoxicity assay measuring LDH release that there is no significant difference between both groups. Furthermore, brightfield imaging showed no obvious differences and the DEGs show also no evidence of increased cell death.

        -Serum from SLE patients reduces drastically Edu positivity, it would be interesting to see a clonogenicity assay to see whether this reflects on reduced stem cell clonogenic potential

      • We agree. However, this analysis goes beyond the time and material limitations we have in our project.

        -Goblet cells in the colon are very heterogeneous, which subpopulations of goblet cell are reduced? how does this affect mucus composition?

      • We see that subpopulation GC4 is significantly reduced upon SLE serum stimulation (Fig. 7C and Suppl. Fig. 7C). Overall, we see a trend of a general reduction of all GC subpopulation and an indication that there might be also a shift in subtype abundance. We would need to increase the study population to be able to draw any conclusions on how exactly the GC subpopulations change. So far not much is known about how the different GC subpopulations affect mucus composition. This field is completely understudied especially in the human intestine. Future projects should focus on mucus composition and how it is changed with changes of the subpopulations (even under physiological conditions).

      • We thank the reviewer for the question about the mucus composition. We included the analysis of FCGBP protein abundance (Fig. 4C and Suppl. Fig. 4D; line 245-247) in our study. The increased FCGBP protein abundance upon SLE serum stimulation which is in line with our transcriptomic changes complements our data and supports our hypothesis that the mucus composition is altered. This new data improves the quality of our research.

        Minor comments: - Please provide an hypothesis on how mitochondrial alterations are linked to altered lineage progeny of stem cells. This should be discussed more in depth.

      • It is known that cells in the crypt compartment that undergo rapid division depend on glycolysis for ATP production once the cell differentiates it switches to oxidative phosphorylation.3 In vitro it has been shown that differentiation coincides with the switch to oxidative phosphorylation.4 There is a complex interplay between Notch signaling and FoxO transcription factors which is driving differentiation and cell fate decision.5 Especially the differentiation towards the secretory lineage highly depends on the metabolic switch from glycolysis to oxidative phosphorylation. Furthermore, even mucus secretion itself is dependent on oxidative phosphorylation.6 This is in line with our differentiation experiment where less oxidative phosphorylation coincided with the absence of goblet cells. We hypothesize that the changed cellular composition upon SLE serum stimulation is at least partly reflected in the altered mitochondrial function. If the decrease in the secretory lineage alone can explain the seen mitochondrial changes needs to be further elucidated. While a detailed examination at single-cell level analysis of mitochondrial function might be able to answer if they drive the altered cell differentiation, such an in-depth analysis is beyond the scope of this article and would be best addressed in a dedicated study on the topic. Within the scope of our analysis and considering the still limited knowledge of mitochondrial function in specific cell types of the human colon we included some more discussion (line 696-698 and 702-703).

        -Many antimicrobial peptides are changed, this could reflect on microbiome composition as well as mucus composition and properties, which I am sure will be the topic of future studies. This should be discussed more in depth.

      • We hypothesize that the alterations in antimicrobial peptide expression along with the seen changes in major mucus components would be translated into changes in mucus composition. Since the mucus serves as the niche for gut microbiota this could lead to changes in microbiome composition. It is of high interest to analyze the mucus composition of the stimulated organoids. Furthermore, assays analyzing the killing capacity of the potentially secreted antimicrobial peptides could help us to understand the relevance of the observed changes. We addressed this in line 714-715 and line 750-752.

        Reviewer #2 (Significance (Required)):

        The study is useful for both broad and specialized audiences. The findings are interesting and of relevance to the field of SLE, gut epithelial biology. The strength of the manuscript is that it opens many scientific avenues, its weakness is that they are not mechanistically dissected to the fullest rendering the study a bit descriptive. Nonetheless, I consider positively the manuscript after a minor revision given the major message of the paper can be proven.

      Thank you for your constructive feedback. We are genuinely encouraged by your recognition of the utility and relevance of our study for both broad and specialized audiences in the fields of SLE and gut epithelial biology. Your acknowledgment resonates with our larger objectives: beyond merely exploring the specific connection between SLE and intestinal leakiness, our aim has been to create a methodological approach that illuminates novel avenues to study complex diseases. It is deeply heartening to realize that this overarching message and intent were clearly understood and agreed upon by the reviewer. We recognize and appreciate your insights into the strengths and areas for improvement of our manuscript, and we are committed to addressing the highlighted points to further enhance our contribution to the field.

      __ Reviewer #3 (Evidence, reproducibility and clarity (Required)):__

      Inga Viktoria Hensel et al. used colon organoid to study the impact of lupus patients' serum on gut epithelial barrier. The exposure of SLE serum on colon organoids increased gene expression related to cell cycle, chromosome organization, mitochondrial function as well as interferon signaling, but downregulated that related to secretion, cytoskeleton, and anchoring junctions of the cells. Higher type I IFN in the SLE serum and unregulated interferon signature genes post stimulation suggest a potential role of type I interferon in this process. The addition of a type 1 interferon receptor (IFNAR1) antagonist, Anifrolumab, blocked the stimulation function of SLE serum but the combination of IFN-2α and control serum failed to recapitulate the results from SLE serum, suggesting that more than one cytokine was involved. SLE serum exposure altered metabolic profiles of organoids with a significant increase of basal respiration and ATP production. Stimulating organoid with SLE serum confirmed an alteration in cell differentiation with a loss of secretory lineage. scRNA-seq analysis revealed that colon organoid had all major cell types from colon in vivo. SLE serum stimulation shifted cell differentiation with decreased number of goblet cells and downregulated mucin, AMP and other components that were required for gut barrier integrity.

      Finally, the authors performed a gene expression analysis of colon biopsies derived from SLE patients and healthy controls. While the authors should be commended to attempt a validation of the results obtained with organoids, the small sample size and patient heterogeneity prevented a statistical analysis. Some genes involved in absorption and ion transport as well as secretory lineage showed a similar trend with organoid assay, suggesting that colon organoids may be a good tool for future studies. However, it is noticeable that the biopsies from SLE patients did not show the IFN signature and the decreased in Muc2 expression, which dominated the gene signature of organoids exposed to SLE serum. There is no information about the disease activity of the SLE patients, as well as their IFN activity, which makes difficult to interpret these results.

      • We thank the reviewer for the questions and suggestions. They helped us to improve our manuscript and make it more concise for the reader.

      Specific concerns: 1. Line 107, Why did The authors use 72 hours post treatment. Are other timepoints available and have similar results?

      • We used two different time points, 24h and 72h. The nature of the organoid culture limits the total length of the experiment. Organoids can be cultured for a maximum of 5-7 days. Differentiation from the stem cell to the fully differentiated cell takes 5-7 days. Preliminary results showed that serum stimulation prior to day 2 led to a decrease in organoid survival, most likely because serum stimulation in general induces differentiation. We therefore chose 72h as the stimulation that mimics a chronic exposure as a differentiating cell would face in vivo. With this time span we were able to see manifestations in cell differentiation changes but avoided beginning cell death to prolonged culture. However, we also wanted to understand a more acute exposure to the serum. Therefore, we chose 24h as a second stimulation duration. With this time point we were able to detect initial changes in cell fate decision which was important in the interpretation of the accumulated effects seen after 72h.

      Figure 1D, how do the authors explain the heterogeneity among SLE samples (2, 3, 4, 5) on organoid line II? These samples do not seem to correlate with cytokine levels shown in Fig. 2. This issue may be worth exploring further, such as correlation between cytokine levels and gene expression.

      • The heterogeneity seen among the SLE samples most likely reflects the complex composition of the serum itself. A similar heterogeneity (PC1 axis) is also seen for the controls. The epithelial cells eventually will react to all contained factors showing an integrated response that makes it difficult to correlate to a single cytokine.

      Line 144, the 2 outlier SLE serum samples are not same between organoid lines with NO. 1&5 in Organoid line II and with NO. 1&4 in Organoid line I. The statement is misleading.

      • We corrected the statement according to the suggestions (Line 146-148).

      Line 169, IFN-a2 and IL-6 are not significantly different.

      • The statement was rephrased (Line 166-174).

      Line 179-180, Reduced fitness of organoids exposed to SLE serum is an overstatement. It was not directly tested, and there is no difference in apoptosis.

      • The term ‘reduced fitness’ referred to the results seen in the mitochondrial stress test. We rephrased the parts to make the statement more concise (Line 182).

      Line 242-243: SLE serum stimulation induced MUC2 high expression in Organoid II but lower level in organoid I (Figure 4B & Figure S4C). This is a major discrepancy that needs to be addressed.

      • This discrepancy comes from the different differentiation dynamics observed in both organoid lines. Therefore, for the downstream analysis we considered the results from both lines to have a robust analysis. With the results from the 24h timepoint and the scRNA-seq which were performed with either of the lineages respectively, we can be certain that the overall seen effect on the secretory lineage is a valid finding (we addressed this in line 229-232).

      Line 251-252: How do authors make sure that "we were facing an effect on the differentiation process rather than cell type loss"?

      • We can exclude an increase of cell death since we did not see changes in LDH release (Fig. 1C) and cleaved Caspase 3 abundance (Suppl. Fig. 1A) when we compared both conditions. Additionally, the data from the 24h stimulation time point showed the reduction of transcription factors (Fig. 4J) important for differentiation which manifested in a reduction of secretory cell markers upon longer stimulation (72h) (edited statement in line 256-258).

      Line 259, How about apoptosis gene levels here?

      • Apoptosis markers BAX and BCL2 are not amongst the differentially expressed genes. (see Suppl. Table 4).

      Line 290 : It has been shown that the response of colon explants to IFN-α was variable among donors (https://www.sciencedirect.com/science/article/pii/S2352345X16301084#undfig1). This study should be cited. Was the response to IFNa tested on both organoids?

      • The reference was included (Line 669-671). The response to IFNα was only tested in organoid line II given the limited availability of the serum that was used for co-stimulation. Overall, however, we saw an effect in both donor lines and less response was rather connected to the serum, not the organoid donor. In the publication reported interindividual heterogeneity depends on the therewith connected release of IL-18. Future studies could include analysis of cytokine release from the organoids after serum stimulation and a higher number of organoid lines to validate our findings.

      Line 305-307: Is single cell sequencing from single organoid line or from combined? Do two organoid lines show different distributions?

      • scRNA-seq was performed using organoid line II. Due to limited resources, we unfortunately could not include another organoid line.

        Reviewer #3 (Significance (Required)):

        While there is mounting evidence of an altered intestinal barrier integrity in SLE patients, there is little insights in the mechanisms. Using colon organoids is a novel approach with great potentials to investigate this issue. The strongest signature found by the authors was type IFN, which is indicates that the colon epithelial cells respond in a similar manner to other cell types. The secretory and absorption genes are of potential greater interest to unraveling mechanisms to gut alteration in SLE. This study is of interest for audiences interested in lupus basic and clinic research, as well as investigators working of gut barrier integrity.

      Thank you for your constructive feedback. We are encouraged by your acknowledgment of our novel approach using colon organoids to explore the altered intestinal barrier integrity in SLE patients. Your emphasis on the significance of the type IFN signature and the importance of secretory and absorption genes aligns with our perspective.

      Incorporating the intestinal barrier functional experiment emphasizes the translational nature of our study. We agree with your view that our findings are relevant for those involved in both basic and clinical lupus research, as well as specialists in intestinal biology. Your encouraging feedback strengthens our conviction in the wider significance of our work. We are motivated to keep bridging the gap between these two essential areas of study.

      References

      1. Pearce, S. C. et al. Marked differences in tight junction composition and macromolecular permeability among different intestinal cell types. BMC Biol. 16, 1–16 (2018).
      2. Kishida, K., Pearce, S. C., Yu, S., Gao, N. & Ferraris, R. P. Nutrient sensing by absorptive and secretory progenies of small intestinal stem cells. Am. J. Physiol. Liver Physiol. 312, G592–G605 (2017).
      3. Rath, E., Moschetta, A. & Haller, D. Mitochondrial function — gatekeeper of intestinal epithelial cell homeostasis. Nat. Rev. Gastroenterol. Hepatol. 15, 497–516 (2018).
      4. Rodríguez-Colman, M. J. et al. Interplay between metabolic identities in the intestinal crypt supports stem cell function. Nature 543, 424–427 (2017).
      5. Ludikhuize, M. C. et al. Mitochondria Define Intestinal Stem Cell Differentiation Downstream of a FOXO/Notch Axis. Cell Metab. 32, 889-900.e7 (2020).
      6. Sünderhauf, A. et al. Loss of Mucosal p32/gC1qR/HABP1 Triggers Energy Deficiency and Impairs Goblet Cell Differentiation in Ulcerative Colitis. Cmgh 12, 229–250 (2021).
    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Inga Viktoria Hensel et al. used colon organoid to study the impact of lupus patients' serum on gut epithelial barrier. The exposure of SLE serum on colon organoids increased gene expression related to cell cycle, chromosome organization, mitochondrial function as well as interferon signaling, but downregulated that related to secretion, cytoskeleton, and anchoring junctions of the cells. Higher type I IFN in the SLE serum and unregulated interferon signature genes post stimulation suggest a potential role of type I interferon in this process. The addition of a type 1 interferon receptor (IFNAR1) antagonist, Anifrolumab, blocked the stimulation function of SLE serum but the combination of IFN-2α and control serum failed to recapitulate the results from SLE serum, suggesting that more than one cytokine was involved. SLE serum exposure altered metabolic profiles of organoids with a significant increase of basal respiration and ATP production. Stimulating organoid with SLE serum confirmed an alteration in cell differentiation with a loss of secretory lineage. scRNA-seq analysis revealed that colon organoid had all major cell types from colon in vivo. SLE serum stimulation shifted cell differentiation with decreased number of goblet cells and downregulated mucin, AMP and other components that were required for gut barrier integrity.

      Finally, the authors performed a gene expression analysis of colon biopsies derived from SLE patients and healthy controls. While the authors should be commended to attempt a validation of the results obtained with organoids, the small sample size and patient heterogeneity prevented a statistical analysis. Some genes involved in absorption and ion transport as well as secretory lineage showed a similar trend with organoid assay, suggesting that colon organoids may be a good tool for future studies. However, it is noticeable that the biopsies from SLE patients did not show the IFN signature and the decreased in Muc2 expression, which dominated the gene signature of organoids exposed to SLE serum. There is no information about the disease activity of the SLE patients, as well as their IFN activity, which makes difficult to interpret these results.

      Specific concerns:

      1. Line 107, Why did The authors use 72 hours post treatment. Are other timepoints available and have similar results?
      2. Figure 1D, how do the authors explain the heterogeneity among SLE samples (2, 3, 4, 5) on organoid line II? These samples do not seem to correlate with cytokine levels shown in Fig. 2. This issue may be worth exploring further, such as correlation between cytokine levels and gene expression.
      3. Line 144, the 2 outlier SLE serum samples are not same between organoid lines with NO. 1&5 in Organoid line II and with NO. 1&4 in Organoid line I. The statement is misleading.
      4. Line 169, IFN-a2 and IL-6 are not significantly different.
      5. Line 179-180, Reduced fitness of organoids exposed to SLE serum is an overstatement. It was not directly tested, and there is no difference in apoptosis.
      6. Line 242-243: SLE serum stimulation induced MUC2 high expression in Organoid II but lower level in organoid I (Figure 4B & Figure S4C). This is a major discrepancy that needs to be addressed.
      7. Line 251-252: How do authors make sure that "we were facing an effect on the differentiation process rather than cell type loss"?
      8. Line 259, How about apoptosis gene levels here?
      9. Line 290 : It has been shown that the response of colon explants to IFN-α was variable among donors (https://www.sciencedirect.com/science/article/pii/S2352345X16301084#undfig1). This study should be cited. Was the response to IFNa tested on both organoids?
      10. Line 305-307: Is single cell sequencing from single organoid line or from combined? Do two organoid lines show different distributions?

      Significance

      While there is mounting evidence of an altered intestinal barrier integrity in SLE patients, there is little insights in the mechanisms. Using colon organoids is a novel approach with great potentials to investigate this issue. The strongest signature found by the authors was type IFN, which is indicates that the colon epithelial cells respond in a similar manner to other cell types. The secretory and absorption genes are of potential greater interest to unraveling mechanisms to gut alteration in SLE. This study is of interest for audiences interested in lupus basic and clinic research, as well as investigators working of gut barrier integrity.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      The group of Dr. Resnik-Docampo provides a very elegant study on two patient lines for SLE. The study is definitely very interesting and opens many scientific avenues that are worthy of being explored further.

      Major comments:

      • Barrier integrity or its alterations can be tested in organoids with specific dyes, I feel this would give definitive proof of concept.
      • In supplementary figure 1 a caspase 3 staining is presented, please show a positive control for caspase 3 staining on organoids or alternstively use a different method to prove no differential cell death.
      • Serum from SLE patients reduces drastically Edu positivity, it would be interesting to see a clonogenicity assay to see whether this reflects on reduced stem cell clonogenic potential
      • Goblet cells in the colon are very heterogeneous, which subpopulations of goblet cell are reduced? how does this affect mucus composition?

      Minor comments:

      • Please provide an hypothesis on how mitochondrial alterations are linked to altered lineage progeny of stem cells. This should be discussed more in depth.
      • Many antimicrobial peptides are changed, this could reflect on microbiome composition as well as mucus composition and properties, which I am sure will be the topic of future studies. This should be discussed more in depth.

      Significance

      The study is useful for both broad and specialised audiences. The findings are interesting and of relevance to the field of SLE, gut epithelial biology. The strength of the manuscript is that it opens many scientific avenues, its weakness is that they are not mechanistically dissected to the fullest rendering the study a bit descriptive. Nonetheless, I consider positively the manuscript after a minor revision given the major message of the paper can be proven.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Authors used organoid technology to study the effects of the serum from lupus patients on intestinal epithelium. By culturing organoids derived from human colon crypts, they specifically determined the response of epithelial cells to inflammatory mediators present in lupus serum. Using bulk and scRNA-seq, authors found that secretory cells function and differentiation were impaired as well as the mitochondrial metabolism. These effects were shown to be mediated by type 1 interferon in combination with other pro-inflammatory cytokines present in lupus serum.

      The reduction of mucus secretion after SLE-serum treatment and the downregulation of tight junctions' genes seem to indicate an increased permeability of the epithelial barrier, thus it would be interesting to determine the expression and distribution of tight junction proteins and to test in the organoids whether the paracellular permeability is increased upon SLE-serum treatment. These analyses will give a functional result of this in vitro model.

      If the organoids take a few days to culture and the material is available, the measurement of paracellular permeability may take no more than 2 weeks. It is true that they will need a microneedle to inject the FITC-Dextran 4K into the organoids and record the images for 24h.

      I would like to know which of the donor's cells were used from figure 2 on and why.

      The bioinformatics analyses using gene expression data and scRNASeq were well done. No comments.

      Significance

      For the field of autoimmunity, to study the crosstalk between the systemic response and the gut epithelium response results quite important as the increased permeability of the gut epithelial barrier has been suggested to fuel the systemic inflammation in lupus. However, as the author mention, there is not enough information about the interaction of epithelial cells and the systemic inflammatory mediators in lupus. This system can be useful to determine a personalized treatment for patients by testing the effect of individual serum on organoids. Moreover, the use of organoids can be extended to study the gut epithelium response in other autoimmune diseases mediated by type 1 interferon.

      Increased permeability of the gut epithelial barrier has been related with lupus development. In humans, it is not known whether it is a cause or consequence, but in lupus mouse models it has been demonstrated that there is a reduction of the systemic autoimmune response concomitant with a reduction of gut permeability. The authors have validated an in vitro model that can be used to study how gut epithelium is affected by systemic inflammatory mediators and that will help to develop novel therapeutic approaches or personalize treatments.

      Interest stakeholders: Clinical and basic researchers in autoimmunity, gastroenterology, and rheumatology.

      My field of expertise is systemic and organ-specific autoimmunity at cellular and molecular level. My work covers autoimmunity and gut microbiota. I study how B cells regulate the microbiota composition and how that microbiota impacts gut permeability and inflammation in mouse lupus models. On the other hand, the bioinformatics analyses are well-done for both bulk RNASeq and scRNASeq.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We thank the reviewers to appreciating the depth and quality of the results presented in our manuscript. We are happy that he/she has appreciated our contemporary approach to addressing an important problem but also a thorny and debated topic in the field that has lasted for over 30 years since it was first proposed by Mike Berridge. Our work not only addresses mechanisms in cultured human cells but also for the very first time addresses the key problem of Li action in the human brain using human iPSC derived forebrain cortical neurons.

      We are delighted with the reviewer’s comment that “This effort highlighted the author's commendable goal to develop a thoughtful story and not just another publication.” We thank the reviewer for appreciating our detailed multi-disciplinary approach to addressing a long standing (> 4 decades) problem of key significance in human psychiatry and neuroscience. We thank him/her for noting that the work deserves to be presented in a journal with a cross-disciplinary focus. A few technical points that have been noted by the reviewer have been addressed below. Most of these can be effectively addressed by modest rewriting of text to make certain points clearer. The one experiment that has been suggested can be done and will be completed within 1 month.

      1. Description of the planned revisions

      Reviewer #1 (Evidence, reproducibility and clarity):

      The authors functionally define in the inositol monophosphate phosphatase IMPA1, as the true target of lithium regulating phosphatidylinositol turnover and calcium signalling. While the observed IMPA1 inhibition by lithium led to the historical 'inositol depletion hypothesis' over the past 30+ years were published evidence both in support and against this concept. These contradictory sets of results have led to decreased interest in phosphoinositides as the signalling pathway affected by the therapeutic action of lithium in bipolar disorder (BD) patients. The remarkable results shown here will revert this trend since the data clearly demonstrate a key role of IMPA1 in setting the rate of phosphatidylinositol turnover, and consequentially the extent of calcium signalling. While the data are consistent with the 'inositol depletion hypothesis' the authors do not prove or disprove the validity of this hypothesis since the actual levels of inositol were not measured in their experiments. However, this is not a criticism, since quantifying cellular inositol is complex, it is just a suggestion for future work. After clarifying the points listed below this work will be suitable for publication.

      • The experiments using inositol rich DMEM (reported on page 17 and in Fig 2I,J) require a better explanation and an adequate material and method section. It is not clear if the 'normal/control' condition uses inositol-free DMEM. The standard concentration of inositol in DMEM is 40uM. Thus, are the ~155uM (28 mg/litre) added by the authors at the high end of the 40uM? Given that FBS contains inositol have the authors used dialyzed serum? While adding 155uM of inositol on either inositol-free medium or to medium containing 40uM inositol does not alter the author's message, this technical information are important for the reproducibility of the data presented and to understand how HEK293T manages inositol homeostasis.

      The standard concentration of inositol in DMEM high Glucose media (Dulbecco’s Modified Eagle Medium; Life Technologies) is 40 µM (7 mg/ litre) and our HEK293T cells were maintained under standard conditions at (37oC, with 5% CO2) in this media, supplemented with 10% Foetal bovine serum (FBS). This FBS was not dialyzed, so it might contain trace amounts of inositol.

      For our inositol rich DMEM, 117 μl of 100 μM of inositol (18 mg/ml) was added to 100 ml of DMEM high Glucose media, supplemented with 10% FBS- this led to the final effective concentration of inositol in the media ~155 µM (28 mg/ litre). This media was referred to as the inositol rich media and used for the inositol supplementation in Fig. 2I-J.

      Therefore, the inositol supplementation we refer to is effectively raising the extracellular inositol concentration from ca. 40mm to 155mM which is 3X elevation. This information has been added to the results section.

      • It would be helpful to know if store operated calcium entry is altered in impa1-/--M1 cells. This information would nicely complement Fig.3 C-E data.

      We have studied store operated calcium entry in IMPA1-/- cells and it is decreased. The quantification of this reduction can be added to the paper.

      • In the Introduction at the end of page 4, the evidence not supporting the inositol depletion hypothesis is correctly discussed. This section lacks the discussion of another work questioning this theory (PMID: 30171184). The conclusion of this work is also in agreement with the authors finding that lithium affects the rare/turnover (lines 490/506) of PIP2 synthesis.

      Saiardi A, Mudge AW. Lithium and fluoxetine regulate the rate of phosphoinositide synthesis in neurons: a new view of their mechanisms of action in bipolar disorder. Transl Psychiatry. 2018 Aug 31;8(1):175. doi: 10.1038/s41398-018-0235-2. PMID: 30171184.

      This paper suggests that lithium mediated inhibition of IMPase leads to an accumulation of IP1 and this elevated IP1 leads to a competitive inhibition of the rate of synthesis of PI, and hence turnover of PIP2. Combined with lithium’s inhibition of inositol uptake, this inhibition of PI synthesis can lead to the mood stabilizing effect of lithium, rather than the inositol depletion. This point will be added to our manuscript and the reference cited.

      • In the material and methods, Liquid Chromatography Mass spectrometry is abbreviated to LCMS while in the main text (line 493) LC-MS is used. The dashed version should be used throughout the manuscript.

      Liquid Chromatography Mass spectrometry will be abbreviated to LC-MS throughout the text in the revised version.

      • I suggest to define (line 500) phosphatidylinositol 4-phosphate as (PI(4)P simplified as PIP). This will be consistent with the phosphatidylinositol 4,5-bisphosphate abbreviation as (PIP2) as reported in the introduction (line 97)

      PIP refers to all the functional isoforms of Phosphatidylinositol phosphate- PI 3P, PI 4P and PI 5P. By the LC-MS/MS analysis, we had measured the total PIP masses but we cannot distinguish between the individual functional isomers of PIP. However, pre-existing literature suggests that PI 4P is the most abundant isoform of PIP present in cell- its level is approximately 50 folds higher than that of PI 5P (Rameh et al., 1997). Hence we can suggest that the change in the total mass of PIP (as seen by the LC-MS/MS) is mainly reflective of the PI 4P.

      • Line 646: Instead of using [this study] the authors should refer to the Figure panels supporting the discussed argument.

      The identity of the channels mediating Ca2+ transients in this system was shown by us in Sharma et al., 2020. In the revision, we will cite this paper.

      Referees cross-commenting

      Reviewer #2 main message is identical to my. The work is a "contemporary re-evaluation of the inositol depletion hypothesis" but it does settle the debate. Say that reviewer #2 also recognises the importance of the work in defining IMPA1 as the only lithium target affecting the PI cycle removing GSK3 from the picture. Additionally, we agree that the thorough transcriptional analysis of the effect of lithium on human cortical neurons will be very informative for any researcher interested in psychiatric disorders.

      Reviewer #2 requests are rational and not demanding. Most queries require extra information or the reformatting of the data presented.

      Reviewer #1 (Significance):

      The submitted manuscript addresses an important topic. The authors developed HEK293 stable expressing muscarinic receptor to study the effect of lithium (without or after receptor activation) on PI(4,5)P2 turnover using two approaches, by microscopy and biochemically by LC-MS. These analyses were followed by a thorough characterization of the effect of lithium on calcium signalling. The generation of HEK293 impa1-/- line has allowed the authors to demonstrate that the observed effect of lithium on PI(4,5)P2 turnover and calcium signalling were IMPA1 dependent. The authors pushed the work to a higher level by studying the effect of lithium on iPSC-derived human cortical neurons demonstrating that lithium reduces neurons excitability and calcium signalling. Although previously published attempts failed to generate IMPA1 deficient human cortical neurons the authors managed to produce iPSC impa1-/- but, as reported and consistent with previous literature, this cell line failed to differentiate into neurons. This effort highlighted the author's commendable goal to develop a thoughtful story and not just another publication. The work is complemented by a very informative transcriptional analysis characterising the effect of lithium on human cortical neurons. Noteworthy is also the author's efforts to functionally and transcriptionally define the effect of another lithium target, GSK-3. These experiments emphasize that GSK-3 does not phenocopy the effect of lithium. This is another utterly important message of the paper.

      In conclusion, the authors presented an easily readable, comprehensive, and experimentally convincing story. Furthermore, the developed experimental tools (HEK293-m1AchR) and the extensive data set (transcriptomic analysis) will be instrumental to further studies aimed at elucidating mechanistically how phosphoinositide signalling affects BD pathophysiology.

      Reviewer #2 (Evidence, reproducibility and clarity):

      This manuscript seeks to test if inhibition of the phosphoinositide (PI) cycle is the relevant pathway targeted by lithium in bipolar affective disorder (BPAD). Firstly, a cultured model system (HEK293T) is used to test the effects of lithium on the PI cycle. Using PI(4,5)P2 probes along with mass spectrometry, Li is shown to inhibit PI(4,5)P2 re-synthesis after PLC activation, though not to perturb pre-stimulus levels. Release of calcium from intracellular stores along with refilling from extracellular calcium is also inhibited - though there are no effects on stored calcium capacity. Crucially, with the exception of the calcium refilling step, these effects if Li can be abolished by genetic ablation of IMPA1, the proposed molecular target of Li. Having established the affected pathway, the manuscript then studies the effects of Li treatment on iPSC-differentiated cultured cortical neurons. Spontaneous and muscarinic evoked calcium transients are shown to be abolished by Li. None of these effects in HEK293T or neurons can be recapitulated by an inhibitor of GSK3beta, another proposed target for Li. Finally, a transcriptomic analysis of Li treated neurons is presented, showing down regulation of relevant genes, especially genes involved in neuronal calcium signaling and glutamatergic signaling.

      The inositol depletion hypothesis has been debated for nearly four decades. As it stands, this manuscript does not settle this debate once and for all, but it does add some novel and important insights: that 1) IMPA1 is certainly the target of lithium, at least in terms of the PI cycle and 2) Lithium treatment can lead to longer-term transcriptional changes in neuronal calcium and glutamatergic signaling that can dampen excitability. The paper is on the whole clearly written, and the data are easy to follow. That said, there are a number of areas where the manuscript is lacking key details, or where the results do not fully support the conclusions. Specific suggestions for amendment are as follows:

      (1) The PH-PLCdetla1 PH domain has been used to follow PI(4,5)P2 turnover in HEK293T cells. Although long established, the manuscript does not discuss the fact that this domain also binds to IP3, which given high enough concentrations, can compete the PH domain off the membrane. As such, what is being measured is the convolution of PI(4,5)P2 decreases and IP3 increases (see for example doi: 10.1083/jcb.200301070 ). Ideally, a non-IP3 binding probe would have been used, such as the Tubby c-terminal domain (doi: 10.1186/1471-2121-10-67; doi: 10.1113/jphysiol.2008.153791). As it stands, the failure of the PH domain to return to the membrane after Li treatment reported in figures 1G, 3F and 3L could either be due to a failure of PI(4,5)P2 re-synthesis, or a failure to breakdown IP3 - either of which are plausible explanations given inhibition of IMPA1. This concern is somewhat mitigated by the inclusion of mass determinations of the lipids in figure 1H-J, which support the PI(4,5)P2 re-synthesis defect. However, the potential problems with interpretation of the data with the PH domain should be discussed.

      PH-PLCδ-GFP probe is used in the field as a biosensor for PI 4,5-P2 (Chakrabarti et al., 2015; Várnai and Balla, 1998) and has been used to monitor the PIP2 turn-over rate. However, as the reviewer has pointed out, this probe also has an affinity towards IP3 (Xu et al., 2003) and therefore the failure of the probe to return to the plasma membrane could also, in principle, reflect the accumulation of IP3.

      We are well aware of this discussion in the field and to make sure that our measurements using the PH-PLCδ-GFP probe are indeed a true reflection of PIP2 re-synthesis , we have also used a biochemical method to establish the levels of PIP2. Our measurements of the total mass of PIP2 by LC-MS/MS corroborate our findings using the probe, on the delay in PIP2 resynthesis. Nonetheless, we will explicitly mention this point in the discussion.

      Drawback of the Tubby c-terminal domain-

      Most of the biosensors for PI 4,5-P2 have distinctive advantage and disadvantages- PH-PLCδ-GFP probe is a more sensitive reporter but its IP3 binding may compromise its accuracy to measure PI 4,5-P2 changes. However, the Tubby c-terminal domain has exhibited lower sensitivity to report on changes of PI 4,5-P2 during PLC activation, although being more specific in its affinity towards PI 4,5-P2 (Szentpetery et al., 2009). Furthermore, recent studies have revealed that Tubby c-terminal domain can also bind to PI 3,4-P2 as well as PI 3,4,5-P3 (Hammond and Balla, 2015). Lastly a very recent study has noted that in contrast to PH-PLCδ-GFP probe, the tubby domain binds selectively to certain domains of the plasma membrane at membrane contact sites making it not a detector of PIP2 levels across the plasma membrane (Thallmir et,al., 2023, PMCID: PMC10445746 DOI: 10.1242/jcs.260848 ).

      (2) The strongest evidence for the effects of IMPA1 inhibition coming from inositol depletion are given by the experiment reported in figure 2I and J, where inositol supplementation rescues calcium mobilization. This should also be performed for the PIP2 re-synthesis experiments.

      We thank the reviewer for this suggestion.

      We will perform this experiment and add the results to the revised manuscript. Duration estimated for this experiment- 30 days.

      (3) It is implicit in the manuscript that DMEM does not contain inositol. This is not true; Life technologies' formulation for DMEM contains 40 micromol/l myo-inositol, which is sufficient to support activity of both proton/myo-inositol and sodium/myo-inositol symporters (HMIT and SMIT). On the face of it, therefore, inositol depletion seems unlikely. The reviewer wonders what concentration of added inositol mediated the rescue? This key fact is missing from the manuscript. At the very least, the details should be included and the reason for rescue of already inositol replete cells discussed. Ideally, the key experiments would be repeated with inositol-free medium and supplementation.

      Repeated cycles of GPCR linked PLC signalling depend on a stable and on a continuous supply of PIP2 at the cell membrane, which in turn depends on the cytoplasmic pool of inositol in the cell. Inositol pool can be maintained by three avenues- via the recycling of the inositol by the stepwise dephosphorylation of IP3, de novo synthesis of inositol from glucose 6-phosphate and the transport of inositol from the extracellular environment across the plasma membrane. Li inhibits IMPase, an enzyme that dephosphorylates inositol monophosphate to generate free inositol.

      Due to Li’s inhibition of IMPase, the inositol pool cannot be regenerated by the first two avenues since both of them need IMPase. However, restriction of the inositol pool by Li’s inhibition of IMPase can be bypassed by the transport of inositol from the extracellular media via SMIT (Sodium-dependent myo-inositol co-transporter) and/or HMIT (Proton-dependent myo-inositol co-transporter). At steady state, the low amount of inositol in the DMEM media (the inositol concentration in normal DMEM media being approximately 7 mg/litre or 40 µM) might be sufficient for maintaining the inositol pool and thereby PIP2 levels at the steady state. But this amount of inositol in the DMEM media appeared to be limiting to sustain the inositol pool and thereby PIP2 levels under conditions of hyperactivated PIP2 cycle. This is likely the reason why Li mediated inositol depletion (by inhibition of IMPA1) leads to a decreased rate of PIP2 synthesis at the plasma membrane as well as decreased PLC mediated Ca2+ release, in the background of activated PLC.

      However, when the cells were grown in an inositol rich DMEM media (inositol concentration is ca. 28 mg/litre or approximately 155 µM; which is similar to the inositol concentration in the cerebrospinal fluid (Swahn, 1985; Shetty et al., 1996)); transport of extracellular inositol by SMIT/HMIT could sustain a continuous level of PIP2 levels even in a PLC activated background. This explains the rescue of the decreased PLC mediated Ca2+ release phenotype in the control-M1 cells grown in inositol supplemented DMEM despite the Li treatment.

      This section can be added to the Results section (page 17) in the revised version.

      (4) The introduction refers to lithium as a "non-competitive" inhibitor of IMPA1. This is erroneous, as lithium is in fact an uncompetitive inhibitor. This is a key distinction: since the uncompetitive inhibitor blocks the enzyme:substrate complex, it is most effective where substrate accumulates the most - in this context, sites of intense PLC activity. This was central to Berridge's inositol depletion hypothesis. Also, the Allison et al citation is incorrect here. The correct citation is PMID: 2833231.

      Li inhibits IMPA1 in an uncompetitive manner.

      This will be corrected in the revised version of the manuscript, with the appropriate references.

      Ref cited by reviewer- Gee NS, Ragan CI, Watling KJ, Aspley S, Jackson RG, Reid GG, Gani D, Shute JK. The purification and properties of myo-inositol monophosphatase from bovine brain. Biochem J. 1988 Feb 1;249(3):883-9. doi: 10.1042/bj2490883. PMID: 2833231; PMCID: PMC1148789.

      Ref- Hallcher LM, Sherman WR. The effects of lithium ion and other agents on the activity of myo-inositol-1-phosphatase from bovine brain. J Biol Chem. 1980 Nov 25;255(22):10896-901. PMID: 6253491.

      (5) other key experimental details are missing from the figures/figure legends/results and or methods. Namely, what concentration of carbachol was used? What was the optimum concentration of thapsigargin? For figure 2 B-C, was carbachol used to evoke calcium mobilization?

      For the agonist mediated Ca2+ release, 20 µM of carbachol was used. This is mentioned in the Materials and Methods section (line 238); however, we will mention this in the figure legends and results for clarity, in the revised version.

      For the store depletion in the SOCE experiments, 10 µM of thapsigargin was used. This is mentioned in the Materials and Methods section (line 249); however, we will mention this in the figure legends and results for clarity.

      In Fig. 2B, C, Carbachol was used to evoke calcium mobilization in the cells. This is mentioned in the Results section (line 510)- we will mention this in the figure legends for clarity.

      (6) The effects of IMPA1 knockout and rescue in figure 3F are rather unconvincing. All treatment groups' means fall within 1 SD; are the changes statistically significant? Plotting 95% C.I. or standard error may be more informative for these experiments.

      This can be addressed in the revised version.

      Minor comments:

      () There are some inconsistencies in the figure panels. Arrows labelled "CCh" are used to denote CCh addition in e.g. Fig. 3D, whereas simple arrows are used elsewhere e.g. Fig. 3F or no arrow at all e.g. Fig. 3B.

      All the points where CCh has been added to stimulate PLC will be denoted with an arrow labelled Cch for clarity and consistency. This will be addressed in the revised version.

      () Details of what the error denotes is missing in Figs. 2B-C, 3B-C, F - as is N for 3A.

      Whiskers in box plots show the minimum and maximum values with a line at the median. This will be addressed in the revised version.

      () Fig. 2D: It should be made explicit that arrows indicate TTX addition in the figure. More importantly, it should be clarified whether this is also the case for Fig. 5D? Transients do not appear to be depleted by this addition.

      This has been mentioned in the figure legends for the figure (line 1077)- we will address this in the revised version.

      Few of the neuronal transients are not abolished by TTX- this variability can be addressed by other representative traces.

      () In figure 6C, it is stated that "there was no down regulation in transcripts for SCN1A (Nav1.1) or SCN9A (Nav7.1)" but this is not strictly true from the data; the Li-treated cells definitely trend lower. The effect is clearly not statistically significant, so although it is not possible to state that they reduced, this is not the same thing as being able to assert that they are not reduced. Perhaps it could be more helpful to plot the size of the reduction between these transcripts?

      This will be addressed as- “there was no significant downregulation in transcripts for SCN1A (Nav1.1) or SCN9A (Nav7.1)".

      The difference in the transcript level for SCN1A (Nav1.1) or SCN9A (Nav7.1) can be plotted for further clarification.

      Reviewer #2 (Significance):

      The manuscript is ultimately a contemporary re-evaluation of the inositol depletion hypothesis for Li treatment of BPAD, first proposed by Berridge in 1989. The manuscript certainly does not end the debate - other pathways and mechanisms for lithium's actions on a complex human behavioral phenotype will surely persist. However, it does add some important new insights: firstly, that IMPA1 is certainly the target mediating the effects of Li on the PI cycle; and secondly, that long-term, Li may exert effects at the transcriptional level to down regulate calcium and glutamatergic signaling in the brain. However, there is no mechanism presented to link these two findings. The work is therefore of interest to researchers with an interest on studying psychiatric disorders, basic mechanisms of neuronal excitability as well as molecular mechanisms of cell signaling. It therefore deserves to be published in a journal with a cross disciplinary focus.

      2. Description of the revisions that have already been incorporated in the transferred manuscript

      Please insert a point-by-point reply describing the revisions that were already carried out and included in the transferred manuscript. If no revisions have been carried out yet, please leave this section empty.

      3. Description of analyses that authors prefer not to carry out

      Nil

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      This manuscript seeks to test if inhibition of the phosphoinositide (PI) cycle is the relevant pathway targeted by lithium in bipolar affective disorder (BPAD). Firstly, a cultured model system (HEK293T) is used to test the effects of lithium on the PI cycle. Using PI(4,5)P2 probes along with mass spectrometry, Li is shown to inhibit PI(4,5)P2 re-synthesis after PLC activation, though not to perturb pre-stimulus levels. Release of calcium from intracellular stores along with refilling from extracellular calcium is also inhibited - though there are no effects on stored calcium capacity. Crucially, with the exception of the calcium refilling step, these effects if Li can be abolished by genetic ablation of IMPA1, the proposed molecular target of Li. Having established the affected pathway, the manuscript then studies the effects of Li treatment on iPSC-differentiated cultured cortical neurons. Spontaneous and muscarinic evoked calcium transients are shown to be abolished by Li. None of these effects in HEK293T or neurons can be recapitulated by an inhibitor of GSK3beta, another proposed target for Li. Finally, a transcriptomic analysis of Li treated neurons is presented, showing down regulation of relevant genes, especially genes involved in neuronal calcium signaling and glutamatergic signaling.

      The inositol depletion hypothesis has been debated for nearly four decades. As it stands, this manuscript does not settle this debate once and for all, but it does add some novel and important insights: that 1) IMPA1 is certainly the target of lithium, at least in terms of the PI cycle and 2) Lithium treatment can lead to longer-term transcriptional changes in neuronal calcium and glutamatergic signaling that can dampen excitability. The paper is on the whole clearly written, and the data are easy to follow. That said, there are a number of areas where the manuscript is lacking key details, or where the results do not fully support the conclusions. Specific suggestions for amendment are as follows:

      1. The PH-PLCdetla1 PH domain has been used to follow PI(4,5)P2 turnover in HEK293T cells. Although long established, the manuscript does not discuss the fact that this domain also binds to IP3, which given high enough concentrations, can compete the PH domain off the membrane. As such, what is being measured is the convolution of PI(4,5)P2 decreases and IP3 increases (see for example doi: 10.1083/jcb.200301070 ). Ideally, a non-IP3 binding probe would have been used, such as the Tubby c-terminal domain (doi: 10.1186/1471-2121-10-67; doi: 10.1113/jphysiol.2008.153791). As it stands, the failure of the PH domain to return to the membrane after Li treatment reported in figures 1G, 3F and 3L could either be due to a failure of PI(4,5)P2 re-synthesis, or a failure to breakdown IP3 - either of which are plausible explanations given inhibition of IMPA1. This concern is somewhat mitigated by the inclusion of mass determinations of the lipids in figure 1H-J, which support the PI(4,5)P2 re-synthesis defect. However, the potential problems with interpretation of the data with the PH domain should be discussed.
      2. The strongest evidence for the effects of IMPA1 inhibition coming from inositol depletion are given by the experiment reported in figure 2I and J, where inositol supplementation rescues calcium mobilization. This should also be performed for the PIP2 re-synthesis experiments.
      3. It is implicit in the manuscript that DMEM does not contain inositol. This is not true; Life technologies' formulation for DMEM contains 40 micromol/l myo-inositol, which is sufficient to support activity of both proton/myo-inositol and sodium/myo-inositol symporters (HMIT and SMIT). On the face of it, therefore, inositol depletion seems unlikely. The reviewer wonders what concentration of added inositol mediated the rescue? This key fact is missing from the manuscript. At the very least, the details should be included and the reason for rescue of already inositol replete cells discussed. Ideally, the key experiments would be repeated with inositol-free medium and supplementation.
      4. The introduction refers to lithium as a "non-competitive" inhibitor of IMPA1. This is erroneous, as lithium is in fact an uncompetitive inhibitor. This is a key distinction: since the uncompetitive inhibitor blocks the enzyme:substrate complex, it is most effective where substrate accumulates the most - in this context, sites of intense PLC activity. This was central to Berridge's inositol depletion hypothesis. Also, the Allison et al citation is incorrect here. The correct citation is PMID: 2833231.
      5. other key experimental details are missing from the figures/figure legends/results and or methods. Namely, what concentration of carbachol was used? What was the optimum concentration of thapsigargin? For figure 2 B-C, was carbachol used to evoke calcium mobilization?
      6. The effects of IMPA1 knockout and rescue in figure 3F are rather unconvincing. All treatment groups' means fall within 1 SD; are the changes statistically significant? Plotting 95% C.I. or standard error may be more informative for these experiments.

      Minor comments:

      • There are some inconsistencies in the figure panels. Arrows labelled "CCh" are used to denote CCh addition in e.g. Fig. 3D, whereas simple arrows are used elsewhere e.g. Fig. 3F or no arrow at all e.g. Fig. 3B.
      • Details of what the error denotes is missing in Figs. 2B-C, 3B-C, F - as is N for 3A.
      • Fig. 2D: It should be made explicit that arrows indicate TTX addition in the figure. More importantly, it should be clarified whether this is also the case for Fig. 5D? Transients do not appear to be depleted by this addition.
      • In figure 6C, it is stated that "there was no down regulation in transcripts for SCN1A (Nav1.1) or SCN9A (Nav7.1)" but this is not strictly true from the data; the Li-treated cells definitely trend lower. The effect is clearly not statistically significant, so although it is not possible to state that they reduced, this is not the same thing as being able to assert that they are not reduced. Perhaps it could be more helpful to plot the size of the reduction between these transcripts?

      Significance

      The manuscript is ultimately a contemporary re-evaluation of the inositol depletion hypothesis for Li treatment of BPAD, first proposed by Berridge in 1989. The manuscript certainly does not end the debate - other pathways and mechanisms for lithium's actions on a complex human behavioral phenotype will surely persist. However, it does add some important new insights: firstly, that IMPA1 is certainly the target mediating the effects of Li on the PI cycle; and secondly, that long-term, Li may exert effects at the transcriptional level to down regulate calcium and glutamatergic signaling in the brain. However, there is no mechanism presented to link these two findings. The work is therefore of interest to researchers with an interest on studying psychiatric disorders, basic mechanisms of neuronal excitability as well as molecular mechanisms of cell signaling. It therefore deserves to be published in a journal with a cross disciplinary focus.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      The authors functionally define in the inositol monophosphate phosphatase IMPA1, as the true target of lithium regulating phosphatidylinositol turnover and calcium signalling. While the observed IMPA1 inhibition by lithium led to the historical 'inositol depletion hypothesis' over the past 30+ years were published evidence both in support and against this concept. These contradictory sets of results have led to decreased interest in phosphoinositides as the signalling pathway affected by the therapeutic action of lithium in bipolar disorder (BD) patients. The remarkable results shown here will revert this trend since the data clearly demonstrate a key role of IMPA1 in setting the rate of phosphatidylinositol turnover, and consequentially the extent of calcium signalling. While the data are consistent with the 'inositol depletion hypothesis' the authors do not prove or disprove the validity of this hypothesis since the actual levels of inositol were not measured in their experiments. However, this is not a criticism, since quantifying cellular inositol is complex, it is just a suggestion for future work. After clarifying the points listed below this work will be suitable for publication.

      The experiments using inositol rich DMEM (reported on page 17 and in Fig 2I,J) require a better explanation and an adequate material and method section. It is not clear if the 'normal/control' condition uses inositol-free DMEM. The standard concentration of inositol in DMEM is 40uM. Thus, are the ~155uM (28 mg/litre) added by the authors at the high end of the 40uM? Given that FBS contains inositol have the authors used dialyzed serum? While adding 155uM of inositol on either inositol-free medium or to medium containing 40uM inositol does not alter the author's message, this technical information are important for the reproducibility of the data presented and to understand how HEK293T manages inositol homeostasis.<br /> It would be helpful to know if store operated calcium entry is altered in impa1-/--M1 cells. This information would nicely complement Fig.3 C-E data.<br /> In the Introduction at the end of page 4, the evidence not supporting the inositol depletion hypothesis is correctly discussed. This section lacks the discussion of another work questioning this theory (PMID: 30171184). The conclusion of this work is also in agreement with the authors finding that lithium affects the rare/turnover (lines 490/506) of PIP2 synthesis.<br /> In the material and methods, Liquid Chromatography Mass spectrometry is abbreviated to LCMS while in the main text (line 493) LC-MS is used. The dashed version should be used throughout the manuscript.<br /> I suggest to define (line 500) phosphatidylinositol 4-phosphate as (PI(4)P simplified as PIP). This will be consistent with the phosphatidylinositol 4,5-bisphosphate abbreviation as (PIP2) as reported in the introduction (line 97)<br /> Line 646: Instead of using [this study] the authors should refer to the Figure panels supporting the discussed argument.

      Referees cross-commenting

      Reviewer #2 main message is identical to my. The work is a "contemporary re-evaluation of the inositol depletion hypothesis" but it does settle the debate. Say that reviewer #2 also recognises the importance of the work in defining IMPA1 as the only lithium target affecting the PI cycle removing GSK3 from the picture. Additionally, we agree that the thorough transcriptional analysis of the effect of lithium on human cortical neurons will be very informative for any researcher interested in psychiatric disorders.

      Reviewer #2 requests are rational and not demanding. Most queries require extra information or the reformatting of the data presented.

      Significance

      The submitted manuscript addresses an important topic. The authors developed HEK293 stable expressing muscarinic receptor to study the effect of lithium (without or after receptor activation) on PI(4,5)P2 turnover using two approaches, by microscopy and biochemically by LC-MS. These analyses were followed by a thorough characterization of the effect of lithium on calcium signalling. The generation of HEK293 impa1-/- line has allowed the authors to demonstrate that the observed effect of lithium on PI(4,5)P2 turnover and calcium signalling were IMPA1 dependent. The authors pushed the work to a higher level by studying the effect of lithium on iPSC-derived human cortical neurons demonstrating that lithium reduces neurons excitability and calcium signalling. Although previously published attempts failed to generate IMPA1 deficient human cortical neurons the authors managed to produce iPSC impa1-/- but, as reported and consistent with previous literature, this cell line failed to differentiate into neurons. This effort highlighted the author's commendable goal to develop a thoughtful story and not just another publication. The work is complemented by a very informative transcriptional analysis characterising the effect of lithium on human cortical neurons. Noteworthy is also the author's efforts to functionally and transcriptionally define the effect of another lithium target, GSK-3. These experiments emphasize that GSK-3 does not phenocopy the effect of lithium. This is another utterly important message of the paper.

      In conclusion, the authors presented an easily readable, comprehensive, and experimentally convincing story. Furthermore, the developed experimental tools (HEK293-m1AchR) and the extensive data set (transcriptomic analysis) will be instrumental to further studies aimed at elucidating mechanistically how phosphoinositide signalling affects BD pathophysiology.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In this work, the authors generate a multi-omic dataset (RNA, proteomic and metabolomic) from fibroblast cell-lines of human and bat origins, in study of the specific differences in bat that allows them to have a good cancer resistance and longevity. They specifically focus on metabolic differences between humans and bats. They perform differential analysis followed by GO enrichment analysis to highlight differences related to the electron transport chain both at the level of RNA and protein abundance. They then use FBA sampling and specific constraints to propose an hypothesis of reverse direction of the second complex of the ETC, as well as better resistance to ROS, which they support with several subsequent experiments.

      Overall, the paper is very well written, the findings are presented clearly and efficiently. For the most part, the assumption and limits of the study are clearly stated by the author (notably with respect to the limits of using only cell lines). In my opinion, the goal of the paper, which is presented as a stepping stone into further characterisation of the metabolic differences between human and bat for potential oncological research benefits, is clearly stated and appropriate.

      There are however several points that I think are important to address inorder to improve the quality of the scientific work and its interest for the rest of the scientific community.

      Major

      The authors state:<br /> "We then set the lower bound of the PaLung Complex I reaction flux to a value equal to 70% of its theoretical maximum. Similarly, we set the upper bound of the WI-38 Complex I reaction at a value equal to 30% of its theoretical maximum value. This ensured that the PaLung model would have higher flux through the Complex I reaction, in comparison to the WI-38 model."

      How do the results hold with different thresholds ? Are these findings robust with e.g. in ranges between 10 to 50% (90-50%) (instead of only 30% and 70%). Furthermore, the histogram figures doesnt seem to reflect a 70% of maximum lower bound for complex I (threshold at a value of 30 seems like extremity of tail).

      Number of differentially expressed genes is extremely high because such cutoffs are not really meaningful given the comparison between two organisms. No need to refer to the 6247 above cutoff as differentially regulated genes (see: https://elevanth.org/blog/2023/07/17/none-of-the-above/ and https://daniel-saunders-phil.github.io/imagination_machine/posts/if-none-of-the-above-then-what/ for pointers toward current best practice in biological statistics). Enough to simply note that 6247 are above the cutoffs, which suggest a drastic (and expected) difference in expression profiles between the two organisms.

      Please highlight the RNA and proteomic analysis assumption and present results within those boundaries (e.g. how are the transcript matched between human and bat, the use of human gene ontologies, etc...). Are the human GO set definitions relevant in bat (it is a common practice with mice and rats, are bats close ?)?

      Are oxphos and hypoxia responses the most extreme pathway scores in the GSEA ? Instead of barcode plots that are generally not a very useful use of figure space, use fig 1C to show the top e.g.20 (positive and negative) pathway scores so that we can see how much those two actually stand out. Same for the proteomic analysis. Also, need to show an unbiased side by side comparison of the pathway enrichments for RNA and proteomic, the reported results in main text and figures are too cherry picked to be of interest as they stand.

      Finally, and very importantly, please upload ALL the code used for the analysis, with instructions to run it and all the required inputs and source files. The computational analysis is only as credible as it is easy to reproduce.

      Minor

      Introduce GeTMM, what are its key specificities ?

      Fig 1C code bar plot useless, simply report ES and NES and pathway absolute rank in text.

      Report Foldchange/p-value/rank of complex-I members and other genes of interest for the narrative of the paper.

      Referees cross-commenting

      I also think the comments from the other reviewers are appropriate.

      Significance

      In my opinion, the goal of the paper, which is presented as a stepping stone into further characterisation of the metabolic differences between human and bat for potential oncological research benefits, is clearly stated and appropriate.

      Broadly interesting for oncological research.

      My espertise is multi-omic data analysis and integration with prior knowledge in the context of complexe diseases.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Jagannathan et al. performed a multi-omics comparative analysis between fibroblast cells from bats of the species P. alecto and humans. Using a combination of transcriptomics, proteomics and metabolomics, the authors showed differences in central metabolism between the cells of the two species. Specifically, the authors noted higher expression of Complex I components of the electron transport chain, as well as low activity of the Complex II. The computational modeling suggested that the latter is indicative of a state resembling the state of ischemia. Furthermore, the expression of antioxidant components was interpreted as higher in the bat compared to human cells, which is in accordance with previous reports.

      Overall, it is a comprehensive multi-omics approach performed with a very interesting biological object, such as a bat. However, some aspects, especially the part of bioinformatic analysis, needs to be enhanced. The existence of differences in mitochondrial metabolism is also not surprising, given the evolutionary distance and very different ecology and lifestyle between the two species, but a more mechanistic follow-up would be of greater interest. Nevertheless, it is the first study using integrated omics approach of that sort done on bats.

      Major:

      1. The authors compared a fibroblast cell line derived from adult bats with a human embryonic cell line. Please discuss whether mitochondrial metabolism in embryonic cells might be different and how it could have affected the obtained results. Please describe in more detail how the cells were established, what population doubling they were used at (both bat and human cells). Were the cells cultured in atmospheric oxygen or low-oxygen conditions. The exposure of cells to atmospheric oxygen might affect the many mitochondrial parameters measured in this study and could influence the main finding about ischemic-like state. Additionally, please mention in the limitations of the study that only biological n=1 was compared (since cells only from 1 individual per species was used in experimental groups), despite n=3 technical replicates.
      2. Reference genomes for bats are not as well annotated as for human. Downregulation of a pathway may result from some genes being excluded from the analysis because of poor annotation of the P. Alecto genome compared to human. The authors state: "Genes with counts per million (CPM) < 1 in more than 3 out of 6 samples were discarded from downstream analysis". So, if the gene was not annotated, was it assigned a zero value and discarded? Was it discarded if it was zero in one species (e.g. bat) or set to 0? If such genes were excluded, while in reality not being mapped, they could have skewed the pathway analysis.
      3. All conclusions are based on high-throughput data, however it is accepted that some validation should be provided. Please provide qPCR or WB (if good antibodies are available) validation for several most significantly differentially expressed genes supporting the pathways identified in Figure 2 (preferably supporting the conclusions about Complexes I/II).
      4. The major findings of this paper were based on the omic data, followed by some experimental validations. However, the quality of these omic data or the results are not solid enough to motivate the authors to validate these findings. For example, both of the GO terms enriched by the DEGs in Fig.1 are not the top terms as claimed by the authors (not even significant after multiple test correction). Also, even though the 2 GO terms in Fig.2 are quite significant, the expression pattern seems not very consistent among the replicates, which make the enrichments not so solid. This highlights an inconsistency among different omic datasets, which may generate some conflicting results. For example, the low level of metabolites from TCA cycle (Fig.4c) seems not consistent with the high level of TCA-related protein, as described in Fig.2c & d. For the purpose of improving the manuscript quality, the authors may have to evaluate the consistency among the multiple omic datasets or to optimize their bioinformatic pipeline to enhance the results.
      5. The dominant up-regulation of complex I in ETC is interesting and is the main finding of this paper. However, no experimental evidence was provided to prove the greater activity of Complex I, for example, metabolites changes. In addition, the genes encoding proteins belong to ETC complex I, II, III and IV vary a lot, with much more genes encoding complex I. Therefore, the author should consider the background gene number when they compare the up-regulated gene number differences in each complex. For example, a fisher-exact test could be done to see if complex I has significantly more genes been up-regulated than a random expectation.
      6. If the main findings of this paper can be further confirmed by additional experiments or data, it will be a very nice paper. This could be a potential mechanism that bats used to switch metabolism modes between two metabolic extremes: flight and hibernation, which require high and low energy. However, the usage of only the lung fibroblasts of human and bat may limit the ability of generalizing this 'ischemic-like state' of ETC in most of the bats tissue/organs. While I agree what the authors mentioned in the discussion section, that to extend to primary cells of other species can help generalize this finding, studying the metabolism state of different cell type of bats (e.g., muscle cells responsible for flight; myocytes and neurons for hibernation) probably can provide more insights into the evolution of various interesting phenotypes of bats.

      Minor:

      • the author may have to add the p value or FDR for each GSEA plot, even though some of the FDR are not significant. Also, it will be better to show the normalized enrichment score (NES) instead of the ES.
      • the gene set name in several supplementary tables contains many '%' characters and those needs to be removed.
      • in Line 302, "...combined with the earlier findings of downregulated OxPhos expression and low OCR, we conclude...". If my understanding is right, the authors only mentioned the up-regulation of Oxphos expression, instead of down-regulation. This sentence may need to be clarified.
      • How did mitochondrial DNA content per cell compared between the two species? Could the results be affected by the number and size of the mitochondria per cell in each species? An indirect measurement of mitochondrial DNA yield in the fractionation experiment would be the total DNA amount that was obtained in mitochondrial fractions per cell lysed.

      Significance

      The work is significant considering the limitations stated above. This may be considered a pilot study of brand significance.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary

      In this study, the authors conducted a multi-omics analysis comparing cells from the long-lived bat, Pteropus alecto, and human cells. Their findings revealed that bat cells express higher levels of mitochondrial complex I components and exhibit a lower rate of oxygen consumption. Moreover, computational modeling suggested that the activity of complex II in bat cells might be low or even reversed, similar to the conditions observed during ischemia. The decrease in central metabolites and the increased ratio of succinate to fumarate in bat cells might indicate an ischemia-like metabolic state. Despite having high mitochondrial ROS levels, bat cells exhibit higher levels of total glutathione and a higher ratio of NADPH to NADP. Additionally, bat cells showed resistance to glucose deprivation and induction of ferroptosis.

      Major comments

      1. Regarding Figure 1A, the authors mention 'n = 3' for a single cell line. Does this refer to three different passages or three independent experiments? Please provide a more detailed description to clarify.
      2. In relation to Figures 1C and 1D, the authors state in the figure legend that the 'GSEA analysis identifies Respiratory electron transport and Cellular response to hypoxia as the top metabolic pathways that are differentially regulated between PaLung and WI-38 cells.' (Lines 140-144). However, the criteria for selecting these terms as the top metabolic pathways is not clear. In the lists in Supplementary Tables 2 and 3, the authors' proposed term, 'Respiratory electron transport,' is ranked 126th, and 'Cellular response to hypoxia' is ranked 79th. Conversely, terms related to the TCA cycle are ranked 66th and 82nd, and another term that seems to be related to hypoxia, 'OXYGEN-DEPENDENT PROLINE HYDROXYLATION OF HYPOXIA-INDUCIBLE FACTOR ALPHA,' is ranked 62nd. Could the authors please provide a clarification for their choice of 'Respiratory electron transport' and 'Cellular response to hypoxia' as the top metabolic pathways?
      3. In the Materials and Methods section (lines 419-421), the authors mention, 'GSEA was run against the complete Gene ontology biological process (GO BP) gene set list (containing 18356 gene sets).' However, they narrow down the gene dataset for analysis (lines 136-138, 'we filtered our gene dataset to contain only genes listed under the Gene ontology category Cellular Metabolic Process (GO ID:0044237), resulting in a truncated list of 4794 genes.'). I'm concerned that this selective approach might introduce bias into the resultant pathways. Is this selective approach commonly employed in this type of analysis? And isn't there a need for adjustments to avoid potential bias?
      4. The authors noted that the number of differentially expressed genes (DEGs) is quite high (6,247 out of 14,986) as per lines 134-135, stating that "The number of differentially expressed genes (6,247) was extremely high, suggesting that multiple pathways are differentially regulated between the two species." However, this large number of DEGs could indicate either an improper correction procedure or a need for a more stringent threshold. The authors should address this issue to avoid potential misinterpretation of the results.
      5. In Figure 2B, the samples labeled as W1 and P1 appear to be outliers. This raises questions about the integrity of the sampling or analysis process. Please describe about this.
      6. Regarding the GSEA analysis of Fig. 2, they are using the full set of GSEA. However, this reviewer is wondering if this is appropriate when analyzing mitochondrial fractions, as I believe using the entire GSEA set could introduce a bias. Is this a common approach? Shouldn't the authors be focusing on mitochondrial-related sets within the GSEA, and then determining the upregulated and downregulated pathways from there?
      7. The authors describe in lines 195-197, "GSEA-flagged upregulation in OxPhos was driven mostly by the upregulation of Complex I subunits, for both the proteomic and transcriptomic data (Figure 2G, Supplementary Figure S1D)." However, within this analysis, the number of genes composing each subgroup of the mitochondrial Complexes are 44 for Complex I, 4 for Complex II, 10 for Complex III, and 19 for Complex IV (https://www.genenames.org/data/genegroup/#!/group/639). The authors mention that the genes of Complex I were dominant in the ETC, but, might this just be reflecting the original difference in the number of genes? As this reviewer believes this could have a significant impact on the authors' current claims, this reviewer suggest the authors to carefully reconsider this point, comparing the actual results with the proportion expected from the difference in gene numbers. (Even in Fig. S1D, it appears to correlate with the number of genes: C1 39.3%, C3 10.7%, C4 10.7%, C2 3.5%)
      8. As pointed out in Major Point 7, if the authors' claim of enrichment in Complex I is indeed due to the large number of genes included in the Complex I subgroup (https://www.genenames.org/data/genegroup/#!/group/639), can the assumption of High Complex I flux truly be considered valid? In that case, this constraints model would become inappropriate, and the validity of the inferred low or reverse activity of Complex II would be diminished. Therefore, a careful re-examination is desirable.
      9. (option, takes about 1-2 months). This reviewer believes that the authors' most important claim, concerning the high activity of Complex I and the low activity of Complex II, lacks strong evidence as no biochemical data of the activities of each mitochondrial complex are presented to substantiate this. Unless additional biochemical experimental data is provided, the assertions should be toned down. While the abstract mentions "complex II activity may be low or reversed," it is stated with certainty in line 108 of the introduction, "associated with the low or reverse activity of Complex II." Based on the present data, this reviewer believes that the claim remains speculative. Therefore, I suggest moderating the overall argument or adding the biochemical data. While the results from metabolomics are supportive, they do not serve as direct evidence.
      10. Regarding Figure 5, the title of the figure states "lower antioxidant response", but it doesn't seem that the data in the figure actually shows a lower antioxidant response.
      11. In lines 109-110 of the Introduction, the authors state, "we confirmed our prediction of ischemic-like basal metabolism in PaLung cells by characterizing the response of bat cells to cellular stresses such as oxidative stress, nutrient deprivation, and a type of cell death related to ischemia, viz. ferroptosis." However, can the assertion that the cells are in an ischemic-like state be confirmed simply because they are resistant to several types of cellular stress?

      Minor points:

      1. The authors mention the use of cufflinks/Tophat for mapping/quantification. However, support for these software programs has ended and the creators of these programs themselves recommend using the successor programs. I recommend re-analysis using a more current pipeline (such as HISAT2/StringTie, STAR/RSEM, etc.). Furthermore, the transcriptomics section of the methods should also include the program used for cleaning and trimming.
      2. As for the Oxygen Consumption Rate (OCR) data presented in Figure 2F, it makes sense that it's low at the basal level. However, it's perplexing that it is also low even under uncoupled conditions, especially considering the high energy demand associated with flight in this species. Could the authors provide their interpretation on this apparent contradiction?
      3. In line 156, the authors mention that 'Profiling detected a total of 1,469 proteins.' Please provide more details in the explanation. Specifically, does this total of 1,469 proteins represent a combined count from both humans and bats, or is this the number of proteins for which orthologs could be identified in both species, just like the authors did with the transcript results.
      4. In Supplementary Table 4, only 127 mitochondrial proteins are listed out of the 405 proteins mentioned in "Of these 405 proteins, we identified 127 to be core mitochondrial proteins (lines 161-163)". As there is no explanation for this within Supplementary Table 4, it would be better to include one.
      5. In line 472, the phrase "GO BB gene set list" is used. Could this potentially be a typographical error, and should it instead be "GO BP gene set list"?
      6. In the volcano plot of Fig. S3B, it appears that the side with lower P/W values generally corresponds with lower p-values. I wonder if there might have been any oversight or mistake in the data analysis process that could explain this observation?
      7. In lines 249-252, it is stated, "The low or negative flux values for Complex II in our PaLung simulations indicate that the electrons obtained from Complex I may accumulate at Complex II or potentially even get consumed by Complex II operating in reverse (bypassing the rest of the ETC) in PaLung cells." However, isn't the basic process of electron transfer done through Complex I-III-IV, independent of Complex II?
      8. Regarding Figure 4F, the authors state, 'PaLung cells displayed higher viability than WI-38 cells after glucose deprivation (Figure 4F).' However, in addition to the cell images, it would be beneficial to perform experimental quantification of cell death to provide more rigorous data. Additionally, the cells appear to be over-confluent, which might influence the results. Also, scale bars should be included in all photos, including Fig. 6.
      9. Regarding Figure 5B, it is stated that 'the expression levels of differentially expressed antioxidant genes' are shown, but it includes those that are not significant. It would be helpful if the authors could clarify how this gene set was selected.
      10. Regarding Figure 6C, the values for total glutathione seem to significantly differ from those in Figure 5C. An explanation for this discrepancy would be appreciated to ensure the consistency and reliability of the data.

      Referees cross-commenting

      I think the comments from the other reviewers are appropriate.

      Significance

      Collectively, these intriguing results from the interspecies comparison provide novel insights into the differences in metabolism and cellular characteristics between bat and human cells. However, the study has some limitations, notably certain weaknesses in the data and potential overstating of certain interpretations. Addressing these issues would enhance the overall quality and robustness of the manuscript. Furthermore, if feasible, conducting a biochemical analysis of each mitochondrial complex activity would solidify the authors' main conclusions.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary:

      This paper provides an elegant investigation into the dysmorphology of skeletal structures upon loss of the extracellular Fraser Complex through use of a zebrafish fras1 mutant. The adult phenotypes of this mutant had not been previously explored in detail. The authors use transgenics, histological staining and immunostaining to visualize the morphological defects, then examine Fraser Complex localization and effects on Shh signaling upon loss of Fras1. They analyse both steady state and regeneration contexts. Most importantly, they demonstrate the blistering that has been shown to occur in larval fins, also occurs during regeneration of the adult fins, and that there is a disorganization of the pre-osteoblasts due to basement membrane corruption. This work provides novel investigation into how Fraser Complex leads to skeletal defects.

      Major comments:

      Overall the data presented by the authors is logical and very well presented. They make reasonable claims that are supported by sound experimentation. Statistics are used appropriately and the authors combine different approaches to make their points. For example they draw on previous single cell RNA-seq Data sets to define the cell type expressing Fraser complex components but then also use immunostaining and ins situ hybridisation to localise expression domains. I thought the analysis using the ptch1:kaede line to be particularly elegant and informative.

      My first major question relates to Figure 7. The authors cage their analysis under the impetus of understanding how the distal anomalies and skeletal defects in Fraser Syndrome arise in development. They present convincing images of distal blistering during regeneration. Were similar blisters seen at any stage during adult fin development prior to the full fin formation? The authors might have noted this during their imaging of the ptch1 reporter Figure 6 Supplement 1. Or they might need to look earlier. Figure 7 is informative analysis. It's a shame to limit it to regeneration and not look during adult fin formation which would have direct inferences for human development.

      Secondly, was osteoblast morphology affected as well as their patterning in the fras1 mutants? Perhaps the authors could look at zns-5 antibodies or sp7:egfp line in transverse cryosections to assess if there was a change in osteoblast morphology. Figure 5B' certainly suggests they might be more cuboidal and have lost their flattened shape. This change in osteoblast morphology has been noted in other ECM mutants affecting the lepidotrichia.

      Minor comments:

      I have only a few minor comments.<br /> Line 55 Introduction. For clarity change this sentence to "variable expressivity and incomplete penetrance reminiscent of the variability seen in distal limb defects in humans with Fraser Syndrome."

      Referring to Figure 2, is each fin ray thicker in fras1 mutants than in WT? It appears so but might be just an optical illusion. Would be easy to measure and state in the text.

      Line 242, 243 and Figure 5. The text refers to Fig 5C' and Fig 5D', but I could only find Fig 5C' and Fig 6C'. Do you mean E, F??

      Related you claim that in fras1 mutants, frem2 protein remains intracellular. How do you know that protein signal is intracellular yet in the WT it is extracellular? Please reword this or show more conclusively. This is also repeated on line 360 in the discussion.

      Fig 6B, D are not referred to in the main text.

      I couldn't find details of the Runx2 antibody in the materials and methods

      Significance

      This paper provides novel insights into how loss of Fraser Complex might alter morphology of post-embryonic structures, and gives novel, visual indication of the effect basement membrane disruption has on osteoblast patterning. This will give novel guidance to explaining the basis of skeletal presentations of Fraser Syndrome for basic researchers interested in the importance of osteoblast environment on patterning and clinicians examining similar rare skeletal congenital syndromes.

      It elegantly demonstrates that cellular topology, organisation and morphology is just as important as signalling in defining organ growth and shape. The authors also suggest this model of an indirect disruption of osteoblast patterning might explain why there is such variability in distal skeletal phenotype severity in Fraser patients. This is a valid and reasonable hypothesis.

      My background directly relates to mutant analysis of zebrafish fins

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary:

      In this manuscript, Robbins et al. develop the adult zebrafish caudal fin as a model for limb deformities in Fraser syndrome. They show that the zebrafish fras1 mutant can survive to adulthood and investigate how loss of fras1 influences the caudal fin during its regeneration. The fin ray branching defects and chondral bone defects examined in this study show a degree of variability akin to many defects found in Fraser syndrome, including limb defects. The paper is an easy read, has beautiful imaging, and shows compelling quantification. As such, the authors set up the zebrafish fras1 mutant caudal fin as a novel and interesting platform to investigate the onset and variability of limb defects in Fraser syndrome.

      Major comments:

      Figure 7 makes some critical claims based solely on H&E staining; better markers are needed. I also strongly recommend that the authors repeat this Figure 7 experiment with immunolabel or other techniques that mark the epithelial and mesenchymal layers distinctly. In particular, since the author's discussion focuses on osteoblast positioning, it seems important to mark the osteoblasts alongside the epithelium.

      The authors posit that background mutations explain Fraser syndrome variation, but it's worth also considering non-genomic origins of variation, including potential micro-environmental differences and/or stochasticism. The caudal fin seems like an ideal system to test the idea - one could injure the fin and test how well initial defects predict defects after regeneration. It looks like the authors started to do so in panel 3R, but don't comment on the finding. Also, it looks like the initial severity doesn't completely predict regenerated severity - for instance, the least severe fin pre-injury becomes the most severe fin post-injury. I recommend explaining panel 3R in results text and returning to it in the discussion, to contextualize how this finding might influence understanding of fras1-dependent variability. OPTIONAL: Variability could also be compared between different fins in the same animal; does the severity of caudal fin defect correlate with severity in the pelvic or dorsal fin? If so or if not, what might this suggest about the origins of phenotypic variation in this model?

      The study is focused on core Fraser complex, particularly fras1 and the Frem genes which are mutually-stabilizing components of anchoring cords that link nascent epithelia to underlying mesenchyme. The authors could broaden the paper's impact and scope by considering other proteins bound by the core Fraser complex, such as AMACO, Integrins, Npnt, fibrillin, etc. Likewise, examination of Collagen expression, such as collagen VII, may help explain why there is a dissipation over time for the requirement for fras1 to prevent blistering. It may be outside the scope of this study to delve deep into these 'nearby genes' but it seems reasonable to examine them bioinformatically in the scRNA-seq (perhaps adding a supplemental figure if the results are unsatisfying), or at least to discuss them and thereby contextualize the overall findings.

      Minor comments:

      Figure 8 feels like a visual abstract, summarizing findings and contextualizing existing models to the caudal fin, instead of putting forward a truly new model. It focuses on the concept that Fras1 is needed for epithelial-mesenchymal attachments and that Fraser-components stabilize one another; both of these ideas are over a decade old. Although the concepts are cited appropriately within the discussion narrative, it would be nice if Figure 8 did a bit more. The model could be revised in a way that offers new insights into how the specific defects seen in this study arise, by hinting at answers to some of the many questions raised by the study. What is the source of variation? Why do the fin rays fail to branch in the mutant? (could there be more to that decision than simple osteoblast mispositioning?) Why does defect severity change during regeneration vs. development? Why does an extra hypural cartilage form in the mutant? Is there any similarity between the failure to branch fin rays and the presence of fusions in chondral skeleton? These fusions could also be compared and contrasted with non-limb skeletal fusions? It's certainly optional to tackle all of these issues, but discussing any of them could increase the manuscript's impact and establish interesting fodder for future papers. These changes are important, but I place this remark in 'minor comments', because an improved final figure would not be critical to publication in some journals.

      This sentence on line 273-274 is confusing and should be revised: "However, the Fraser Complex at least supports the Shh/Smo downstream cell behaviors that split pre-osteoblasts given frequent ray branching defects in fras1-/- mutants." What do the authors mean by "at least supports"? The phrasing may imply 'Provides physical support essential to,' but that reading does not explain why the fin rays branch in Shh expressing cells regardless of the presence of Fras1. (this comment is actually 'minor')

      The Figure 7 title states that the Fraser complex is needed for normal "epithelial-mesenchymal tissue layering." I am not certain what the authors mean by this. The phrase written in the figure title implies that mesenchymal cells start appearing inside of epithelial regions, but that interpretation doesn't match the figure nor results text. An alternative read - one consistent with the final figure - is that the authors are simply trying to show that the blisters form at the interface of the fin and underlying mesenchyme. If this is the primary thrust of the argument, then it could be stated plainly - and shown more clearly in the results section. (this comment is also truly 'minor')

      Significance

      This manuscript establishes the zebrafish adult caudal fin as a new model to investigate epithelial-mesenchymal interaction defects and skeletal variation caused by loss of the central Fraser complex gene. It is an important contribution to existing models because of the similarity between patterning mechanisms in the caudal fin and tetrapod limbs, which are variably disrupted in Fraser's syndrome. This variability is itself of interest, because the profound variability of Fraser phenotype offers an experimental model for high-variance diseases, which remain poorly understood. The caudal fin is an exciting system to study variation, in particular because it can be cut and regrown rapidly with phenotypic severity compared between regenerates in a clonal system; that regenerative tractability is particularly potent when paired with the zebrafish transgenic toolbox, as the authors show in Figure 6. The present manuscript feels almost complete and yet it opens up many questions, suggesting that it can serve as a good foundation for future studies.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Robbins and colleagues present a new zebrafish model for studying the rare disorder Fraser Syndrome in a well written manuscript. The authors present an interesting phenotype caused by a mutation in fras1: mutants have small, misshapen fins with rays that frequently fail to form branches. The authors show that the Fras1 protein localizes to the distal portions of regenerating fin rays and that in its absence, another component of the Fraser Complex (Frem2) is decreased and mislocalized. The authors show that Fras1 is not required for Shh/Smo signal transduction but that branching is nonetheless disrupted.

      Major comments:

      Since the basement membrane ends up being such a big part of the story, it would add support to the model to specifically present a laminin stain in both WT and the mutant. This could potentially support to the idea that the FPC is integrating the BM with the osteoblasts and it would be helpful to see where the BM is relative to the 'blisters.'

      The fras1-/- mutants show a near-absence of Frem2 protein; the authors conclude that Fras1 supports Frem2 secretion and assembly into Fraser Complex-containing BM. However have the authors considered the possibility that Fras1 directly or indirectly regulates Frem2 transcription? (The model in Fig 8 seems to show a relative increase in Frem2, which should be altered)<br /> Do the other components of the FPC (Frem1a/b, Frem3) show similarly disrupted levels and localization? As presented, since the Frem1a/b, Frem3 are not actually examined in a fras1-/- context, it is not justified to show their intracellular localization in the model in Fig 8b.

      The relative activities of osteoblasts and osteoclasts may regulate the relative location of branches (Cardeira-da-Silva et al 2022). In the fras1 system mutant, it would be beneficial to examine osteoclasts to rule out the idea that Fras1 is simply required for osteoclast activity. This could additional lend support to the idea that disrupted integration between the BE and Obs underlies that failure of fras1-/- mutants to form branches. This could be done within a few months by crossing the mutant into an osteoclast reporter, or more rapidly by using an osteoclast specific antibody or ISH.

      The authors look only at the meristic presence/absence of fin ray branches, and do not take fin length into account. Longer rays are more likely to form branches and the fras1-/- have shorter fins. Some of the branches may be absent in the mutant background simply because the rays are not long enough to have formed them. How far are the branches from the body in each background? Where do the branches form along the total length of the rays?<br /> In the regeneration experiments, do the mutants regenerate at the same relative rate as WTs? Could the decrease in the number of branched rays simply be due to the fact that the mutants may not have not regenerated to their original length by 28 dpa? Has the distance from the body to branch changed? These are all addressable with the data the authors have already collected.

      Minor comments:

      The protruding lower jaw phenotype mentioned in the results should either be shown, or if it is redundant with previous publications please add the citation here.

      Please show Amputation planes in Fig 4E-G. It is notable that Fras1 seems to be present in the proximal region (proximal to the amputation plane?). This seems like it deserves mention in the manuscript.

      In line 195, please clarify what you mean by ray proportions. The proportion of longest/shortest, presumably?

      Please change the title of Fig 3: Fras1 mutants robustly restore skeletal patterning. Also, the ray length ratio in Fig 3Q has been tested with an unpaired t test. It should be a paired test as in R.

      This is an unbelievably a minor point, but for consistency with the other panels I think that in Fig 5 E and F should be C' and D'.

      The titles of Fig 6 and Fig 7 should indicate indicate Fras1 not the Fraser Complex. Eg. Fras1 is not essential for sonic hedgehog/smoothed signal transduction during fin regeneration

      There are also a few grammar errors that should be fixed.

      Significance

      Robbins and colleagues present a new zebrafish model for studying the rare disorder Fraser Syndrome.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      First and foremost, we would like to extend our thanks to the two referees and managing editor of Review Commons for their constructive feedback and careful consideration of this manuscript. We have taken into consideration all of the suggestions from the reviewers and address all points below and in the following sections.

      Minor comments from Reviewer #1:

      “It is not clear why the authors used cell number as a measure of viability compared to the MTS assay used in figure 2.”

      Response:

      In Fig. 2, both MTS assay and CellTiter-Blue assay are used to assess cell viability at 24h and 72h, respectively, whereas counterstaining with DAPI is used to quantify cell number in viral infection assays. Quantification of viral infection using immunofluorescence requires fixation and permeabilization of the cells which is not compatible with assessment of metabolic activity through either the MTS assay or CellTiter-Blue assay post-imaging. One can perform these assays (e.g., MTS and CellTiter-Blue) prior to imaging, however there were concerns regarding viral assay image quantification after running these assays due to the metabolic demand of dye processing which may influence susceptibility to viral infection/propagation, and fluorescence of the metabolic sensor interfering with subsequent IF staining.

      DAPI staining is not meant to show viability per se, however, one can gate for fragmented cell nuclei (indicative of lysed cell) to remove dead cells or nuclear debris from the measurement. However, pre-apoptotic or dying cells cannot be accounted for in this measurement.

      In our case, due to the rapid doubling time of the immortalized cell lines used (e.g., Vero E6 ~24h, Calu-3 ~35-48h, L929 ~24h), we are able to see large differences in cell number as infected or lysed cells fail to replicate over the 48h experiment. Thus, DAPI staining can be used as a proxy to determine the overall health of the culture but is not directly a measure of cell viability.

      Minor comments from Reviewer #1:

      “Why did the authors adopt a different pre-treatment infection protocol for SARS-CoV-2 compared to MHV and OC43?”

      Response:

      The pre-treatment protocol was developed by collaborators in the BSL3 facility as standard practice for rapid treatment/screening of multiple compounds in a BSL3 lab where hands-on time was limited due to immense research focus on infectious disease (e.g., SARS-CoV-2) at the time. We screened many different nanoparticle formulations with this protocol before assessing nanoparticle effect on MHV and OC43 where we also used standardized protocols.

      In reference to comments from Reviewer #2:

      “The substance of the work is very interesting, but experience shows that the idea that by testing one isolate you can generalize about all other viruses is not accurate. Viruses mutate. SARS-CoV-2 has shown an exceptional capacity for mutation, and the mechanism by which viruses enter cells by endocytosis or membrane fusion plays a role in their exposure to products concentrated in the lysosome. Viruses that enter by membrane fusion (including certain isolates of SARS-CoV-2) should not a priori be as sensitive because they are not subject to phagolysosome fusion.”

      “In this sense, it is important to evaluate efficacy on several viral strains and not on a single strain, as has long been the case for acute viral infections. As with HIV, viruses can present natural or acquired resistances linked to evolution under selection pressure or not.<br /> In practice, we cannot rely on testing two viruses, one that has disappeared (Wuhan) and the first virus of the Omicron generation (B1), to assess the therapeutic capacity of a new strategy.”

      Response:

      We would like to highlight that MFQ-NP efficacy was evaluated in several different coronavirus models (MHV, HCoV-OC43 and SARS-CoV-2) in addition to two distinct viral strains (SARS-CoV-2 WT-WA1 and Omicron BA.1) in this study. Not only this, but we have selected viruses from distinct Betacoronavirus lineages which infect different species (homo sapiens and mus musculus). At the time, we had chosen Omicron BA.1 as our model strain as it was the dominant strain in circulation and was temporally separated and genetically distinct from the original WT-WA1 strain.

      We can appreciate that viruses mutate, and SARS-CoV-2 has exemplified this through its life cycle. Due to this rapid mutation rate, it is challenging to assess the current dominant variant (e.g., XBB.1.16 as of writing this) and complete manuscript preparation in addition to full peer-review prior to the emergence of a new, potentially more relevant, dominant variant. Additionally, it remains challenging to accurately predict the emergence and genotypic/phenotypic changes of new strains before they arise, necessitating investigation on ancestral strains or, at the least, the current dominant strain.

      Lastly, we do not wish to speculate/generalize that MFQ-NPs or a similar approach works for “all other viruses”. As exemplified by efficacy studies in three Betacoronavirus lineages, and one of which using two distinct strains, we do argue that this approach is an effective means to inhibit Betacoronavirus infection. We speculate in the discussion that MFQ-NPs may be used as either a prophylactic or treatment for an array of other respiratory coronaviruses, however we neither show data or speculate efficacy against viruses outside of the coronavirus family.

      In reference to comments from Reviewer #1:

      “The claim that MFQ may impact cell entry is not supported by the data in the paper. At minimum, the impact of treatment on expression of viral entry receptors for all 3 viruses should be performed, viral attachment assays (see PMID 35176124) and viral pseudoparticle assays. Further the conclusion that MFQ inhibits replication as well as entry is not fully supported by the data presented. This could be improved using a single cycle infection experiment using a synchronised infection protocol. The gold standard to determine impacts on replication would be the use of a viral replicon however I appreciate the technical difficulties in performing these experiments.”

      Response:

      We agree that the mechanism by which MFQ-NPs inhibit coronavirus infection has not been fully interrogated through this work. We do have preliminary evidence addressed in Fig. 4 which suggests that mechanistically MFQ-NPs may work through targeting pH-dependent protease activity and lysosomal function downstream of viral uptake. However, we have not yet investigated the effect that MFQ-NPs may have on viral entry receptors or viral attachment.

      To that end, we are proposing to perform RT-qPCR to measure changes in expression level of key membrane bound proteins responsible for viral uptake. For these assays, we plan to treat Calu-3 cells with MFQ-NPs, unloaded PGC-NPs, equivalent concentration of molecular MFQ, or DMSO as control to gauge expression level of ACE2 (Hs01085333_m1), TMPRSS2 (Hs01122322_m1), sialate O-acetyltransferase gene (CasD1, Hs01082700_m1), and sialic acid acetylesterase gene (SIAE, Hs00405149_m1) relative to expression of glyceraldehyde-3-phosphate dehydrogenase (GAPDH, Hs02786624_g1) using TaqMan probes (ThermoFisher, USA). Additionally, we will also measure the expression level of Cathepsin L (Hs00964650_m1). Cathepsin L is not a transmembrane protein, however strong evidence suggests that this lysosomal protease is essential for S protein processing and viral membrane – endolysosomal membrane fusion in the SARS-CoV-2 endocytic infection route.

      These proteins are chosen as ACE2 and TMPRSS2 are known mediators of SARS-CoV-2 uptake and fusion, and HCoV-OC43 relies on uptake via sialoglycan-based receptors with 9-O-acetylated sialic acid (9-O-Ac-Sia) as a key component. Although CasD1 and SIAE themselves are not transmembrane receptors for HCoV-OC43, they regulate the addition or removal of O-acetyl ester groups from sialic acids, respectively.

      Similarly, we plan to treat L929 cells with MFQ-NPs, unloaded PGC-NPs, equivalent concentration of molecular MFQ, or DMSO as control to gauge expression level of CEACAM1 (Mm04204476_m1) relative to expression of GAPDH (Mm99999915_g1). MHV spike protein binds to murine carcinoembryonic antigen-related cell adhesion molecule 1a (mCEACAM1a) facilitating infection. NP treatment duration will be consistent with viral infection assays (e.g., 48 h) prior to RNA isolation and qPCR.

      Results from PCR measurements may warrant further investigation into protein level expression measured by Western Blotting. However, we plan to begin with PCR as blotting for multiple membrane bound proteins is considerably challenging and higher cost than qPCR.

      In addition to expression of viral entry receptors, we will also perform a viral attachment assay and internalization assay to further interrogate MFQ’s mechanism of action. To determine whether mefloquine inhibits SARS-CoV-2 binding/attachment, we will perform viral binding assays in Calu-3/ Vero E6-TMPRSS2-T2A-ACE2 cells that express ACE2 at high levels, and HEK293T cells that express ACE2 at lower levels. Assays will be performed using SARS-CoV-2 Spike pseudo-typed lentivirus which expresses a fluorescent reporter upon mammalian cell infection. SARS-CoV-2 Spike pseudo-virus is advantageous as it mimics SARS-CoV-2 entry mechanisms; however, it can be handled at BSL2, and it can be used to accurately quantify viral uptake since this virus is not replication competent.

      SARS-CoV-2 can be internalized primarily via receptor-mediated endocytosis in cells which do not express TMPRSS2 (e.g., Vero E6) or via direct plasma membrane fusion in cells which do express TMPRSS2 (e.g., Calu-3 and Vero E6-TMPRSS2-T2A-ACE2). To test whether mefloquine inhibits the endocytosis of SARS-CoV-2, Vero E6 cells will be pre-treated with effective concentrations of MFQ-NPs, equivalent concentration of molecular MFQ, or unloaded PGC-NPs/DMSO as controls. Next, cells will be inoculated with SARS-CoV-2 Spike pseudo-virus at MOI 0.5 at 37 oC for 1 h. Cells will then be washed with PBS to remove unbound virus, media containing treatments will be reintroduced, and the pseudoviral reporter fluorescence will be measured 18-24 h after inoculation.

      To test whether mefloquine inhibits TMPRSS2-mediated fusion during SARS-CoV-2 infection we will use TMPRS2 expressing Vero E6-TMPRSS2-T2A-ACE2 and Calu-3 cells. Cells will be pre-treated with Leupeptin/Pepstatin (inhibitors of endolysosomal proteases), camostat mesylate (serine protease inhibitor), MFQ-NPs, molecular MFQ, unloaded PCG-NPs, or DMSO as control for 1 h, and then inoculated with SARS-CoV-2 Spike pseudo-virus (MOI = 0.5). Cells will then be washed with PBS to remove unbound virus, media containing treatments will be reintroduced, and the pseudoviral reporter fluorescence will be measured 18-24 h after inoculation.

      Minor comments from Reviewer #1

      _<br /> “Further discussion in the introduction as to the potential mechanism of action of MFQ should be included. I would also suggest the authors read the work by Elizabeth Campbell and Bruno Canard concerning the potential difficulties in designing direct acting antivirals for coronaviruses.”

      “The figure legends lack detail concerning the number of replicates and statistical comparisons. For viral infections MOIs used are also absent.”_

      Response:

      We have included a brief summary describing what the field knows of the mechanism of action of MFQ. Namely that MFQ does not directly inhibit the virus/cell membrane attachment process, rather MFQ somehow inhibits viral entry after attachment. We speculate a few mechanisms by which this may occur, which include: (1) inhibiting viral membrane fusion with the cell membrane or endolysosomal membrane, (2) inhibiting proteases responsible for processing SARS-CoV-2 S protein and exposing the fusion peptide, (3) modulating expression levels of ACE2, TMPRSS2, and/or cathepsin, or (4) promoting exocytosis of SARS-CoV-2 particles after uptake.

      While it is not the primary goal of the manuscript to determine this mechanism of action, we have evidence currently that MFQ inhibits endolysosomal proteolysis (e.g., mechanism 2 above). Through viral attachment assays and evaluation of receptor expression levels we will also probe mechanism 3 in the revision process.

      We have updated the figure legends and methods section to include further details concerning replicates and statistical comparisons. For viral infections we had previously listed the MOIs used in the Materials & Methods section but have also included them in the figure legends.

      In reference to comments from Reviewer #2:

      “On the one hand, both the introduction and the abstract contain too many elements that give a biased view of the extremely controversial literature. For example, the activity of Hydroxychloroquine and its toxicity have been explored most extensively on the "C19Early" website, which reports on trials carried out in a multitude of countries, including more than 300 trials with Hydroxychloroquine, and it is unreasonable in a scientific paper, designed to last, to report on the major beliefs at a given moment in order to develop a work that has nothing to do with this debate. The same applies to the efficacy of the vaccine. It is difficult to say that the vaccine was poorly distributed, with 20 billion doses, making it the most widely distributed vaccine in the history of mankind in such a short space of time, with results that were not as spectacular as the studies predicted, since the epidemic continued at a comparable level. I suggest that the authors concentrate on their work rather than getting involved in the controversies that are developing around treatments and vaccination.”

      Response:

      When possible, we have tried to highlight the mixed/controversial results, both positive and negative, of pre-existing therapeutics targeting SARS-CoV-2 and COVID-19 and cited them accordingly. Conjectural phrases such as “selective pressure may lead to 3CLpro mutations conferring nirmatrelvir resistance to new viral mutants” or “there is a growing concern that Molnupiravir, especially when administered at sub therapeutic doses, may result in the creation of more virulent SARS-CoV-2 mutants” are supported by observations in the literature and have been proposed by other experts in the field. Otherwise, we have revised the text to remove any unsupported speculative phrases.

      We believe it is worth noting the existing therapeutic strategies in the field to provide context and rationale for our differentiated approach. We have extensively explored the C19Early site as well, and although it does a fantastic job of compiling relevant literature, this site also appears to have a biased view. Throughout preparation of this manuscript, we have considered FDA recommendations and clinical practice in prophylactic protection/treatment of COVID-19 paramount in guiding our introduction and discussion.

      We have removed phrasing regarding the limited distribution of vaccines.

      In reference to comments from Reviewer #1:

      _“The authors claim that MFQ loaded nanoparticles have reduced cytotoxicity compared to 'free MFQ' dissolved in DMSO, however with the NP data and free MFQ data not plotted with the same units this conclusion is hard to reach (Fig.2). While I appreciate the molar units are presented in the text - the reduction in cytotoxicity with MFQ-NP appears to be relatively minor in the both the Calu3 and Vero cell models (doubling in IC50 in both instances). This may indicate quite a narrow therapeutic window for antiviral efficacy without unwanted cytotoxicity. Can the authors replot the data on scales using either molar or ug/ml and use the same dose range for all treatments to enable statistical determination as to whether MFQ-NP significantly reduce cytotoxicity.

      To test the antiviral efficacy of the MFQ-NP the authors adopt 2 infection systems, either treating cells pre or post infection. The authors either use fluorescently tagged reporter viruses (OC-43/MHV) or immunofluorescence to visualise and quantify viral infection in cell-line models. Given a key aim of this paper is to determine whether MFQ-NP rather than free MFQ is a superior treatment option, it is challenging to assess this with the data presented in figures 5-6. The units of treatment between NP, MFQ-NP and free MFQ again differ, and the molar dose range of MFQ-NP and free NP is not the same. This makes it very hard to conclude whether MFQ-NPs are more effective then free MFQ. Formal dose response curves with the same dose of empty-NPs, MFQ-NPs and free MFQ are needed here, preferably with match cell viability data using the same assay as figure 2.”_

      Response:

      We will include additional plots with axis scaling for MFQ-NPs as concentration of MFQ in µM rather than concentration of NPs in µg/mL for further comparison to the free MFQ group. We chose concentration of NPs to match with the equivalent unloaded NP controls. Unfortunately, it would not be possible to create a formal dose response curve with the same dose of empty-NPs and free MFQ as those entities only co-exist in the MFQ-NPs treatment group.

      We agree with the observation that the therapeutic window is likely narrow in vitro. This is observed in the viral inhibition and cytotoxicity experiments, where the most efficacious dosing of NPs (e.g., 50 – 100 µg/mL) in inhibiting viral infection is similar to the IC50 value (e.g., 54 µg/mL in Calu-3) at 24 h. Similarly, we see a biphasic dose response in our protease activity assay, suggesting that low doses actually increase endolysosomal protease activity which may promote viral infection.

      We speculate this dose limiting toxicity and narrow therapeutic window will likely be improved more drastically in vivo (ongoing continuation of this study), however in vitro we still see at least a minor improvement in MFQ tolerability.

      In reference to comments from Reviewer #1:

      “Finally while animal experiments are likely beyond the scope of this study, use of air-liquid interface cultures of lung epithelial cells would be a significant improvement to the work and provide further support to their conclusions in a physiologically relevant system.”

      Response:

      While we appreciate the suggestion of ALI models and animal models to further assess MFQ-NPs in a more physiologically relevant system, we agree that these studies would be beyond the scope of this study. This investigation is planned as a continuation of the current study.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      This work is interesting but poses two problems.

      On the one hand, both the introduction and the abstract contain too many elements that give a biased view of the extremely controversial literature. For example, the activity of Hydroxychloroquine and its toxicity have been explored most extensively on the "C19Early" website, which reports on trials carried out in a multitude of countries, including more than 300 trials with Hydroxychloroquine, and it is unreasonable in a scientific paper, designed to last, to report on the major beliefs at a given moment in order to develop a work that has nothing to do with this debate. The same applies to the efficacy of the vaccine. It is difficult to say that the vaccine was poorly distributed, with 20 billion doses, making it the most widely distributed vaccine in the history of mankind in such a short space of time, with results that were not as spectacular as the studies predicted, since the epidemic continued at a comparable level. I suggest that the authors concentrate on their work rather than getting involved in the controversies that are developing around treatments and vaccination.<br /> The substance of the work is very interesting, but experience shows that the idea that by testing one isolate you can generalize about all other viruses is not accurate. Viruses mutate. SARS-CoV-2 has shown an exceptional capacity for mutation, and the mechanism by which viruses enter cells by endocytosis or membrane fusion plays a role in their exposure to products concentrated in the lysosome. Viruses that enter by membrane fusion (including certain isolates of SARS-CoV-2) should not a priori be as sensitive because they are not subject to phagolysosome fusion.

      In this sense, it is important to evaluate efficacy on several viral strains and not on a single strain, as has long been the case for acute viral infections. As with HIV, viruses can present natural or acquired resistances linked to evolution under selection pressure or not.<br /> In practice, we cannot rely on testing two viruses, one that has disappeared (Wuhan) and the first virus of the Omicron generation (B1), to assess the therapeutic capacity of a new strategy.

      Significance

      This work is interesting but poses two problems.

      On the one hand, both the introduction and the abstract contain too many elements that give a biased view of the extremely controversial literature. For example, the activity of Hydroxychloroquine and its toxicity have been explored most extensively on the "C19Early" website, which reports on trials carried out in a multitude of countries, including more than 300 trials with Hydroxychloroquine, and it is unreasonable in a scientific paper, designed to last, to report on the major beliefs at a given moment in order to develop a work that has nothing to do with this debate. The same applies to the efficacy of the vaccine. It is difficult to say that the vaccine was poorly distributed, with 20 billion doses, making it the most widely distributed vaccine in the history of mankind in such a short space of time, with results that were not as spectacular as the studies predicted, since the epidemic continued at a comparable level. I suggest that the authors concentrate on their work rather than getting involved in the controversies that are developing around treatments and vaccination.<br /> The substance of the work is very interesting, but experience shows that the idea that by testing one isolate you can generalize about all other viruses is not accurate. Viruses mutate. SARS-CoV-2 has shown an exceptional capacity for mutation, and the mechanism by which viruses enter cells by endocytosis or membrane fusion plays a role in their exposure to products concentrated in the lysosome. Viruses that enter by membrane fusion (including certain isolates of SARS-CoV-2) should not a priori be as sensitive because they are not subject to phagolysosome fusion.

      In this sense, it is important to evaluate efficacy on several viral strains and not on a single strain, as has long been the case for acute viral infections. As with HIV, viruses can present natural or acquired resistances linked to evolution under selection pressure or not.<br /> In practice, we cannot rely on testing two viruses, one that has disappeared (Wuhan) and the first virus of the Omicron generation (B1), to assess the therapeutic capacity of a new strategy.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary

      Petcherski et al describe a nanoparticle delivery system to deliver mefloquine, a inhibitor of viral endocytosis, into cell line models of coronavirus replication. They describe the generation of these nanoparticles and test their antiviral efficacy against 3 different beta coronaviruses OC43, MHV and SARS-CoV-2, including the omicron variant.

      Major Comments

      The authors claim that MFQ loaded nanoparticles have reduced cytotoxicity compared to 'free MFQ' dissolved in DMSO, however with the NP data and free MFQ data not plotted with the same units this conclusion is hard to reach (Fig.2). While I appreciate the molar units are presented in the text - the reduction in cytotoxicity with MFQ-NP appears to be relatively minor in the both the Calu3 and Vero cell models (doubling in IC50 in both instances). This may indicate quite a narrow therapeutic window for antiviral efficacy without unwanted cytotoxicity. Can the authors replot the data on scales using either molar or ug/ml and use the same dose range for all treatments to enable statistical determination as to whether MFQ-NP significantly reduce cytotoxicity.

      To test the antiviral efficacy of the MFQ-NP the authors adopt 2 infection systems, either treating cells pre or post infection. The authors either use fluorescently tagged reporter viruses (OC-43/MHV) or immunofluorescence to visualise and quantify viral infection in cell-line models. Given a key aim of this paper is to determine whether MFQ-NP rather than free MFQ is a superior treatment option, it is challenging to assess this with the data presented in figures 5-6. The units of treatment between NP, MFQ-NP and free MFQ again differ, and the molar dose range of MFQ-NP and free NP is not the same. This makes it very hard to conclude whether MFQ-NPs are more effective then free MFQ. Formal dose response curves with the same dose of empty-NPs, MFQ-NPs and free MFQ are needed here, preferably with match cell viability data using the same assay as figure 2.

      The claim that MFQ may impact cell entry is not supported by the data in the paper. At minimum, the impact of treatment on expression of viral entry receptors for all 3 viruses should be performed, viral attachment assays (see PMID 35176124) and viral pseudoparticle assays. Further the conclusion that MFQ inhibits replication as well as entry is not fully supported by the data presented. This could be improved using a single cycle infection experiment using a synchronised infection protocol. The gold standard to determine impacts on replication would be the use of a viral replicon however I appreciate the technical difficulties in performing these experiments.

      Finally while animal experiments are likely beyond the scope of this study, use of air-liquid interface cultures of lung epithelial cells would be a significant improvement to the work and provide further support to their conclusions in a physiologically relevant system.

      Minor Comments

      It is not clear why the authors used cell number as a measure of viability compared to the MTS assay used in figure 2.

      Why did the authors adopt a different pre-treatment infection protocol for SARS-CoV-2 compared to MHV and OC43?

      Further discussion in the introduction as to the potential mechanism of action of MFQ should be included. I would also suggest the authors read the work by Elizabeth Campbell an Bruno Canard concerning the potential difficulties in designing direct acting antivirals for coronaviruses.

      The figure legends lack detail concerning the number of replicates and statistical comparisons. For viral infections MOIs used are also absent.

      Significance

      This work has good potential but is let down by the execution of the experimental design. The use of NP for antiviral drugs is a very interesting area and could greatly contribute to drug design for this viral family.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity):

      In this study, the authors made a two-component homing modification gene drive in Anopheles coluzii with a different strategy than usual. The final drive itself targets and disrupts the saglin gene that is nonessential for mosquitoes, but important for the malaria parasite. The drive uses several gRNAs, and some of these target the Lp gene where an anti-malaria antibody is added, fused to the native gene (this native gene is also essential, removing nonfunctional resistance alleles at this locus). In general, the system is promising, though imperfect. Some of the gRNAs self-eliminate due to recombination of repetitive elements, and the fusion of the antimalaria gene had a modest fitness cost. Additionally, the zpg promoter was unable to operate at high efficiency, requiring use of the vasa promoter, which suffers from maternal deposition and somatic expression (the latter of which increased fitness costs at the Lp target). The manuscript has already undergone some useful revisions since its earliest iteration, so additional recommended revisions are fairly modest.

      Line 43-45: The target doesn't need to be female sterility. It can be almost any haplosufficient but essential target (female sterility works best, so it has gotten the most study, but others have been studied too).

      --- We agree. However, this paragraph focused on previous achievements in malaria mosquitoes, for which suppression gene drives spreading lethality rather than female sterility have not been reported to our knowledge. Even the targeting of doublesex, which is a sex determination rather than female fertility gene, results in female sterility (Kyrou et al. 2018). However, we inserted the possibility of female killing by X-shredder GD (Simoni et al., 2020).

      Line 69: A quick motivation for studying Anopheles coluzii should be added here (since gambiae is discussed immediately before this).

      ---Thank you for drawing our attention to this point. We modified the sentence to:

      _Here, we present the engineering of the Lipophorin (Lp) essential gene in Anopheles coluzzii, a prominent member of the A. gambiae species complex and a major malaria vector in sub-Saharan Africa.

      _

      Introduction section: It might be helpful to break up the introduction into additional paragraphs, rather than just two.

      --- We followed this suggestion and broke up the introduction into 5 paragraphs to make it more breathable.

      Introduction last part: The last part of the introduction reads more like an abstract or conclusions section. Perhaps a little less detail would fit better here, so the focus can be on introducing the new drive components and targets

      --- We have followed this suggestion and substantially shortened this last part of the introduction.

      Line 207-213: This material could go in the methods section. There are some other examples in the results that could be similarly shortened and rearranged to give a more concise section.

      --- We moved the long description from lines 207-213 to the Methods as suggested, and summarized it simply as:

      Only mosquitoes displaying GFP parasites visible through the cuticle were used to infect mice.

      We emphasize this point because in subsequent experiments using Saglin knockout mosquitoes, this enrichment for infected mosquitoes will probably attenuate the Plasmodium-blocking phenotype caused by Saglin KO, since mosquitoes lacking Saglin tend to be less infected (Klug et al., 2023). Elsewhere in the Results, we still provide detailed descriptions of procedures because we believe they aid understanding and assessing the quality of the experiments.

      Line 283-287: I couldn't find the data for this.

      --- Indeed we only summarized the data about the progeny of the [zpg-Cas9; GFP-RFP] line crossed to WT, as we didn’t judge these results worth detailing. Here is our record from one such cross:

      GFP-RFP females x WT males  486 (50.7%) GFP+ and 472 (49.3%) GFP- larvae

      GFP-RFP males x WT females  1836 (48.9%) GFP+ and 1925 (51.1%) GFP- larvae

      This shows no significant gene drive. However in these progenies, a few GFP+ and non-RFP larvae, and a few RFP+ non-GFP larvae were noted by visual examination under the fluorescence microscope, without counting them precisely. Their existence testified to some weak homing activity mediated by zpg-Cas9 in the Lp locus.

      We modified the sentence as follows to support our conclusion, and we propose to leave these detailed numbers here in our response, which will be published along with the paper.

      In spite of the presence of the zpg-Cas9 and gRNA-encoding cassettes in the GFP-RFP allele, it was inherited in about 50% of male or female progenies, demonstrating little homing activity of the GFP-RFP locus after crosses to WT, except for the appearance of rare GFP-only or RFP-only progeny larvae, …

      Line 291: Replace "lied" with "was".

      ----done.

      Line 356: Homing in the zygote would be considered very unusual and is thus worthy of more attention. While possible (HDR has been shown for resistance alleles in the zygote/early embryo), this would be quite distinct from the mechanism of every other reliable gene drive that has been reported. Is the flow cytometry result definitely accurate? By this, I mean: could the result be explained by just outliers in the group heterozygous for EGFP, or perhaps some larvae that hatched a little earlier and grew faster? Perhaps larvae get stuck together here on occasion or some other artifact? Was this result confirmed by sequencing individual larvae?

      ---- We agree with your skepticism, especially given that the same is not seen in Suppl Fig 2A with a similar genotype setup, i.e., the vasa gene drive at the Lp locus, or in the G1 of populations 6 or 8 at the Saglin locus (Suppl. File 2). Unfortunately, it would take too much time at this point to re-create this line (which has been discarded) to re-examine this issue. Therefore, we acknowledge that another explanation than homing in the zygote may account for this result. Based on our empirical experience COPAS outputs are reliable: such outliers from the heterozygous population are usually not seen, and we always sort neonate larvae a few hours from hatching. Those 6% homozygous-looking larvae may come from a contamination with male pupae when female pupae were manually sorted for the cross to WT males, a human error that we cannot exclude. In this case, the true GFP inheritance would be closer to 79% than to 85%. For these reasons, we must back up from our initial statement as follows:

      The progeny of these triple-transgenic females crossed to WT males showed markedly better homing rates (>79% GFP inheritance)

      And edit the figure legend of Figure 4B to account for the alternative possibility of a contamination with males:

      6% of individuals appeared to be homozygous, revealing either unexpected homing in early embryos due to maternal Cas9 deposition, or accidental contamination of the cross with a few transgenic males.

      Results in general: Why is there no data for crosses with male drive heterozygotes? Even if some targets are X-linked, performance at others is important (or did I miss something and they are all X-linked). I see some description near line 400, but this sort of data is figure-worthy (or at least a table).

      --- For the only example of functioning split gene drive at the Lipophorin locus on chromosome III, we do show homing results from heterozygous GD males in Suppl. Fig. 2A (91.2% homing in males inferred from ((40.7+53.1+1.8)-50)x2). We added this calculation of the homing rates in the figure legend. For full drive constructs in the Saglin locus on chromosome X (our final functional design), in addition to the data described in the text near line 400, male data showing “teleguided” homing at the Lipophorin locus on chromosome II is shown in Suppl. File 2 (see G2 of population 7, showing close to 100% homing at the GFP locus); the same data (less easy to assess) being converted into the G2 point of the graphs in Figure5.

      Lines 362-367: What data (figure/table) does this paragraph refer to?

      --- We apologize for the fact that this sentence was misleading. In this population, the genotype frequencies were not tracked at each generation but measured once after 7 generations. We rephrased (now lines 401-403) and now provide the measured values directly in the text:

      We maintained one mosquito population of Lp::Sc2A10 combined with SagGDzpg (initial allele frequencies: 25% and 33%, respectively) and measured genotype frequencies after 7 generations. This showed an increase in the frequency of both alleles (G7: GFP allelic frequency = 59.2%, phenotypic expression of DsRed in >90% of larvae, n=4282 larvae),

      Lines 405-406: There may be a typo or miscalculation for the DsRed inheritance and homing rate here. Should DsRed inheritance be 90.7%?

      --- Thank you for spotting this. You are right, DsRed inheritance would be 90.7% if the homing rate were 81.4% as we mistakenly wrote. Actually DsRed inheritance was really 80.7% so our mistake was in calculating the homing rate: 61.4% is the correct value ((80.7-50)x2), now corrected in the manuscript.

      Figure 5: The horizontal axis font size for population 8 is a little smaller than the others.

      --- True. Corrected.

      Line 454: In addition to drive conversion only occurring in females and the somatic fitness costs, embryo resistance from the vasa promoter would prevent the daughters of drive females from doing drive conversion. This means that drive conversion would mostly just happen with alleles that alternate between males and females.

      --- We agree with this idea, although the impact of this phenomenon will depend on the extent of resistance allele formation in early embryos. We observed (Fig. 6) that failed homing mutagenesis in Saglin is not that intense, the sequenced non-drive alleles that were exposed 1-4 times to mutagenic activity in females either being mostly wild-type, or carrying mutations that often still left one or two gRNA target sites intact and vulnerable to another round of Cas9 activity. Therefore, alleles passed on from female to female may still undergo drive conversion to a large extent, that future experiments may be able to quantify.

      Line 481: Deletions between gRNAs certainly happen, but I wouldn't necessarily expect this to be the "expectation". In our 2018 PNAS paper, it happened in 1/3 of cases. There were less I think in our Sciences Advances 2020 and G3 2022 paper. All of these were from embryo resistance from maternal Cas9 (likely also the case with your drive due to the vasa promoter). When looking at "germline" resistance alleles, we have recently noticed more large deletions.

      --- We agree that the early embryo with maternally deposited Cas9 is probably the most prominent source of mutations at gRNA target sites. Perhaps naïvely we imagined that it would be easier for cells to repair two closely spaced DNA breaks by eliminating the intervening sequence, rather than stitching each break individually. Given that we sequenced many alleles carrying a single mutation, the lack of larger deletions may be explained by lower rates of Cas9 activity in Saglin, with mostly a single break at a time, due to limiting Cas9 amounts and their partial saturation with Lp gRNAs, and/or lesser accessibility of the Saglin locus compared to Lipophorin… We deleted the phrase “Contrarily to our expectation”.

      Figure 6C: It may be nice to show the wild-type and functional resistance sequence side-by-side.

      --- done

      Lines 642-644: This isn't necessarily the case. At saglin, the nonfunctional resistance alleles may still be able to outcompete the drive allele in the long run. This wasn't tested, but it's likely that the drive allele has at least some small fitness costs.

      --- We agree. We inserted this comment in a parenthesis in the text (now lines 644-645):

      Unlike the first approach, this design may allow Cas9 and gRNA-coding genes to persist indefinitely within the invaded mosquito population (unless nonfunctional resistance alleles outcompete the drive allele in the long run).

      A few comments on references to some of my studies:

      Champer, Liu, et al. 2018a and 2018b citations are the same paper.

      --- Duplicate in our reference library. Corrected.

      For Champer, Kim, et al. 2021 in Molecular Ecology, there was a recent follow-up study in eLife that shows the problem is even worse in a mosquito-specific model (possibly of interest as an alternate or supporting citation): https://elifesciences.org/articles/79121

      --- Citation added (line 68).

      One of my other previous studies was not cited, but is quite relevant to the manuscript: https://www.science.org/doi/10.1126/sciadv.aaz0525<br /> This paper demonstrates multiplexed gRNAs and also models them, showing their advantages and disadvantages in terms of drive performance. Additionally, it models and discusses the strategy of targeting vector genes that are essential for disease spread but not the vectors themselves (the "gene disruption drive"), showing that this can be a favorable strategy if gene knockout has the desired effect (nonfunctional resistance alleles contribute to drive success).

      --- your 2020 study will indeed now be useful to inform the design of multiplex gRNAs for various gene drives designs, in terms of number of gRNAs, distribution of their target sites, necessity to generate loss-of-function rather than functional resistance allele in the target gene (such as our Lp and Saglin pro-parasitic genes)… The notion of Cas9 saturation with increasing gRNA numbers is also important. When we initiated this project in 2018, we only had intuitive notions that multiplex gRNAs could improve the durability of GD and increase the chances of resistance alleles to be loss-of-function. We thus arbitrarily maximized the number of gRNAs for each of the two targets: 3 for each target in one design, 3 and 4 in another, which, according to your modelling, is luckily close to the optimal numbers for each locus. We now cite your paper as a GD design tool in the discussion about pathways to optimizing our system:

      To further optimize GD design, modeling studies can now aid in determining the optimal number of gRNAs in a multiplex, depending on the specific GD design and purpose (Champer et al., 2020)__.

      In addition to this and to the stabilization of multiplex gRNA arrays, other paths to improvement (…)

      This one is less relevant, but is still a "standard" homing modification rescue type drive that could be mentioned (and owes its success to multiplexing): https://www.pnas.org/doi/abs/10.1073/pnas.2004373117<br /> The recoded rescue method was also used in mosquitoes (albeit without gRNA multiplexing) by others, so this may be a better one to mention: https://www.nature.com/articles/s41467-020-19426-0

      --- We added the two references on what is now Line 663:

      Lp::Sc2A10 depends on SagGD for its long-term persistence and spread in a population, and SagGD depends on Lp::Sc2A10 as a rescue allele of the essential Lp target for its survival. This design can be seen as a two-locus variation of rescue-type GDs (Adolfi et al., 2020; Champer et al., 2020)

      Sincerely,<br /> Jackson Champer

      Referees cross-commenting<br /> Other comments look good. One thing that I forgot to mention: for the 7-gRNA construct with tRNAs, the authors mentioned that it was harder to track, but it sounds like they obtained some data for it that showed similar performance. Even if this one is not featured, perhaps they can still report the data in the supplement?

      --- This GD required examination of the mosquitoes at late developmental stages, such as the pupa, to score red fluorescence under control of the OpIE2 promoter, that is unfortunately late-active when expressed from the Lp locus. We precisely scored only the first 128 pupae arising from the progeny of the first obtained G1 [SagGD/+ ; Lp-2A10/+] females crossed to WT males. Among these:

      • 115 were GFP+, DsRed+ (89.8%)

      • 12 were GFP+, DsRed- (9.3%)

      • 1 was GFP-, DsRed- (<1%)

      This allowed us to roughly estimate the homing rates at 98.2% at the Lipophorin locus and 79.7% at the Saglin locus, which is similar to the other construct without tRNA spacers.

      These approximate rates were confirmed by visual examination of progenies in two subsequent generations of [SagGD/+; Lp-2A10/+] males and females backcrossed to WT.

      Reviewer #1 (Significance):

      Overall, this study represents a useful advance. Aside from being the first report for gene drive in A. coluzii, it also is the first that investigates the gene disruption strategy and is the first report of gRNA multiplexing in Anopheles. The study can thus be considered high impact. There are also other aspects of the study that are of high interest to gene drive researchers in particular (several drives were tested with some variations).

      --- We are grateful for your positive, constructive and in-depth analysis of our study!

      Reviewer #2 (Evidence, reproducibility and clarity):

      The authors initially created a transgenic mosquito colony expressing the Sc2A10 antibody fused to the lipid transporter Lipophorin, and tested the transmission-blocking activity of this transgene. Building off of previous findings that the Sc2A10 antibody inhibits sporozoite infectivity when expressed in mosquito salivary glands, the authors showed that found it was also efficient at inhibiting sporozoite infectivity when secreted into the hemolymph expressed under the lipophorin endogenous promoter in An. coluzzii. They then designed and tested two different gene drives utilizing the Sc2A10-Lipophorin fusion protein. In the first, the authors used a recoded allele of Lp-Sc2A10 while simultaneously utilizing gRNAs that targeted endogenous Lp in an effort to select for mosquitoes that expressed transgenic Lp-Sc2A10 due to the essential nature of Lp. However, this drive was unsuccessful because recoded Lp is necessarily heterozygous while the GD is entering the population, and Lp proved to be largely haploinsufficient. Further, the zpg promoter expressing cas9 was not effective in promoting homing of the gRNAs. In the second gene drive that was tested, authors made use of the endogenous Saglin locus, which expresses a natural agonist for Plasmodium, and is thus desirable to target for disruption in a gene drive that aims to reduce vector competence for Plasmodium. This gene drive also uses recoded Lp-Sc2A10 to replace the wild-type Lp allele, thus selecting for Sc2A10 expression, however this drive is not dependent on fitness of individuals with only one functional copy of Lp.<br /> The authors discovered that the efficacy of the zpg promoter to drive homing of cas9 is locus-dependent, limiting the success of their gene drive designs. They do show, however, that the Saglin gene drive succeeds at reaching high frequencies in mosquito populations using instead the vasa promoter to express cas9, and that these transgenic mosquitoes are able to reduce infectivity of sporozoites in a bite-back mouse model. However, they observe gene drive refractory mutations in the Lp gene, despite its highly conserved nature, showcasing the difficulty of avoiding drive resistance even in small populations of mosquitoes, and also observed deletions of gRNAs targeting both Lp and Saglin, further highlighting possible shortcomings in gene drive approaches. Together, these findings are useful to the field in walking the readers through an interesting and promising approach for a novel gene drive, and illustrating the challenges in engineering an efficacious and long-lasting drive.

      Major comments:

      As the authors are able to observe Plasmodium within mosquitoes, it would be useful to have these data in the manuscript pertaining to the prevalence and intensity of infection in mosquitoes prior to bite-back assays. If there are data or images that the authors could include, it would be helpful to show if there is a possibility that infection intensity is a variable that contributes to whether or not mice develop an infection. It would also be interesting to note whether there is a different in infection (oocysts or sporozoites) between transgenic mosquitoes and wild type mosquitoes.

      --- This is a valuable suggestion. Please note that, in order to evaluate the transmission-blocking properties of the Lp-2A10 allele (acting at the sporozoite level), we discarded non-infected mosquitoes prior to bite-back experiments, so that infection prevalence was 100% in the mosquitoes retained for the bite-back. We have not systematically compared parasite loads between transgenic and control mosquitoes. In some experiments comparing Lp-2A10 mosquitoes and their control, we dissected a subset of the mosquito midguts after bite-back to visually ascertain that they showed roughly equivalent oocyst numbers between transgenic and controls. However, we have not precisely recorded these data. It is possible that slightly decreased lipid availability in Lp::2A10 mosquitoes (their lipophorin allele producing slightly less Lp than the WT) negatively affects the parasite, as suggested by previous studies highlighting the role of host lipophorin-derived lipids for parasite development in the mosquito (Costa et al, Nat Commun 2018; Werling et al. Cell 2019; Kelsey et al. PLoS Path 2023).

      In the case of Lp-2A10 mosquitoes additionally containing a GD in Saglin, it is expected that they should carry lower parasite numbers than their controls, an effect of the Saglin knockout mutation alone (Klug et al., PLoS Path 2023). Re-inforcing the transmission blocking effect of the 2A10 antibody by reducing parasite loads via the Saglin KO was indeed our intention. Hence, having selected the most infected mosquitoes for our bite-back experiments likely attenuated this desired effect, but we still observed a 90% transmission decrease when the two modifications were combined, compared to a 70% decrease with Lp-2A10 alone. We do not plan to perform additional infections experiments for the current manuscript on Plasmodium berghei expressing Pf-CSP, but we do intend to record parasite counts in a follow-up study with an optimized SagGD transgene and Plasmodium falciparum infections. This will be of high relevance for potential future applications in malaria control.

      The authors also go into significant detail in the discussion exploring ideas of how to optimize or improve this specific gene drive design. The authors should also stress further the applicability of their discoveries in other gene drive designs, and emphasize the lessons they learned in the difficulties encountered in this study and how these findings could guide others in their decision making process when choosing targets or elements to include in a potential gene drive approach.

      --- We feel that we already emphasized these lessons in the manuscript, in the discussion and when justifying the chosen strategies in the Results section. Lessons for future designs include:

      • inserting an antimalarial factor into an essential endogenous gene, preserving its function, can provide many benefits (high expression level, secretion signal that can be hijacked, endogenous introns can be hijacked to host a marker, inactivation by mutagenesis or epigenetic silencing being more difficult…);

      • a distant-locus gene drive (as here in Saglin) could potentially drive several antimalarial cargoes at the same time, inserted in different loci;

      • non-essential mosquito genes agonistic to Plasmodium are attractive host loci for a GD, an already old idea illustrated here by the case of Saglin;

      • multiplex gRNAs are a viable approach to reduce the formation of GD-resistant alleles in essential genes and/or to increase the frequency of loss-of-function alleles, which will either disappear if the gene is essential or decrease vector competence if the gene is pro-parasitic. Hence gRNAs targeting intron sequences should be avoided in order to preserve this benefit, as illustrated by one of our Lp gRNAs targeting the first intron and that contributed to generate the only Lp viable resistance allele identified in this study;

      • To increase long-term stability of the GD construct, repeats should be minimized in gRNA multiplexes through the use of a single promoter and various spacers (tRNAs, ribozymes?) – it remains to be seen if the 76-nucleotide gRNA constant sequence itself, necessarily repeated, will stimulate unit losses in a gRNA multiplex;

      • The best promoter to restrict Cas9 expression to the germ line may be zpg in some but not all loci; the vasa promoter causing maternal Cas9 deposition may still be envisaged if resistance allele formation can be prevented by other means (targeting hyper-conserved essential sequence, multiplexing the gRNAs against an essential gene…).

      Minor comments:

      Line 44 - female sterility but also female killing approaches to crash pop. like X shredder, if authors would like to expand

      --- Female killing citation of Simoni et al, 2020 added (line 45).

      Lines 48-60 - Authors should add some references from the literature surrounding ethics and ecology studies related to gene drive release

      --- we added: (e.g., National Academies of Science, Engineering, and Medicine, 2016; Courtier-Orgogozo et al., 2017; de Graeff et al., 2021) on lines 49-51.

      Line 114 - Given the only moderate impacts of Saglin's role in Plasmodium invasion, I am not sure this saglin deletion is a convincing benefit for GD as it is probably not impactful enough alone - can the authors soften this statement?

      --- while it’s correct that Saglin KO mosquitoes show a significant decrease only in P. berghei oocyst counts and not in prevalence when mosquitoes are heavily infected, they do show a significant decrease in both counts and prevalence upon infection with P. berghei and, most importantly_, P. falciparum_ when parasite loads are lower —a situation that is more physiological (e.g. prevalence of 65% and 13% in WT and Sag(-)KI mosquitoes, respectively, upon infection with P. falciparum - Klug et al., PLoS Path 2023). Therefore, for human-relevant P. falciparum infections, an impactful decrease in vector competence can be legitimately expected.

      Line 126 -Can the authors provide rationale for expressing Sc2A10 with Lp instead of expressing it from salivary glands?

      --- There are three reasons for this. First, we knew from the cited Isaacs et al. papers that the 2A10 antibody was efficient against transmission when expressed in the fat body, and from unpublished work (Maria Pissarev, Elena Levashina and Eric Marois) that anti-CSP ScFvs expressed in the fat body of transgenic mosquitoes blocked sporozoite transmission as efficiently as when expressed from salivary glands. This is certainly favored by the easy sporozoite accessibility to the antibody when both are in mosquito hemolymph. Of note, the transmission blocking results suggest that the binding of ScFv to CSP withstands the crossing of the salivary gland epithelium by sporozoites. Second, we were looking for a host gene expressed as high as possible to produce high levels of Sc2A10 antibody. Third, the host gene must be essential so that resistance alleles would not be viable.

      We agree that it would also be possible to use a salivary gene instead of Lp as a host for this antimalarial factor. In this case, a same-locus gene drive may have functioned, but the advantages of the host locus being an essential gene would be lost, at least partially, as genetic ablation of the salivary gland, albeit slowing blood uptake, does not prevent mosquito viability and reproduction (Yamamoto et al., PLoS Path 2016).

      Line 140 - Can authors give any comment on why these regions of Lp were chosen to be recoded / targeted with gRNAs?

      --- inserting Sc2A10 just after the cleaved Lp secretion signal, and N-terminally to the rest of the Lp protein, was the goal, so that 2A10 would be secreted together with Lp and separated from both signal peptide and Lp by naturally occurring proteolysis. This constrained the choice of the target site to be at the junction between signal peptide and the remainder of Lp protein. An alternative design could have been to insert it between the two subunits ApoLpI and ApoLpII, with duplication of the protease cleavage site, or on the C-terminal extremity of the protein, but there would have been no intron in the immediate vicinity to knock-in a selection marker at the same time.

      Line 171 - "stoichiometric"

      --- Corrected.

      Line 186 - Can the authors comment or speculate on why the expression levels of the fusion protein are expected to be lower than endogenous Lp?

      --- We did not expect this. It is hard to predict whether and explain how insertion of exogenous sequences in a gene can alter its expression. Possible explanations include: the existence of harder-to-translate mRNA sequences in the Sc2A10 moiety; the addition of seven exogenous amino acids on the N-terminal side of ApoLpII (mentioned in M&M) possibly modifying the stability of the Lp protein; the modification of the intron sequence perturbing efficient intron excision and/or pre-mRNA expression due to the disruption of regulatory elements or to the new presence of the GFP gene in the antisense orientation (albeit expressed in the nervous system and not in the fat body); the presence of the exogenous Tub56D transcription terminator used to arrest GFP transcription possibly possessing bidirectional termination activity and lowering the mRNA level of the Lp allele…

      Line 211 - Why were 6 mosquitoes used for these assays, and 10 mosquitoes used in later assays (Line 223)?

      --- Mice were always exposed to groups of 10 mosquitoes, but not all 10 mosquitoes were necessarily biting the mice. We retained mice bitten by at least 6 mosquitoes for further analysis (M&M, lines 871-873 of the revised file).

      Line 212 - I would also suggest using letters (Suppl. Table 2A,B,C etc) to refer the specific experiments and sections in the Table.

      --- Implemented.

      Line 225- 228 - The authors should mention in the text that homozygotes and heterozygotes do not differ in infection assays.

      --- Added: Therefore, heterozygous mosquitoes showed a transmission blocking activity comparable to that seen in homozygotes.

      Line 249 - Can the author comment on the impacts of population influx / exchange on the idea that the GD cassette need only be transiently in the population?

      --- If Lp::Sc2A10 is fixed in the population and the GD gone, indeed an influx of WT alleles through mosquito immigration will begin to replace the antimalarial factor and drive it to extinction due to its fitness cost. As mentioned in the final paragraph of the discussion, this could be seen as an advantage to restore the original natural state—hopefully after malaria eradication! However, we regard a situation where Lp::2A10 never reaches fixation as more likely, with its spread being re-ignitable by updated GDs (line 741 of the revised file).

      Line 273 - Can the authors comment on why this may have occurred more frequently than the expected integration of the GD cassette?

      --- When a chromosome break is repaired, each side of the cut must recombine with the repair template. A possible explanation for our observation is that one side of the break recombined with the injected repair plasmid, while the other recombined with the intact sister chromosome (physiologically probably the preferred option). Since this situation still leaves truncated chromosomes, another repair event can join the plasmid-bearing chromosome end to the sister chromosome. The observation that complex rearrangement occurred frequently suggests that such events can be very common, but will usually go undetected due to the absence of genetic markers. Here, GFP on the intact sister chromosome served as a genetic marker to betray its unexpected involvement in the repair process.

      Line 314 - Not all fitness costs are apparent through standard laboratory rearing as was performed in Klug et al. Authors could consider "no known fitness cost" instead.

      --- We agree. This is what we meant by “no fitness cost in laboratory mosquitoes”. We changed this to “no fitness cost at least in laboratory conditions (Klug et al., 2023)” to make clear that this was tested.

      Line 407 - don't start new paragraph (same with 409)

      --- we removed these two lines, as we realized they contained an error, and made a correction on line 420 of the revised manuscript.

      Line 408 - I'm not sure it's clear why all these populations were kept for a different number of generations - can the authors clarify?

      --- Populations 1 and 2 were the oldest founder populations, therefore maintained for the longest time. As described in the text, all other populations were derived from populations 1 and 2 later in time by outcrossing a subset of individuals to WT mosquitoes. For these derived populations, we reset the clock of generation counting to 0 as we monitored the homing phenomenon “from scratch” in transgenic males crossed to WT, and in transgenic females crossed to WT. Resetting the clock resulted in an apparent lower number of generations for these derived populations. In addition, some of them were discarded early, usually after reaching a stable state, as it was difficult to maintain so many populations in parallel over a long period of time.

      Line 558 - "10/12 mice" not immediately clear - the authors could be more specific about how data was combined here

      --- Thank you for pointing out this ambiguity. We replaced by: the absence of infection in a total of 10 out of 12 mice showed… (line 561)

      Line 586 - Since there do appear to be some fitness costs associated with the Sc2A10 version of Lp, might it be expected that fitness costs imposed by the transgene itself could lead to selection pressures leading to its loss? Or do the authors think that these fitness costs are prevented from causing selection against Sc2A10 due to the design of the transgene such that its translation is a prerequisite for Lp's translation? Is the fact that its removal occurs more rapidly than Lp's any indication that selection against the persistence of Sc2A10 may occur?

      --- Yes, we believe that Lp::Sc2A10 will progressively disappear, replaced by the WT allele, as shown in Figure 1C, in the absence of a GD stimulating its maintenance and spread. In the Lp::Sc2A10 transgene, translation of Sc2A10 is indeed a prerequisite for Lp translation, imposing a degree of genetic stability of this transgene in terms of sequence integrity, but this does not mean that the locus cannot be outcompeted by the WT under natural selection, so that long-term persistence of Lp::Sc2A10 depends on the presence of the GD, as outlined in lines 669-672. As the GD itself can disappear due to the accumulation of resistance alleles, we expect a progressive lift of its pressure to maintain Lp::Sc2A10 and both loci to be progressively lost, a form of reversibility that may be regarded as desirable (lines 773-776 in v2, 741-743 in v3). Alternatively, both transmission blocking alleles could be maintained by releasing an updated version of the dual GD.

      Line 659 - add some further detail to this - how do you envision this to occur?

      --- We have deleted this paragraph, as it hypothesized that SagGD could frequently be transmitted to the next generation in the absence of Lp::2A10, which is not the case (it would be lethal, and Lp::2A10 homing is anyway extremely efficient). After a putative field release of [SagGD / Y; Lp::2A10/ Lp::2A10] males, both transgenes should rapidly be introgressed in the field’s genetic background.

      Line 635 - Long paragraph, should be broken up or removal of text. Some of these ideas could possibly be made more concise to improve readability. There are many different hypotheticals that are expanded upon in the discussion.

      --- We admit that this paragraph in the discussion was long and dense. We have split it into 4 smaller paragraphs to better separate the concepts that we want to discuss, and have deleted the part mentioned in the above point.

      Line 677 - This scenario seems potentially unrealistic considering the only subtle impacts of Saglin deletion on vector competence, and the potential for population exchange in mosquito populations to dilute out these alleles if the drive begins to fail. Can the author comment or potentially decrease emphasis on such scenarios?

      --- while Saglin KO mosquitoes show a moderate decrease of infection prevalence in the context of high infections, the Saglin KO decreases parasite loads in all cases, and most importantly, also prevalence upon physiological infections with P. falciparum (Klug et al., PLoS Path 2023 and see our response to your comment to line 114 above). This yields a higher proportion of non-infected mosquitoes. Therefore, the impact of Saglin mutations should be stronger for the epidemiology of human infections with P. falciparum than in laboratory models of infections where parasite loads are very high.

      We agree that mosquito migration in natural populations would progressively dilute out the beneficial alleles once the GD effect ceases. The epidemiological impact is difficult to predict and will strongly depend on the durability of the GD and on the intensity of genetic influx from adjacent mosquito populations.

      Line 708 - Can the authors speculate on why zpg is sensitive to local chromatin and elaborate on possible solutions or consequences for other drive ideas? This seems broadly important.

      --- We do not precisely know why the zpg promoter is more sensitive to local influences than the vasa promoter, but this phenomenon seems common for other promoters as well (e.g., the sds3 promoter as opposed to the shu promoter in Aedes aegypti (Anderson et al., Nat Comm 2023)). It is possible that the vasa promoter is better insulated from local repressive influences, perhaps by insulating elements akin to gypsy insulators in Drosophila. Knowledge of genetic insulators active for mosquito genes is lacking as far as we know. Characterization of efficient mosquito insulators, for example if one could be identified within vasa, and their combination with zpg or sds3 promoter elements, could potentially improve the locus-independent activity of such promoters. Alternatively, a natural and ideal promoter may still be found showing both an optimal window of expression of Cas9 in the germline, and little susceptibility to local repression.

      Line 737 - The suggestion of releasing laboratory-selected resistance alleles in the absence of further context may be provocative and unnecessary here.

      --- We didn’t intend to sound provocative, but are interested in the idea of simple resistance alleles with limited sequence alteration that could be selected in the lab, and released to block a gene drive that turned undesirable, so we wanted to share it with the reader. Mutations in the Lp and Saglin loci, preserving their functions, can be limited to one or few nucleotide changes in the gRNA target sites, as illustrated by the mutants we sequenced. Lab population of GD mosquitoes can, therefore, be a source of GD refractory mutants that could be leveraged in recall strategies.

      Line 850 - unnecessary comma

      --- Corrected.

      Line 854 - change to "after infection, moquitoes were "

      --- Changed.

      Figure 1 - Not clear what is intended to be communicated by shapes portraying proteins / subunits - consider more detailed illustration of mosquito fat body cells synthesizing and secreting proteins rather than words in text box with arrow to clearly demonstrate the point of this figure.

      --- We propose a new version of figure 1 to better illustrate the fat body origin of Lp and 2A10. We have also re-worked the graphic design to improve several figures.

      Figure 3 - I recommend rearranging this figure so that B comes before C, visually. The proportions for the design of in B should also match those used for A.

      --- We have followed these recommendations in the new Figure 3, and also used more logical color codes for the gRNAs and their target genes.

      Figure 5 - It is unclear to me why some Populations were maintained for such different lengths of time.

      --- Same point as above for line #408: Populations 1 and 2 are the oldest founder populations, therefore maintained for the longest time. As described in the text, all other populations were derived from populations 1 and 2 later in time by outcrossing to WT mosquitoes, resulting in a lower number of generations for these derived populations. In addition, some of them were discarded earlier, usually after reaching a stable state, as it was not possible to maintain so many populations in parallel for a long period of time.

      Figure 7 - Ladder should be labeled on the gel. It may also be helpful for the author to indicate clearly exactly which mosquitoes were shown by sequencing to have these different deletions, as it is occasionally unclear based on band sizing.

      --- we have added the ladder sizes as well as a numbering of individual mosquitoes on Figure 7. We sequenced 4 gel-purified small -type B- amplicons of Population 1 individually (#1, 2, 4, 6), and a pool of 4 type B amplicons from Population 7 (pooled #2, 4, 5, 6) as well as two samples of several pooled gel-purified large -type A- amplicons from Population 2 (pool of samples #2, 3, 4, 5, 6, 8, 9, 11, 12) and from Population 7 ( pool of #1, 3, 7, 11, 12). This information now also appears in the material and methods section (PCR genotyping of the SagGDvasa gRNA array).

      Line 996 - given that there is a size band on the right line of this gel also, can authors crop the gel image to eliminate unnecessary lanes a and b from this figure without losing information needed to interpret this blot?

      --- we agree that this would make the message easier to understand, but cropping lanes a and b would place WT control and Lp::Sc2A10 homozygotes on two separate images, even if a size marker is present on each. We prefer keeping the raw image to facilitate direct comparison of the band sizes, making clear that this was a single protein gel.

      Line 1070 - 12 out of how many sequenced mosquitoes?

      --- 12 mosquitoes from each of these four populations served as PCR templates to generate figure 7. A subset of amplicons were sequenced individually or pooled, as described above and now in Methods. All sequencing reactions of type A and type B amplicons showed consistent results.

      Line 1078 - Can remove some detail like % of agarose, and replication of results with different polymerase as these are already in methods.

      --- Done.

      Line 1098 - "Unbless"

      --- Corrected

      Reviewer #2 (Significance):

      This study illustrates a wide range of issues pertinent for gene drive implementation for malaria control, and as such is of value to the field of entomologists, genetic engineers, parasitologists and public health professionals. The gene drive designs explored for this study are interesting largely from a basic biology perspective pertinent mostly to specialists in the field of genetic engineering and vector biology, but highlight challenges associated with this technology that could also be of interest to a broader audience. A transmission blocking gene drive has not yet been achieved in malaria mosquitoes, and is thus a novel space for exploration. As a medical entomologist that works predominantly outside of the genetic engineering space, I have appreciated the detail the authors have provided with regard to their rationale and findings, even when these findings were inconsistent with the authors' primary objectives or expectations.

      --- Thank you for your positive assessment and for this in-depth evaluation of our data.

      Reviewer #3 (Evidence, reproducibility and clarity):

      The study by Green et al. generated a gene drive targeting both Saglin and Lipophorin in the Anopheles mosquito, with a view to blocking Plasmodium parasite transmission. This is a highly complex but elegant study, which could significantly contribute to the design of novel strategies to spread antimalarial transgenes in mosquitoes.<br /> Overall, this is a complex study which, for a non-specialist reader gets quite technical and heavy in most parts. Despite this, there are key points showing that suppression gene drive may not be the way forward in this instance. However, I would advise explaining certain elements in more detail for the benefit of the general readers. I only have minor points for the authors to address:<br /> 1) Please point out for the general reader that Anopheles coluzzii belongs to the gambiae complex, since you explain that gambiae are the major malaria spreaders in sub-Saharan Africa.

      --- done in the introduction (lines 71-73) also in response to Rev. 1

      2) The authors pretty much give all results in the last part of the introduction, could the intro be shortened by removing these parts, or just highlighting in a single paragraph the main take home message?

      --- We have condensed this part to highlight the take home messages in the last paragraph, also in response to Rev. 1.

      3) Why is Vg mentioned? It is only mentioned once and doesn't have any other mention through the manuscript.

      --- this introduces the two proteins that are by far the most abundant, and present at similar levels, in the hemolymph of blood-fed females, Vg being also prominent on the Coomassie stained gel of fig.1. We mention Vg also because it represents another excellent candidate locus to host anti-plasmodium factors, as discussed later on lines 600-610 of the Discussion section.

      4) Please make it clearer for non-specialists why Cecropin wasn't used.

      ---On lines 630-636 we explain that we decided to leave out Cecropin to avoid potential additional fitness costs due to expression at all life stages in the fat body, as opposed to solely in the midgut after blood meal (Isaacs et al. PNAS 2012); and to avoid complexifying the anti-Plasmodium Lipophorin locus in a way that could further reduce the functionality of the Lp gene. We also had prior knowledge from unplublished work that Sc2A10 alone was sufficient to block sporozoite infectivity.

      5) Why were homozygous and not heterozygous transgenics transfected if there is such as fitness cost to homozygous mosquitoes?

      --- the fitness cost of homozygous mosquitoes is actually mild, unnoticeable if homozygotes are bred in the absence of competing heterozygotes and wild-types (lines 151-156). Microinjection experiments to obtain the different versions of SagGD were, therefore, performed on either the heterozygous or homozygous line. As for infection assays, the anticipated effect of gene drive is to promote homozygosity at the Lp::Sc2A10 locus. For this reason, it made sense to test the vector competence of homozygotes, in addition to the fact that the Plasmodium-blocking phenotype was expected to be stronger (and thus, easier to document) with two copies of the transgene. Only after obtaining a large dataset from infection assays with homozygotes did we test heterozygotes and found that they actually had a similar phenotype.

      6) Line 211 - what was the average number of infected mosquitoes used per infection for each mosquito strain?

      --- As described in the text (lines 204-206 of v2; 208-212 of the revision) and in the Methods (lines 868-873), non-infected mosquitoes were discarded prior to performing the experiment using 10 infected mosquitoes per mouse, and we discarded mice bitten by fewer than 6 mosquitoes. So at least 6 infected mosquitoes bit each mouse (often 8-9).

      7) Line 219 - please be clearer regarding this being infection detected in the blood.

      --- We replaced « infection » with « detectable parasitemia in the blood »

      8) Line 320 - please clarify why the zpg promoter was used.

      --- The advantages of zpg are mentioned in lines 257-258 and 320-322 (revised file).

      9) Line 375 - what was the rationale for using so many gRNAs?

      --- 3 or 4 gRNAs against Lipophorin and 3 gRNAs against Saglin, amounting to a total of 6 or 7 gRNAs against the two loci. The rationale is explained on lines 249-253 : the goal was to maximize the chance of causing loss-of-function mutations in the essential Lp gene and to favor elimination of GD resistant alleles by natural selection, in case of failed homing. For Saglin which is a non-essential gene, we wanted to ensure loss-of-function of failed homing alleles to achieve a reduction in vector competence, even if GD-resistant alleles accumulate. We sought to make this rationale clearer by adding a sentence on lines 328-332:

      Multiplexing the gRNAs was intended to promote the formation of loss-of-function alleles in case of failed homing at the Lp and Saglin loci: non-functional alleles of the essential Lp gene would be eliminated by natural selection while non-functional Saglin alleles would reduce vector competence.

      Line 555 - please state how long post bite back parasite appears in infected mice.

      --- We changed this sentence to : …two of these six mice developed parasitemia six days after infection<br /> (line 556).

      Reviewer #3 (Significance):

      This is potentially a highly significant study that could provide a vital mechanism for generating efficient gene drives. Although highly technical and complex in most parts, with a little clarification in certain areas this manuscript could be of great value to a general readership.

      --- Thank you for your appreciation and thoughtful evaluation of our manuscript.

      Reviewer #4 (Evidence, reproducibility and clarity):

      The authors hijacked the Anopheles coluzzii Lipophorin gene to express the antibody 2A10, which binds sporozoites of the malaria parasite Plasmodium falciparum. The resulting transgenic mosquitoes showed a reduced ability to transmit Plasmodium.

      The authors also designed and tested several CRISPR-based gene drives. One targets Saglin gene and simultaneously cleaves the wild-type Lipophorin gene, aiming to replace the wildtype version with the Sc2A10 alele while bringing together the Saglin gene drive.

      Drive-resistant alleles were present in population-caged experiments, the Saglin-based gene drive reached high levels in caged mosquito populations though, and simultaneously promoted the spread of the antimalarial Lp::Sc2A10 allele.

      This work contributes to the design of novel strategies to spread antimalarial transgenes in mosquitoes. It also displays issues related to using multiplexing gene-drive designs due to DNA rearrangements that could prevent the efficient spread of the gene drive in the long term.

      This is tremendous work considering how many transgenic lines and genetic crosses are performed using mosquitoes. The conclusions are supported by the data presented, and some modifications regarding the experimental design description through text/figure improvements would facilitate the reading and flow of the paper.

      Here some questions/comments:

      • Line 124-125: Reference?

      --- added

      • Line 133-134: Reference?

      --- added

      • Table 1: It seems the authors have some issues recovering a good amount Sc2A10 from hemolymph samples. Is this a problem of the antibody per se? Is it the Lp endogenous promoter weak? Could this be improved by placing the antibody in a different genomic region? Alternatives could be discussed.

      --- The 2A10 antibody must be initially produced in the same, very high, amounts as the Lp endogenous protein with which it is co-translated. Therefore, its low relative abundance must result from faster turnover or stickiness to tissue, as hypothesised on lines 176-177. We believe that virtually any other endogenous promoter would be weaker than Lp and produce lower Sc2A10 levels.

      • Fig.1B: It would be nice to have a representation of the genome after integration. You could add a B' panel or just another schematic under the current one.

      --- In agreement with this suggestion and that of rev. 3, we added a new panel in 1B.

      • Supplementary Fig.1b: Could the authors explain the origin of the (first) zpg promoter used? Is it from An. Coluzzii? It seems they use a different one in the gene drive designs later (see comments below too).

      --- We initially cloned a PCR-amplified zpg promoter region of the same size as the version published by Kyrou et al., from genomic DNA from our colony of A. coluzzii. The resulting promoter fragment harbored several single nucleotide polymorphisms (SNPs) compared to published sequences, as typically observed when cloning genomic fragments due to high genetic diversity in Anopheles species. Such SNPs are not usually expected to affect promoter activity, but are difficult to distinguish from PCR mutations which, in turn, could decrease or abolish promoter activity if mutating an essential transcription factor binding site. For this reason, our next constructs were based on the validated zpg sequences from Kyrou et al. The first cloning strategy was described in the results section but was missing in the material and method section. This is now corrected (lines 773-779).

      • Fig.3: Please, correct to A, B, C order. Current one is A, C, B.

      --- Done.

      Could the authors include a schematic of the final mosquito genome after integration? I can see they are targeting two different locations (Saglin and Lp). It is unclear though from the figure where the Sc2A10-GFP is coming from. I understand this represents the mosquito genome as you injected heterozygous animals already containing the Sc2A10-GFP. Maybe label the Sc2A10-GFP as mosquito genome or similar? A schematic showing mosquito embryos already carrying this and then the plasmid being injected could help.

      --- Figure 3 does not represent the injection of new transgenic constructs. Instead, it shows the conversion process of chromosomes X and II in a germ cell carrying both transgenes in the heterozygous state, to illustrate how the dual gene drive can spread in a population after WT mosquitoes mated with transgenics carrying both the SagGD and Lp-2A10 alleles. We have re-worked the graphic design of this figure and modified its title to make this more clear.

      • Line 330-331: Do you know the transgenesis efficiency? Did the authors make single or pools for crossing and posterior screening? It would be interesting to know about transgenesis rates to inform the community.

      --- we no longer perform single crosses for transgenesis, as batch crosses ensure higher recovery of transgenics due to the collective reproductive behavior (swarming) in Anopheles. Therefore, we cannot precisely calculate the transgenesis efficiency. However, >60 positive G1s from a pool of 36 G0 males crossed to WT females is indicative of a rather high integration efficiency. We consistently observe high efficiency of transgene integration when using the CRISPR/Cas9 system, that we estimate to be about 5-fold more efficient than docking site transgenesis, and much more efficient than piggyBac mediated transgenesis.

      • Line 357/Fig.4B: Could the authors explain in the text GFP+ vs. GFP++?

      --- GFP++ was meant to indicate higher intensity of GFP fluorescence than GFP+, due to two copies of the transgene versus one, but see our response to reviewer 1’s comment to line 356 about the questionability of homing in the zygote.

      • Line 357: Where is the vasa promoter that made the "rescue" coming from? Is it amplified from Coluzzii? Please, include this explanation for clarification. Why the authors think the zpg from Kyrou et al 2018 works for the cassette integration but not for homing? They discuss positional effects, any references showing that?

      --- We amplified the vasa promoter from A. coluzzii using primers CggtctcaATCCcgatgtagaacgcgagcaaa and CggtctcaCATAttgtttcctttctttattcaccgg (annealing sequence underlined) to have a fragment equivalent to that (vas2) characterized in Papathanos et al, 2009. We have now added this information in the Methods under Plasmid construction. This is the only source of vasa promoter used in this work.

      About zpg promoter activity : we have past experience suggesting that promoters, such as the hsp70 promoter from Drosophila, can be sufficient to express enzymatic activities in embryos injected with helper plasmids, even though the same promoters appear to become inactive once integrated in the genome. This may be due to injected “naked” plasmids being readily accessible to the transcription machinery, unlike organized chromatin. A recent reference showing genomic positional influences on promoter efficiency is Anderson et al., 2023, which we have added on line 710 of the Discussion.

      • Line 362: No reference to figure nor table.

      --- These data (numbers from a COPAS analysis) are provided directly in the text in this sentence (which has been clarified in response to Reviewer 1). See lines 364-369 of the revision.

      • Line 417: The text brings the reader back to Fig.3C. Could the authors move this panel for easier flow of the paper?

      --- We agree that positioning of this panel in Figure 3 is a bit awkward, but this western blot pertains to the characterization of the insertion shown in Fig. 3. Placing it after COPAS analyses would be equally awkward.

      • Line 472-474: How many WT alleles were recovered? It is not stated unless I missed anything, which is possible.

      --- We refrained from providing a quantification of this, and focussed on qualitative results, as we didn't trust the quantitative representativity of our high-throughput amplicon sequencing results in terms of allele frequency in the sampled mosquito population. A large fraction of sequenced reads corresponded to PCR artefacts such as primer dimers and unspecific short amplicons, potentially affecting the relative frequencies of gene-specific amplicons. However, among the sequenced gene-specific amplicons, WT alleles were the majority (lines 474-475).

      • Fig.5. Could the authors discuss why the observed DsRed-gene drive drop in population 1 at ~18 generation? The population gets to the point where only 50% of the population carries the Cas9-DsRed cassette. Considering that the Saglin gene drive only converts through females (inserted into the X chr.), and some indels could be generated by generation 20, how do you explain the great recovery until fully spreading into the population?

      --- We agree that this is somewhat puzzling. We don’t have a satisfactory explanation beyond stochastic effects, possibly promoted by population bottlenecks: although we strived to maintain these populations at a high number of individuals at each generation, we cannot exclude that at a given generation only a relatively small fraction of individuals contributed to the next generation, leading to fluctuations in allelic frequencies. This would be possible particularly for populations 1 and 2, which were not monitored frequently between generations 10 and 18, at which point additional populations 5-8 were established and it was decided that close monitoring of all populations was important.

      It seems to me populations 3-8 are new cage experiments by randomly picking mosquitoes from populations 1 and 2 (at a specific generation) and mixing them with WT individuals. Could the authors explain the reasoning for these experiments? I believe populations 3-8 deserves a different figure (main or supplementary) describing how they were seeded. It is confusing having everything together as these experiments were performed differently way and for a different reason compared to populations 1 and 2. Some cage schematics and drawings would help in understanding the protocol strategy for populations 3-8.

      --- This is correct for populations 3 and 4 that indeed originated from randomly picking mosquitoes from populations 1 and 2 at generation 10 and mixing them with WT individuals. Populations 5, 6, 7 and 8 are crosses between generation 16 transgenic partners of one sex to WT of the other sex, as indicated above the COPAS diagrams provided in Suppl. File 2. We apologize for having insufficiently described how each population was assembled and now provide more details (lines 422-429, in the figure 5 legend, and G0 crosses spelled out on top of each population diagram). In setting up these populations, we wanted to test the effects of various routes by which the transgenes may be introduced into a wild mosquito population: release of unsorted transgenic males + females, or release of one sex only (probably males in the field, but the crosses with transgenic females as with transgenic males also served to re-quantify homing in the second generation of each cross).

      The modified text reads as follows:

      Populations 3 and 4 were established by mixing randomly selected transgenic mosquitoes (both males and females of generation 10) from populations 1 and 2, respectively, with wild-types, to mimic what may occur in a mixed-sex field release. Populations 5-8 were established by crossing single-sex transgenic mosquitoes to WT of the opposite sex, both to mimic a single-sex field release and to re-assess homing efficiency after 16 generations.

      Also, could you add homozygous and heterozygous labels in the figure legend to help understanding the different lines.

      --- As indicated on the side of the figure and in the figure legend, lines don’t represent homozygous vs. heterozygous frequency, but allele frequency (continuous lines), and frequency of mosquitoes carrying the transgene (dotted lines). In the figure legend we now provided the calculation formulas for gene frequency: [ 2 x (number of homozygotes) + (number of heterozygotes)] / 2 x (total number of larvae) for the autosomal Lp::2A10 transgene, and [ 2 x (number of homozygotes) + (number of heterozygotes) ] / 1.5 x (total number of larvae) for the X-linked SagGD transgene.

      • Fig.6: The authors sequenced non-DsRed individuals from generations 3-4. The authors also mentioned they sequenced mosquitoes from generation 32 (Fig.7). Interestingly, they observed that these mosquitoes were missing a piece of the cassette (they contained 2 gRNAs instead of 7). Since the amplicons only cover the gRNA portion, a PCR covering the Zpg-Cas9 portion would be ideal to confirm that only the gRNAs are missing. Sampling DsRed+ mosquitoes from generations 3, 18 and 31 (populations 1 and 2) and carrying out these experiments is recommended. Although unlikely, I would be worried about the Cas9 being deleted due to unexpected DNA rearrangements; in that case, the cassette would contain the DsRed marker alone.

      --- Thank you for this suggestion. We no longer have DNA samples from the earlier generations. Thus, we genotyped 7 DsRed positive male mosquitoes from each of current populations 1, 2 and 7 (generation 41 since transgenesis) for the presence of Cas9. We detected a Cas9-specific amplicon of 1.6 kb in 21/21 sampled DsRed positive mosquitoes, in parallel to the same shortened gRNA arrays detected in earlier generations. This suggests that the Cas9 part of the transgene was not affected by the loss of gRNA units. We made a panel C in Figure 7 showing these results and mentioned them on lines 537-538. Of note, the Cas9 moiety of the gene drive construct shows no repetitive sequence and should therefore not be as unstable as the gRNA multiplex array. The observed excisions of gRNA expression units were strictly due to recombinations between repeated U6 promoter sequences (Fig. 7).

      The authors employ 3 different gRNAs that are 43 and 310 nts apart. It has been shown that only 20 nt lack of homology produces an important reduction on gene drive performance (Lopez del Amo et al 2020, Nat Comms). Also, it has been shown that gRNA multiplexing approaches should be kept with a low number of gRNAs, 2 being maybe the best one depending on the design (Samuel Champer 2020, Sciences Advances). This could be discussed more.

      --- Thank you for this suggestion. These results were not published when this study was initiated, so that our gene drive constructs could only be designed on empirical bases. For gRNA numbers, see the new discussion point and inclusion of a reference to the study by S. Champer et al., on line 700-702. The reduction of drive performance with longer non-homologous stretches is indeed also a very important point, that we now discuss on lines 713-717, citing your study:

      Finally, tighter clustering of gRNA target sites at target homing loci, especially Saglin, should improve gene drive performance by reducing the length of DNA sequences flanking the cut site that bear no homology to the repair template on the sister chromosome and need to be resected by the repair machinery to allow homing (López Del Amo et al., 2020)__.

      Reviewer #4 (Significance):

      There are different novelty aspects from my point of view in this work. While most of the scientists focus on developing CRISPR-based gene drives in An. Stephensi and gambiae, this work employs An. Coluzzii. Some limitations regarding fitness cost associated with the Lp gene were also noted and discussed by the authors.

      --- To be fair, earlier gene drive studies were performed on the G3 laboratory strain, traditionally named A. gambiae, although it is probably itself a hybrid strain from gambiae and coluzzii. Still, the Ngousso strain from Cameroon that was used in this study is thought to be a bona fide A. coluzzii. We have also added a reference to a recent paper (Carballar-Lejarazu et al., 2023) that also describes a population modification GD in A. coluzzii.

      First, they show that An. Coluzzii mosquitoes infect less when containing the antimalarial effector cassette inserted in their genomes. Second, a gene drive is showing super-Mendelian inheritance in An. Coluzzii, which would be the second example of a gene drive in these mosquitoes so far to my knowledge.

      I believe this is the first manuscript experimentally using multiplexing approaches (multiple gRNAs) in mosquitoes (all previous works I saw were performed in flies). While previous gene-drive works employ only one gRNA in mosquitoes, this works explores the use of different gRNAs targeting nearby locations to potentially improve HDR rates and gene drive spread. Although they observe gene drive activity, they also show DNA rearrangements due to the intrinsic nature of multiplexing gene drives that can generate multiple DNA double-strand breaks, impeding proper HDR and clean replacement of the wildtype alleles. This is important from a technical point of view as it shows this approach requires optimization. They included 3 gRNAs targeting the Saglin gene, and trying 2gRNAs instead could be interesting for future investigations.

      --- We now discussed optimization with the help of modeling, in response to Reviewer 1, on lines 701-702.

      This work will be very useful for the CRISPR-based gene drive field, which seeks to develop genome editing tools to control mosquito populations and reduce the impact of vector-borne diseases such as malaria.

      This reviewer intended to understand the work and provide constructive feedback to the best of my abilities. I apologize in advance if I misunderstood anything.

      --- Thank you for your appreciation, insight, and constructive evaluation of our manuscript.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #4

      Evidence, reproducibility and clarity

      The authors hijacked the Anopheles coluzzii Lipophorin gene to express the antibody 2A10, which binds sporozoites of the malaria parasite Plasmodium falciparum. The resulting transgenic mosquitoes showed a reduced ability to transmit Plasmodium.

      The authors also designed and tested several CRISPR-based gene drives. One targets Saglin gene and simultaneously cleaves the wild-type Lipophorin gene, aiming to replace the wildtype version with the Sc2A10 alele while bringing together the Saglin gene drive.

      Drive-resistant alleles were present in population-caged experiments, the Saglin-based gene drive reached high levels in caged mosquito populations though, and simultaneously promoted the spread of the antimalarial Lp::Sc2A10 allele.

      This work contributes to the design of novel strategies to spread antimalarial transgenes in mosquitoes. It also displays issues related to using multiplexing gene-drive designs due to DNA rearrangements that could prevent the efficient spread of the gene drive in the long term.

      This is tremendous work considering how many transgenic lines and genetic crosses are performed using mosquitoes. The conclusions are supported by the data presented, and some modifications regarding the experimental design description through text/figure improvements would facilitate the reading and flow of the paper.

      Here some questions/comments:

      • Line 124-125: Reference?
      • Line 133-134: Reference?
      • Table 1: It seems the authors have some issues recovering a good amount Sc2A10 from hemolymph samples. Is this a problem of the antibody per se? Is it the Lp endogenous promoter weak? Could this be improved by placing the antibody in a different genomic region? Alternatives could be discussed.
      • Fig.1B: It would be nice to have a representation of the genome after integration. You could add a B' panel or just another schematic under the current one.
      • Supplementary Fig.1b: Could the authors explain the origin of the (first) zpg promoter used? Is it from An. Coluzzii? It seems they use a different one in the gene drive designs later (see comments below too).
      • Fig.3: Please, correct to A, B, C order. Current one is A, C, B.<br /> Could the authors include a schematic of the final mosquito genome after integration? I can see they are targeting two different locations (Saglin and Lp). It is unclear though from the figure where the Sc2A10-GFP is coming from. I understand this represents the mosquito genome as you injected heterozygous animals already containing the Sc2A10-GFP. Maybe label the Sc2A10-GFP as mosquito genome or similar? A schematic showing mosquito embryos already carrying this and then the plasmid being injected could help.
      • Line 330-331: Do you know the transgenesis efficiency? Did the authors make single or pools for crossing and posterior screening? It would be interesting to know about transgenesis rates to inform the community.
      • Line 357/Fig.4B: Could the authors explain in the text GFP+ vs. GFP++?
      • Line 357: Where is the vasa promoter that made the "rescue" coming from? Is it amplified from Coluzzii? Please, include this explanation for clarification. Why the authors think the zpg from Kyrou et al 2018 works for the cassette integration but not for homing? They discuss positional effects, any references showing that?
      • Line 362: No reference to figure nor table.
      • Line 417: The text brings the reader back to Fig.3C. Could the authors move this panel for easier flow of the paper?
      • Line 472-474: How many WT alleles were recovered? It is not stated unless I missed anything, which is possible.
      • Fig.5. Could the authors discuss why the observed DsRed-gene drive drop in population 1 at ~18 generation? The population gets to the point where only 50% of the population carries the Cas9-DsRed cassette. Considering that the Saglin gene drive only converts through females (inserted into the X chr.), and some indels could be generated by generation 20, how do you explain the great recovery until fully spreading into the population?

      It seems to me populations 3-8 are new cage experiments by randomly picking mosquitoes from populations 1 and 2 (at a specific generation) and mixing them with WT individuals. Could the authors explain the reasoning for these experiments? I believe populations 3-8 deserves a different figure (main or supplementary) describing how they were seeded. It is confusing having everything together as these experiments were performed differently way and for a different reason compared to populations 1 and 2. Some cage schematics and drawings would help in understanding the protocol strategy for populations 3-8.

      Also, could you add homozygous and heterozygous labels in the figure legend to help understanding the different lines.

      • Fig.6: The authors sequenced non-DsRed individuals from generations 3-4. The authors also mentioned they sequenced mosquitoes from generation 32 (Fig.7). Interestingly, they observed that these mosquitoes were missing a piece of the cassette (they contained 2 gRNAs instead of 7). Since the amplicons only cover the gRNA portion, a PCR covering the Zpg-Cas9 portion would be ideal to confirm that only the gRNAs are missing. Sampling DsRed+ mosquitoes from generations 3, 18 and 31 (populations 1 and 2) and carrying out these experiments is recommended. Although unlikely, I would be worried about the Cas9 being deleted due to unexpected DNA rearrangements; in that case, the cassette would contain the DsRed marker alone.

      The authors employ 3 different gRNAs that are 43 and 310 nts apart. It has been shown that only 20 nt lack of homology produces an important reduction on gene drive performance (Lopez del Amo et al 2020, Nat Comms). Also, it has been shown that gRNA multiplexing approaches should be kept with a low number of gRNAs, 2 being maybe the best one depending on the design (Samuel Champer 2020, Sciences Advances). This could be discussed more.

      Significance

      There are different novelty aspects from my point of view in this work. While most of the scientists focus on developing CRISPR-based gene drives in An. Stephensi and gambiae, this work employs An. Coluzzii. Some limitations regarding fitness cost associated with the Lp gene were also noted and discussed by the authors.

      First, they show that An. Coluzzii mosquitoes infect less when containing the antimalarial effector cassette inserted in their genomes. Second, a gene drive is showing super-Mendelian inheritance in An. Coluzzii, which would be the second example of a gene drive in these mosquitoes so far to my knowledge.

      I believe this is the first manuscript experimentally using multiplexing approaches (multiple gRNAs) in mosquitoes (all previous works I saw were performed in flies). While previous gene-drive works employ only one gRNA in mosquitoes, this works explores the use of different gRNAs targeting nearby locations to potentially improve HDR rates and gene drive spread. Although they observe gene drive activity, they also show DNA rearrangements due to the intrinsic nature of multiplexing gene drives that can generate multiple DNA double-strand breaks, impeding proper HDR and clean replacement of the wildtype alleles. This is important from a technical point of view as it shows this approach requires optimization. They included 3 gRNAs targeting the Saglin gene, and trying 2gRNAs instead could be interesting for future investigations.

      This work will be very useful for the CRISPR-based gene drive field, which seeks to develop genome editing tools to control mosquito populations and reduce the impact of vector-borne diseases such as malaria.

      This reviewer intended to understand the work and provide constructive feedback to the best of my abilities. I apologize in advance if I misunderstood anything.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      The study by Green et al. generated a gene drive targeting both Saglin and Lipophorin in the Anopheles mosquito, with a view to blocking Plasmodium parasite transmission. This is a highly complex but elegant study, which could significantly contribute to the design of novel strategies to spread antimalarial transgenes in mosquitoes.<br /> Overall, this is a complex study which, for a non-specialist reader gets quite technical and heavy in most parts. Despite this, there are key points showing that suppression gene drive may not be the way forward in this instance. However, I would advise explaining certain elements in more detail for the benefit of the general readers. I only have minor points for the authors to address:

      1. Please point out for the general reader that Anopheles coluzzii belongs to the gambiae complex, since you explain that gambiae are the major malaria spreaders in sub-Saharan Africa.
      2. The authors pretty much give all results in the last part of the introduction, could the intro be shortened by removing these parts, or just highlighting in a single paragraph the main take home message?
      3. Why is Vg mentioned? It is only mentioned once and doesn't have any other mention through the manuscript.
      4. Please make it clearer for non-specialists why Cecropin wasn't used.
      5. Why were homozygous and not heterozygous transgenics transfected if there is such as fitness cost to homozygous mosquitoes?
      6. Line 211 - what was the average number of infected mosquitoes used per infection for each mosquito strain?
      7. Line 219 - please be clearer regarding this being infection detected in the blood.
      8. Line 320 - please clarify why the zpg promoter was used.
      9. Line 375 - what was the rationale for using so many gRNAs?<br /> Line 555 - please state how long post bite back parasite appears in infected mice.

      Significance

      This is potentially a highly significant study that could provide a vital mechanism for generating efficient gene drives. Although highly technical and complex in most parts, with a little clarification in certain areas this manuscript could be of great value to a general readership.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      The authors initially created a transgenic mosquito colony expressing the Sc2A10 antibody fused to the lipid transporter Lipophorin, and tested the transmission-blocking activity of this transgene. Building off of previous findings that the Sc2A10 antibody inhibits sporozoite infectivity when expressed in mosquito salivary glands, the authors showed that found it was also efficient at inhibiting sporozoite infectivity when secreted into the hemolymph expressed under the lipophorin endogenous promoter in An. coluzzii. They then designed and tested two different gene drives utilizing the Sc2A10-Lipophorin fusion protein. In the first, the authors used a recoded allele of Lp-Sc2A10 while simultaneously utilizing gRNAs that targeted endogenous Lp in an effort to select for mosquitoes that expressed transgenic Lp-Sc2A10 due to the essential nature of Lp. However, this drive was unsuccessful because recoded Lp is necessarily heterozygous while the GD is entering the population, and Lp proved to be largely haploinsufficient. Further, the zpg promoter expressing cas9 was not effective in promoting homing of the gRNAs. In the second gene drive that was tested, authors made use of the endogenous Saglin locus, which expresses a natural agonist for Plasmodium, and is thus desirable to target for disruption in a gene drive that aims to reduce vector competence for Plasmodium. This gene drive also uses recoded Lp-Sc2A10 to replace the wild-type Lp allele, thus selecting for Sc2A10 expression, however this drive is not dependent on fitness of individuals with only one functional copy of Lp.

      The authors discovered that the efficacy of the zpg promoter to drive homing of cas9 is locus-dependent, limiting the success of their gene drive designs. They do show, however, that the Saglin gene drive succeeds at reaching high frequencies in mosquito populations using instead the vasa promoter to express cas9, and that these transgenic mosquitoes are able to reduce infectivity of sporozoites in a bite-back mouse model. However, they observe gene drive refractory mutations in the Lp gene, despite its highly conserved nature, showcasing the difficulty of avoiding drive resistance even in small populations of mosquitoes, and also observed deletions of gRNAs targeting both Lp and Saglin, further highlighting possible shortcomings in gene drive approaches. Together, these findings are useful to the field in walking the readers through an interesting and promising approach for a novel gene drive, and illustrating the challenges in engineering an efficacious and long-lasting drive.

      Major comments:

      As the authors are able to observe Plasmodium within mosquitoes, it would be useful to have these data in the manuscript pertaining to the prevalence and intensity of infection in mosquitoes prior to bite-back assays. If there are data or images that the authors could include, it would be helpful to show if there is a possibility that infection intensity is a variable that contributes to whether or not mice develop an infection. It would also be interesting to note whether there is a different in infection (oocysts or sporozoites) between transgenic mosquitoes and wild type mosquitoes.

      The authors also go into significant detail in the discussion exploring ideas of how to optimize or improve this specific gene drive design. The authors should also stress further the applicability of their discoveries in other gene drive designs, and emphasize the lessons they learned in the difficulties encountered in this study and how these findings could guide others in their decision making process when choosing targets or elements to include in a potential gene drive approach.

      Minor comments:

      Line 44 - female sterility but also female killing approaches to crash pop. like X shredder, if authors would like to expand

      Lines 48-60 - Authors should add some references from the literature surrounding ethics and ecology studies related to gene drive release

      Line 114 - Given the only moderate impacts of Saglin's role in Plasmodium invasion, I am not sure this saglin deletion is a convincing benefit for GD as it is probably not impactful enough alone - can the authors soften this statement?

      Line 126 -Can the authors provide rationale for expressing Sc2A10 with Lp instead of expressing it from salivary glands?

      Line 140 - Can authors give any comment on why these regions of Lp were chosen to be recoded / targeted with gRNAs?

      Line 171 - "stoichiometric"

      Line 186 - Can the authors comment or speculate on why the expression levels of the fusion protein are expected to be lower than endogenous Lp?

      Line 211 - Why were 6 mosquitoes used for these assays, and 10 mosquitoes used in later assays (Line 223)?

      Line 212 - I would also suggest using letters (Suppl. Table 2A,B,C etc) to refer the specific experiments and sections in the Table.

      Line 225- 228 - The authors should mention in the text that homozygotes and heterozygotes do not differ in infection assays.

      Line 249 - Can the author comment on the impacts of population influx / exchange on the idea that the GD cassette need only be transiently in the population?

      Line 273 - Can the authors comment on why this may have occurred more frequently than the expected integration of the GD cassette?

      Line 314 - Not all fitness costs are apparent through standard laboratory rearing as was performed in Klug et al. Authors could consider "no known fitness cost" instead.

      Line 407 - don't start new paragraph (same with 409)

      Line 408 - I'm not sure it's clear why all these populations were kept for a different number of generations - can the authors clarify?

      Line 558 - "10/12 mice" not immediately clear - the authors could be more specific about how data was combined here

      Line 586 - Since there do appear to be some fitness costs associated with the Sc2A10 version of Lp, might it be expected that fitness costs imposed by the transgene itself could lead to selection pressures leading to its loss? Or do the authors think that these fitness costs are prevented from causing selection against Sc2A10 due to the design of the transgene such that its translation is a prerequisite for Lp's translation? Is the fact that its removal occurs more rapidly than Lp's any indication that selection against the persistence of Sc2A10 may occur?

      Line 659 - add some further detail to this - how do you envision this to occur?

      Line 635 - Long paragraph, should be broken up or removal of text. Some of these ideas could possibly be made more concise to improve readability. There are many different hypotheticals that are expanded upon in the discussion.

      Line 677 - This scenario seems potentially unrealistic considering the only subtle impacts of Saglin deletion on vector competence, and the potential for population exchange in mosquito populations to dilute out these alleles if the drive begins to fail. Can the author comment or potentially decrease emphasis on such scenarios?

      Line 708 - Can the authors speculate on why zpg is sensitive to local chromatin and elaborate on possible solutions or consequences for other drive ideas? This seems broadly important.

      Line 737 - The suggestion of releasing laboratory-selected resistance alleles in the absence of further context may be provocative and unnecessary here.

      Line 850 - unnecessary comma

      Line 854 - change to "after infection, moquitoes were "

      Figure 1 - Not clear what is intended to be communicated by shapes portraying proteins / subunits - consider more detailed illustration of mosquito fat body cells synthesizing and secreting proteins rather than words in text box with arrow to clearly demonstrate the point of this figure.

      Figure 3 - I recommend rearranging this figure so that B comes before C, visually. The proportions for the design of in B should also match those used for A.

      Figure 5 - It is unclear to me why some Populations were maintained for such different lengths of time.

      Figure 7 - Ladder should be labeled on the gel. It may also be helpful for the author to indicate clearly exactly which mosquitoes were shown by sequencing to have these different deletions, as it is occasionally unclear based on band sizing.

      Line 996 - given that there is a size band on the right line of this gel also, can authors crop the gel image to eliminate unnecessary lanes a and b from this figure without losing information needed to interpret this blot?

      Line 1070 - 12 out of how many sequenced mosquitoes?

      Line 1078 - Can remove some detail like % of agarose, and replication of results with different polymerase as these are already in methods.

      Line 1098 - "Unbless"

      Significance

      This study illustrates a wide range of issues pertinent for gene drive implementation for malaria control, and as such is of value to the field of entomologists, genetic engineers, parasitologists and public health professionals. The gene drive designs explored for this study are interesting largely from a basic biology perspective pertinent mostly to specialists in the field of genetic engineering and vector biology, but highlight challenges associated with this technology that could also be of interest to a broader audience. A transmission blocking gene drive has not yet been achieved in malaria mosquitoes, and is thus a novel space for exploration. As a medical entomologist that works predominantly outside of the genetic engineering space, I have appreciated the detail the authors have provided with regard to their rationale and findings, even when these findings were inconsistent with the authors' primary objectives or expectations.

    5. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      In this study, the authors made a two-component homing modification gene drive in Anopheles coluzii with a different strategy than usual. The final drive itself targets and disrupts the saglin gene that is nonessential for mosquitoes, but important for the malaria parasite. The drive uses several gRNAs, and some of these target the Lp gene where an anti-malaria antibody is added, fused to the native gene (this native gene is also essential, removing nonfunctional resistance alleles at this locus). In general, the system is promising, though imperfect. Some of the gRNAs self-eliminate due to recombination of repetitive elements, and the fusion of the antimalaria gene had a modest fitness cost. Additionally, the zpg promoter was unable to operate at high efficiency, requiring use of the vasa promoter, which suffers from maternal deposition and somatic expression (the latter of which increased fitness costs at the Lp target). The manuscript has already undergone some useful revisions since its earliest iteration, so additional recommended revisions are fairly modest.

      Line 43-45: The target doesn't need to be female sterility. It can be almost any haplosufficient but essential target (female sterility works best, so it has gotten the most study, but others have been studied too).

      Line 69: A quick motivation for studying Anopheles coluzii should be added here (since gambiae is discussed immediately before this).

      Introduction section: It might be helpful to break up the introduction into additional paragraphs, rather than just two.

      Introduction last part: The last part of the introduction reads more like an abstract or conclusions section. Perhaps a little less detail would fit better here, so the focus can be on introducing the new drive components and targets

      Line 207-213: This material could go in the methods section. There are some other examples in the results that could be similarly shortened and rearranged to give a more concise section.

      Line 283-287: I couldn't find the data for this.

      Line 291: Replace "lied" with "was".

      Line 356: Homing in the zygote would be considered very unusual and is thus worthy of more attention. While possible (HDR has been shown for resistance alleles in the zygote/early embryo), this would be quite distinct from the mechanism of every other reliable gene drive that has been reported. Is the flow cytometry result definitely accurate? By this, I mean: could the result be explained by just outliers in the group heterozygous for EGFP, or perhaps some larvae that hatched a little earlier and grew faster? Perhaps larvae get stuck together here on occasion or some other artifact? Was this result confirmed by sequencing individual larvae?

      Results in general: Why is there no data for crosses with male drive heterozygotes? Even if some targets are X-linked, performance at others is important (or did I miss something and they are all X-linked). I see some description near line 400, but this sort of data is figure-worthy (or at least a table).

      Lines 362-367: What data (figure/table) does this paragraph refer to?

      Lines 405-406: There may be a typo or miscalculation for the DsRed inheritance and homing rate here. Should DsRed inheritance be 90.7%?

      Figure 5: The horizontal axis font size for population 8 is a little smaller than the others.

      Line 454: In addition to drive conversion only occurring in females and the somatic fitness costs, embryo resistance from the vasa promoter would prevent the daughters of drive females from doing drive conversion. This means that drive conversion would mostly just happen with alleles that alternate between males and females.

      Line 481: Deletions between gRNAs certainly happen, but I wouldn't necessarily expect this to be the "expectation". In our 2018 PNAS paper, it happened in 1/3 of cases. There were less I think in our Sciences Advances 2020 and G3 2022 paper. All of these were from embryo resistance from maternal Cas9 (likely also the case with your drive due to the vasa promoter). When looking at "germline" resistance alleles, we have recently noticed more large deletions.

      Figure 6C: It may be nice to show the wild-type and functional resistance sequence side-by-side.

      Lines 642-644: This isn't necessarily the case. At saglin, the nonfunctional resistance alleles may still be able to outcompete the drive allele in the long run. This wasn't tested, but it's likely that the drive allele has at least some small fitness costs.

      A few comments on references to some of my studies:

      Champer, Liu, et al. 2018a and 2018b citations are the same paper.

      For Champer, Kim, et al. 2021 in Molecular Ecology, there was a recent follow-up study in eLife that shows the problem is even worse in a mosquito-specific model (possibly of interest as an alternate or supporting citation): https://elifesciences.org/articles/79121

      One of my other previous studies was not cited, but is quite relevant to the manuscript: https://www.science.org/doi/10.1126/sciadv.aaz0525<br /> This paper demonstrates multiplexed gRNAs and also models them, showing their advantages and disadvantages in terms of drive performance. Additionally, it models and discusses the strategy of targeting vector genes that are essential for disease spread but not the vectors themselves (the "gene disruption drive"), showing that this can be a favorable strategy if gene knockout has the desired effect (nonfunctional resistance alleles contribute to drive success).

      This one is less relevant, but is still a "standard" homing modification rescue type drive that could be mentioned (and owes its success to multiplexing): https://www.pnas.org/doi/abs/10.1073/pnas.2004373117<br /> The recoded recuse method was also used in mosquitoes (albeit without gRNA multiplexing) by others, so this may be a better one to mention: https://www.nature.com/articles/s41467-020-19426-0

      Sincerely,<br /> Jackson Champer

      Referees cross-commenting<br /> Other comments look good. One thing that I forgot to mention: for the 7-gRNA construct with tRNAs, the authors mentioned that it was harder to track, but it sounds like they obtained some data for it that showed similar performance. Even if this one is not featured, perhaps they can still report the data in the supplement?

      Significance

      Overall, this study represents a useful advance. Aside from being the first report for gene drive in A. coluzii, it also is the first that investigates the gene disruption strategy and is the first report of gRNA multiplexing in Anopheles. The study can thus be considered high impact. There are also other aspects of the study that are of high interest to gene drive researchers in particular (several drives were tested with some variations).

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We are grateful to the Referees for their detailed evaluation of our data and insightful remarks. We have now addressed all comments and amended the manuscript accordingly. Below we detail how we have addressed each point.

      Reviewer #1 (Evidence, reproducibility and clarity):

      Summary:

      In this manuscript Lafzi et al. present a novel computational framework (ISCHIA) for the analysis of spatial occurrence patterns, be it of cells or transcript species, found in spatial transcriptomics datasets. The authors also show its applications in finding differentially co-occurring ligand-receptor pairs, as well as inter-species analysis to find conserved cell signalling pathways. ISCHIA consists of a well-documented R package and utilizes empirical probabilistic estimations of non-random co-occurrence, as used in the field of ecology, which to my knowledge is novel in the field. The authors also validate their predictions using an orthogonal technology (in situ hybridization-based spatial transcriptomics), which is a nice addition to the computational work presented in the manuscript.

      Major:

      When determining the composition classes, the authors discard 4 out of 8 clusters of composition classes, partly due to being highly patient-specific. It's unclear how sensitive ISCHIA is for batch effects which might affect the measured cellular fractions. Given that the presence of batch effects is highly likely with ST methods, due to the sample processing procedures, it would help the reader/potential user to estimate the impact these could have on the resulting output. It would also be useful to plot a version of the UMAP with sample labels as to see if the remaining clusters are properly mixed (at least between replicates of the same condition).

      We thank the reviewer for the comment. We have included in Supplemental Figure S1c a UMAP colored by sample (patients), and a barplot in d) that illustrates how CC8 and CC4 are quite specific to patients 2 and 3. These graphs illustrate how the composition classes 1, 3, 5 and 6 are represented in all patients, albeit in different abundances. We would like to point out that the choice to exclude 4 out of 8 composition classes was not dictated by batch effects, but rather by the specific morphology of the samples available to us. Indeed, we excluded composition classes that were mapping to submucosal and muscular areas because only 2 out of 4 colon resections contained these anatomical compartments, and because we wanted to focus on cell type co-occurrences in the epithelial and subepithelial layers.<br /> Additionally, in order to explain the sensitivity of ISCHIA for batch effects or sample-specific variation, we performed principal component (PC) analysis, and measured the standard deviation explained by each PC on the cell type deconvolution matrix (which is used to calculate composition clusters). Next, we tried to find an association of the covariate “batch” with the PCs that explain a high amount of variation in the data. In the deconvoluted matrix, while the first 4 PCs explain more than 80% of the variation in the data, we couldn’t find association of the covariate “batch” to any of the first 4 PCs. We now include this analysis in the Result section:

      Principal component analysis of the deconvolution matrix reveals no association of a particular sample with the first 4 principal components, which cumulatively explain 80% of the variance in the data (Supplemental Figure 2c, d). K-means clustering of the deconvolution matrix revealed 8 CCs of co-localizing cell types present in all samples (Fig 1c, d).

      While other methods assign a cell-type identity to spots based on the most abundant cell type detected by deconvolution algorithm, ISCHIA summarizes spot gene expression data in a presence-absence matrix. ISCHIA is therefore robust to variation in expression levels due to batch effects. This was also recently reported in the analytical tool Starfysh (He et al. 2022), which performs similar clustering of spots based on cell type composition. This is included in the Discussion:

      While preserving the complexity of the cell type composition of the analyzed tissue, composition-based clustering of spots also confers robustness towards variations in expression levels due to batch effects. Indeed, other spatial analysis methods such as Starfysh66 have found that finding inter-sample commonalities using composition-based clusters is easier compared to finding common transcriptome-based clusters between samples. Still, batch analysis and, if needed, correction of the ST data is recommended prior to analysis with ISCHIA.

      Additionally, it would help to illustrate that the biological findings reported in the manuscript are supported across more than 1 biological replicate.

      We agree with the reviewer that the sample size of Visium and Resolve datasets is limited, however greater than 1 (3 and 4 patients, respectively). ISCHIA is meant as a tool for hypothesis generation. Its findings require independent functional validation in model systems and bigger patient cohorts.

      In the LR analysis, the authors state that ISCHIA's predictions are agnostic to gene expression levels, as the authors model expression as a Boolean (gene count threshold > 0). Wouldn't low expression levels result in increased drop-out due to imperfect sensitivity? This would likely inflate false negative predictions at low expression levels.

      We agree with the reviewer that dropouts due to low capture rate of Visium will lead to false negative predictions. Indeed, we chose to set the threshold for gene count > 0 to account for the sparsity of captured transcripts. In single cell RNA sequencing analysis, gene expression is analyzed in cell clusters rather than in single cells. Similarly, ISCHIA calculates LR co-occurrence in composition classes, that is clusters of spots of similar cell composition. Aggregating spots in composition classes thus mitigates the effects of low capture rate and consequent false negative predictions. We now include a sentence explaining this concept in the Results section:

      The count threshold is a user defined parameter that can be increased to restrict the co-occurrence analysis to highly expressed ligands and receptors. To account for the sparsity of ST data, ISCHIA calculates LR co-occurrence within composition classes, that is clusters of spots with similar cell mixtures. Aggregating spots in composition classes thus mitigates the effects of low transcript capture rate and consequent false negative predictions.

      The authors show the enrichment of particular pathways/genesets in differential gene expression comparing interacting vs noninteracting spots (through LR expression) within the same CC. It is however unclear if this enrichment stems from a random sampling of the CC (with possible confounding factors such as batch effect, QC metrics, which might also have a spatial component such as localized tissue degradation) or from the actual interaction. Adding a measure of uncertainty, such as by permuting over interaction-labels to generate a proper null distribution, would help the user to ascertain the robustness of the results. For clarity, it would also be good to add how this is exactly computed to the Methods section.

      We thank the reviewer for this remark and now perform a gene expression noise estimation. As suggested by the reviewer, we employed a permutation-based approach to assess the significance of differentially expressed genes (DEGs) identified by comparing spots that are double positive for expression of a ligand-receptor pair vs spots that are not expressing any of the genes in a specific CC. To do so, we performed 1000 random sampling of spots into two groups, and calculated DEGs between these groups, consequently generating a null distribution of DEGs. We next calculated Monte Carlo p-values for the LR-associated DEGs, comparing the initially computed p-values DEG with the null distribution, and adjusting them for multiple testing using FDR. Significant adjusted p-values were indicative of genes whose differential expression was robust and unlikely to result from random spot sampling.

      From the Method section:<br /> For the calculation of L-R-associated DEGs, ISCHIA computes differential gene expression between spots that are double positive or double negative for a given L-R pair. The significant DEGs are then used for pathway enrichment with any tool of choice, such as EnrichR (https://bio.tools/enrichr). We employed a permutation-based approach to assess the significance of the obtained DEGs. Specifically, we generated a null distribution of DEGs (noise estimation) by 1000-fold random sampling of spots into two groups, and calculating DEGs between these groups. Next FDR-adjusted Monte Carlo p-values were calculated for each LR-associated DEG, comparing the initially computed p-values DEG from with the null distribution, and subsequently adjusting for multiple testing. DEGs with Monte Carlo FDRs < 0.05 are likely specific to the presence of a given LR and unlikely to result from random spot sampling.

      It's unclear if the p-values in the manuscript are adjusted for multiple comparisons or not. Given the number of hypotheses being tested here, this is a crucial issue.

      We agree with the reviewer that this is a crucial issue. In the ecology papers we consulted and in the original co-occur R package (Griffith et al. 2016), multiple testing correction was not applied when computing co-occurrence of species. We believe however, that it is necessary to correct p values when computing co-occurrence of ligands and receptor pairs, and now implement FDR correction in the ISCHIA pipeline. We have amended all the relative figures and tables.

      The authors don't really mention any of the existing state-of-the-art methods (e.g. Squidpy, Spacemake, Giotto, ...). This doesn't necessitate a full benchmark, but at least the authors should then state qualitatively what the difference is between the chosen approach and already available packages, with their respective added advantages/disadvantages.

      We thank the reviewer for the remark and we have compared the analysis performed by ISCHIA with other state-of-the-art tools. The main difference between ISCHIA with respect to other methods such as Spacemake (Sztanka-Toth et al. 2022), Squidpy (Palla et al. 2022) and Giotto (Del Rossi et al. 2022), is that ISCHIA computes cell-type and LR co-occurrence within individual spots, not between neighboring spots. We include here an extensive comparison with other methods for this reviewer, and now discuss the differences between ISCHIA and other tools in the manuscript.

      For neighborhood analysis, Spacemake and Squidpy use spatial coordinates of spots to identify neighbors among them (neighborhood sets are defined as a fixed number of adjacent spots in a square or hexagonal grid). Squipdy computes co-occurrence of clusters in spatial dimensions, however it uses the coordinates of spots and clusters to calculate co-occurrence of entire clusters of spots, not of cell-types within spots. This approach ignores the missing data between spots, as well as the multicellular nature of each spot. Similarly to Squidpy, Giotto assigns a score of a cell type to each spot upon deconvolution, to further identify the spatial patterns of the major cell taxonomies across all the spots on the tissue. For image-based spatial technologies with single cell resolution, Giotto creates a neighborhood graph of the single-cells to study gene expression patterns. This is similar to the approach we used to validate our predictions from Visium data in the Resolve dataset.

      Tangram (Biancalani et al. 2021) is a deep learning approach to harmonize sc/snRNA-seq data with in situ, histological, and anatomical data, toward a high-resolution, integrated atlas. Tangram focuses on learning spatial gene-expression maps transcriptome-wide at single-cell resolution, and relating those to histological and anatomical information from the same specimens. However, it does not address cell-cell and ligand receptor interactions, nor co-occurrences from spatial data. Therefore, Tangram can be used to improve the deconvolution step of ISCHIA, to improve the definition of cellular composition in multicellular spatial spots.

      Starfysh (He et al. 2022) is a computational toolbox for joint modeling of ST and histology data, dissection of refined cell states, and systematic integration of multiple ST datasets from complex tissues. It uses an auxiliary deep generative model that incorporates archetypal analysis and any known cell state markers to avoid the need for a single-cell-resolution reference. Starfysh also clusters spots based on cell type composition, and terms group of spots with similar composition “spatial hubs”. They use spatial hubs to integrate multiple samples, and to uncover regions with varying composition of cell states. As we propose in ISCHIA, the Starfysh authors also suggest that finding inter-sample commonalities using spatial hubs is easier compared to finding common clusters between samples. Starfysh addresses the co-localization of cell states by calculating the spatial correlation index (SCI) within a certain hub and penalizing the calculated correlation with a weight matrix τ in a way that : τ_(between two spots i,j)=1 if the coordinate distance of spot i and spot j was less than √3 else τ_(between two spots i,j)=0 . While this approach provides a measure of cell state co-localization across a spatial hub, it looks at the problem from an inter-spot perspective, similar to Squipdy and Giotto. Again, this is different from ISCHIA that calculates co-occurrence within spots.

      In conclusion, none of the current approaches focuses on addressing the co-occurrence of cell types and molecules within individual Visium spots. As the analysis is fundamentally different, we did not perform a full quantitative benchmark. We agree, however, that these differences need to be addressed in the manuscripts. To illustrate the different results obtained, we ran ISCHIA on a Visium slide of a coronal section of the mouse brain, which was also analyzed using Squidpy (https://squidpy.readthedocs.io/en/stable/notebooks/tutorials/tutorial_visium_hne.html) and Giotto (https://rubd.github.io/Giotto_site/articles/mouse_visium_brain_201226.html#part-9-spatial-network). We clustered the spots based on cell composition and then ran celltype co-occurrence analysis within each composition class (Supplementary Figure 1).

      From the Results section:

      State-of-the-art analysis tools for Visium data often treat every spot as a single datapoint, and compute co-localization, network or cell-cell interactions analysis between neighboring spots (inter-spot analysis). We hypothesized that CNs would be best reconstructed within individual spots (intra-spot analysis), as their mixed transcriptome contains information about locally occurring cell types, expressed ligands and receptors, and activated signaling pathways. As inferring CNs in each individual spot separately would be noisy, sparse, computationally intensive, and would lack statistical power, ISCHIA first divides the tissue into clusters of spots with similar cellular composition - termed composition classes (CCs) (Fig 1a). CCs are thus groups of spots containing similar mixtures of cells, or cellular communities, e.g, all spots capturing colonic crypts. To achieve the division of the tissue into CCs, spot transcriptomes are deconvoluted, yielding a cell type composition matrix (spot × contribution of each cell type), which is then subjected to dimensionality reduction and k-means clustering. ISCHIA allows for both reference-based deconvolution, with tools such as SPOTlight7 or RCTD8, and reference-free deconvolution9. Upon deconvolution, ISCHIA summarizes spot gene expression data in a cell type presence-absence matrix, where each listed cell type is associated with a probability to be present in a given spot (p > 0.1). Each spot is thus represented as a mixture of cell types, and similar mixtures are then clustered together in CCs. We applied ISCHIA on a publicly available Visium slide of a coronal section of the mouse brain (10x Genomics), using as a reference for deconvolution a scRNA-seq dataset of ~14,000 adult mouse cortical cells from the Allen Institute10. Composition-based clustering of the spots yielded 5 CCs, which broadly reflect the annotated anatomical regions (Supplemental Figure 1a). ISCHIA then computes cell type co-occurrence for every CC separately, identifying spatial association of cells in close proximity (Supplemental Figure 1b). Intra-spot analysis reconstructs cellular networks with cell types as nodes, and is distinct from inter-spot networks analysis employed by other tools on this sample, in which spots are used as nodes11,12.

      We also discuss differences between ISCHIA and other tools in the Discussion:

      ISCHIA differs from other analysis tools for Visium data in that it predicts CNs within spots and not across spots. Indeed, spot data from sequencing-based ST methods such as Visium, simultaneously captures information about 1) cell types, 2) expressed LR genes, and 3) associated transcriptional responses at multiple spatially restricted locations. As proximity is a prerequisite for juxtacrine and paracrine cell-cell communication, which in turn constitutes the basis for the coordinated function of CNs, we hypothesized that CNs would best be reconstructed within individual spots, rather than across neighboring spots. To increase robustness, spots are grouped in clusters of similar cellular composition, termed composition classes. Composition-based clustering of the tissue represents a major advantage of this method, and distinguished it from other methods, such as Squidpy11 or Giotto12, that assign an identity to each spot based on marker gene expression or on the most abundant cell type. While preserving the complexity of the cell type composition of the analyzed tissue, composition-based clustering of spots also confers robustness towards variations in expression levels due to batch effects. Indeed, other spatial analysis methods such as Starfysh66 have found that finding inter-sample commonalities using composition-based clusters is easier compared to finding common transcriptome-based clusters between samples. Still, batch analysis and, if needed, correction of the ST data is recommended prior to analysis with ISCHIA. Composition-based clustering of spots allows to restrict downstream analysis to similar mixtures of cells, filtering out transcriptome heterogeneity arising from distinct cellular compositions, which might act as a confounder variable when performing differential gene expression or cell-cell interaction predictions.<br /> To reconstruct CNs, ISCHIA performs co-occurrence analysis of cell types within CCs. Other tools build a neighborhood graph using spatial coordinates of spots and a fixed number of adjacent spots11,12,66, and therefore ignoring the missing data between spots as well as the multicellular nature of each spot, ISCHIA leverages the inherent proximity of mixed transcriptomes within individual spots to infer cellular neighborhoods. Hence, the cell types within the spots, rather than the spots themselves, are the nodes of the CN. This approach allows for reconstruction of much smaller CNs, operating in close spatial proximity, a prerequisite for juxtacrine and paracrine signaling between cells. ISCHIA further predicts LR interaction as edges connecting cell types within spots, not across multiple spots. Finally, by integrating co-occurrence of cell types, co-occurrence of LR pairs, and associated gene signatures, ISCHIA infers CN function.

      Minor:

      When a priori testing for LR interactions without restricting these interactions to predicted interactions, it would be informative to have an estimate of how many of the positively co-occurring interactions coincide with their predictions. As the authors state, it's hard to judge novel interactions without orthogonal validation, but a large overlap between predictions and the results presented here might instill confidence in the novel findings.

      We thank the reviewer for the comment and now label in green, in Fig 4a, the positively co-occurring interactions that are also predicted by Omnipath, NicheNet or CellTalkDB.

      Fig 4D: It's hard to judge very small p-values on this plot, might be better to plot -log10(pval).

      We have now changed this plot to display the differential co-occurrence score, calculated as FDRinflamed - FDRnon-inflamed.

      The axes on some of the plots should be better defined in the figure legends (e.g. Fig 4D, 5C)

      We have included better axis descriptions.

      I'm not an expert in inflammation or IBD biology, so I will defer that to other reviewers more suited to comment on this.

      Reviewer #1 (Significance):

      The proposed method provides a reasonable framework for studying co-occurences of cell types and transcripts (particularly ligand-receptor pairs), which are currently questions of great interest to the community applying novel spatial transcriptomics technologies in many different domains of life sciences. The manuscript is very well written, and provides a clear and consistent logical flow. The manuscript can be easily read and understood both by specialized users as well as biologist/clinical end-users wanting to apply the proposed technique. The addition of experimental data using an orthogonal technology to validate computational predictions illustrates nicely the power of the proposed approach.

      Although the presented approach is methodologically rather simple (which is not necessarily a disadvantage), it is novel in the field as far as I know and a good implementation is likely to see great adoption by the field, especially if it's well documented, maintained and integrated into existing data processing workflows. The authors should however compare their approach fairly with the rest of the available packages in order to convince the reader.

      Although the presented data seems convincing to me, the authors should take greater care of defining good practice statistical reporting of their findings. Even though these tools are often hypothesis-generating and predictions should always be experimentally validated, some end-users might interpret p-values literally. As such, proper multiple-testing correction and analysis of critical confounding factors should be carried out as to set an example.

      I'm a computational biologist with expertise in method development (machine learning and statistical modelling) for spatial multi-omics assays. I'm not an expert in inflammation or IBD biology, so I will defer that to other reviewers more suited to comment on this.

      Reviewer #2 (Evidence, reproducibility and clarity):

      The authors developed ISCHIA to study co-occurence of cell types and transcript species. This work was further extended to study cell-cell interactions based on ligand-receptor co-expression. The observation by ISCHIA was further validated using hybridization based spatial transcriptomics approaches. ISCHIA was applied to study healthy and inflamed human colons.

      Referees cross-commenting

      As the reviewer #1 pointed, there is no description about existing methods. The reviewer #1 only asked stating qualitative differences.

      If the manuscript is mainly for IBD and ISCHIA is the bioinformatics steps they followed, I would agree with the reviewer #1. However, the authors wanted to say that it is a new software. I still think that full benchmarking is needed in this circumstance.

      We thank the reviewer for the remark and we have compared the analysis performed by ISCHIA with other state-of-the-art tools. The main difference between ISCHIA with respect to other methods such as Spacemake (Sztanka-Toth et al. 2022), Squidpy (Palla et al. 2022) and Giotto (Del Rossi et al. 2022), is that ISCHIA computes cell-type and LR co-occurrence within individual spots, not between neighboring spots. We include here an extensive comparison with other methods for this reviewer, and now discuss the differences between ISCHIA and other tools in the manuscript.

      For neighborhood analysis, Spacemake and Squidpy use spatial coordinates of spots to identify neighbors among them (neighborhood sets are defined as a fixed number of adjacent spots in a square or hexagonal grid). Squipdy computes co-occurrence of clusters in spatial dimensions, however it uses the coordinates of spots and clusters to calculate co-occurrence of entire clusters of spots, not of cell-types within spots. This approach ignores the missing data between spots, as well as the multicellular nature of each spot. Similarly to Squidpy, Giotto assigns a score of a cell type to each spot upon deconvolution, to further identify the spatial patterns of the major cell taxonomies across all the spots on the tissue. For image-based spatial technologies with single cell resolution, Giotto creates a neighborhood graph of the single-cells to study gene expression patterns. This is similar to the approach we used to validate our predictions from Visium data in the Resolve dataset.

      Tangram (Biancalani et al. 2021) is a deep learning approach to harmonize sc/snRNA-seq data with in situ, histological, and anatomical data, toward a high-resolution, integrated atlas. Tangram focuses on learning spatial gene-expression maps transcriptome-wide at single-cell resolution, and relating those to histological and anatomical information from the same specimens. However, it does not address cell-cell and ligand receptor interactions, nor co-occurrences from spatial data. Therefore, Tangram can be used to improve the deconvolution step of ISCHIA, to improve the definition of cellular composition in multicellular spatial spots.

      Starfysh (He et al. 2022) is a computational toolbox for joint modeling of ST and histology data, dissection of refined cell states, and systematic integration of multiple ST datasets from complex tissues. It uses an auxiliary deep generative model that incorporates archetypal analysis and any known cell state markers to avoid the need for a single-cell-resolution reference. Starfysh also clusters spots based on cell type composition, and terms group of spots with similar composition “spatial hubs”. They use spatial hubs to integrate multiple samples, and to uncover regions with varying composition of cell states. As we propose in ISCHIA, the Starfysh authors also suggest that finding inter-sample commonalities using spatial hubs is easier compared to finding common clusters between samples. Starfysh addresses the co-localization of cell states by calculating the spatial correlation index (SCI) within a certain hub and penalizing the calculated correlation with a weight matrix τ in a way that : τ_(between two spots i,j)=1 if the coordinate distance of spot i and spot j was less than √3 else τ_(between two spots i,j)=0 . While this approach provides a measure of cell state co-localization across a spatial hub, it looks at the problem from an inter-spot perspective, similar to Squipdy and Giotto. Again, this is different from ISCHIA that calculates co-occurrence within spots.

      In conclusion, none of the current approaches focuses on addressing the co-occurrence of cell types and molecules within individual Visium spots. As the analysis is fundamentally different, we did not perform a full quantitative benchmark. We agree, however, that these differences need to be addressed in the manuscripts. To illustrate the different results obtained, we ran ISCHIA on a Visium slide of a coronal section of the mouse brain, which was also analyzed using Squidpy (https://squidpy.readthedocs.io/en/stable/notebooks/tutorials/tutorial_visium_hne.html) and Giotto (https://rubd.github.io/Giotto_site/articles/mouse_visium_brain_201226.html#part-9-spatial-network). We clustered the spots based on cell composition and then ran celltype co-occurrence analysis within each composition class (Supplementary Figure 1).

      From the Results section:

      State-of-the-art analysis tools for Visium data often treat every spot as a single datapoint, and compute co-localization, network or cell-cell interactions analysis between neighboring spots (inter-spot analysis). We hypothesized that CNs would be best reconstructed within individual spots (intra-spot analysis), as their mixed transcriptome contains information about locally occurring cell types, expressed ligands and receptors, and activated signaling pathways. As inferring CNs in each individual spot separately would be noisy, sparse, computationally intensive, and would lack statistical power, ISCHIA first divides the tissue into clusters of spots with similar cellular composition - termed composition classes (CCs) (Fig 1a). CCs are thus groups of spots containing similar mixtures of cells, or cellular communities, e.g, all spots capturing colonic crypts. To achieve the division of the tissue into CCs, spot transcriptomes are deconvoluted, yielding a cell type composition matrix (spot × contribution of each cell type), which is then subjected to dimensionality reduction and k-means clustering. ISCHIA allows for both reference-based deconvolution, with tools such as SPOTlight7 or RCTD8, and reference-free deconvolution9. Upon deconvolution, ISCHIA summarizes spot gene expression data in a cell type presence-absence matrix, where each listed cell type is associated with a probability to be present in a given spot (p > 0.1). Each spot is thus represented as a mixture of cell types, and similar mixtures are then clustered together in CCs. We applied ISCHIA on a publicly available Visium slide of a coronal section of the mouse brain (10x Genomics), using as a reference for deconvolution a scRNA-seq dataset of ~14,000 adult mouse cortical cells from the Allen Institute10. Composition-based clustering of the spots yielded 5 CCs, which broadly reflect the annotated anatomical regions (Supplemental Fig 1). ISCHIA then computes cell type co-occurrence for every CC separately, identifying spatial association of cells in close proximity (Supplemental Fig xx). Intra-spot analysis reconstructs cellular networks with cell types as nodes, and is distinct from inter-spot networks analysis employed by other tools on this sample, in which spots are used as nodes11,12.

      We also discuss differences between ISCHIA and other tools in the Discussion:

      ISCHIA differs from other analysis tools for Visium data in that it predicts CNs within spots and not across spots. Indeed, spot data from sequencing-based ST methods such as Visium, simultaneously captures information about 1) cell types, 2) expressed LR genes, and 3) associated transcriptional responses at multiple spatially restricted locations. As proximity is a prerequisite for juxtacrine and paracrine cell-cell communication, which in turn constitutes the basis for the coordinated function of CNs, we hypothesized that CNs would best be reconstructed within individual spots, rather than across neighboring spots. To increase robustness, spots are grouped in clusters of similar cellular composition, termed composition classes. Composition-based clustering of the tissue represents a major advantage of this method, and distinguished it from other methods, such as Squidpy11 or Giotto12, that assign an identity to each spot based on marker gene expression or on the most abundant cell type. While preserving the complexity of the cell type composition of the analyzed tissue, composition-based clustering of spots also confers robustness towards variations in expression levels due to batch effects. Indeed, other spatial analysis methods such as Starfysh66 have found that finding inter-sample commonalities using composition-based clusters is easier compared to finding common transcriptome-based clusters between samples. Still, batch analysis and, if needed, correction of the ST data is recommended prior to analysis with ISCHIA. Composition-based clustering of spots allows to restrict downstream analysis to similar mixtures of cells, filtering out transcriptome heterogeneity arising from distinct cellular compositions, which might act as a confounder variable when performing differential gene expression or cell-cell interaction predictions.

      To reconstruct CNs, ISCHIA performs co-occurrence analysis of cell types within CCs. Other tools build a neighborhood graph using spatial coordinates of spots and a fixed number of adjacent spots11,12,66, and therefore ignoring the missing data between spots as well as the multicellular nature of each spot, ISCHIA leverages the inherent proximity of mixed transcriptomes within individual spots to infer cellular neighborhoods. Hence, the cell types within the spots, rather than the spots themselves, are the nodes of the CN. This approach allows for reconstruction of much smaller CNs, operating in close spatial proximity, a prerequisite for juxtacrine and paracrine signaling between cells. ISCHIA further predicts LR interaction as edges connecting cell types within spots, not across multiple spots. Finally, by integrating co-occurrence of cell types, co-occurrence of LR pairs, and associated gene signatures, ISCHIA infers CN function.

      Reviewer #2 (Significance):

      As the authors wanted to introduce ISCHIA as a new tool, discussion and comparison with the previous approaches are essential. The manuscript lacks discussion and the comparison with others. Co-localization has been discussed already in many articles including [PMID:325799]. It does not seem to require additional packages to study co-localization for cell type. There are many cell-cell interaction studies using ligand-receptor co-localization [ref; stLern, SpaGene, and many]. It is not well documented about the relationships with the previous works. Given the advances in algorithms for spatial transcriptomics, it is very uncertain that ISCHIA can provide additional knowledge or contribute to algorithmic development.

      We agree with the reviews that there is an increasing body of work addressing co-localization of cell type and cell-cell interactions in spatial transcriptomic data. However, we assert that the introduction of our method holds substantial relevance and adds value to the field, notwithstanding its ostensible simplicity. Our method has been well-received within the scientific community, indicating its applicability and potential significance in deciphering complex cellular ecosystems. We believe our approach offers a distinct conceptual advantage by enabling the analysis of cellular communities within individual Visium spots, rather than solely between them, allowing for a more refined exploration of cellular interactions and co-localizations within specific spatial domains.

      Previously, Visium data were generated by Elmentaite et al. (Nture 2021) against healty and IBD samples. what are the new findings of the manuscript?

      Visium data generated by Elmentaite et al is from pediatric Crohn's disease, not adult Ulcerative colitis. Spatial analysis of IBD samples has been performed by Nanostring and by CODEX (Garrido-Trigo et al. 2022; Mayer et al. 2023). Publication of our datasets (both Visium and Resolve) will increase the body of patient data available to the community, and should be considered positively.

      Here, we use our dataset to demonstrate the ability of ISCHIA to reconstruct cellular networks within Visium spots, and identify a M-cell-fibroblast network in inflamed regions of UC patients. We further identify differentially co-occurring LRs in the inflammatory CC5 centered around EDN1, SEMA3C, and CXCL5. We further reveal inflammation-induced, protective responses from the colonic crypt involving the complement cascade and the immuno-modulator SECTM1. Finally, we apply co-occurrence analysis to an independent mouse Visium dataset and uncover differentially co-occurring LR pairs shared between the inflamed human and murine colon. ISCHIA is an hypothesis generating tool, and its findings should be extensively characterized and validated in larger cohorts.

      Reviewer #3 (Evidence, reproducibility and clarity):

      Summary

      The authors provide a framework to analyze spatial transcriptomics (ST) data in terms of spatial co-occurrence of cell types, and ligand-receptor pairs. The method was applied to an ulcerative colitis sequencing-based data set (10x Visium) and validated using a matched hybridization-based data set (Molecular Cartography).

      Major Comments

      The Visium data set consisted of a single slide with four samples. The authors should clarify if the current implementation of their method is limited to a single Visium slide.

      We thank the reviewer for the remark and now state in the text that ISCHIA can be applied to any Visium, Resolve or other spatial transcriptomic dataset. Visium samples originating from different slides and datasets can be fed into the ISCHIA pipeline, as it is quite robust to batch effects. Indeed, while other methods assign a cell-type identity to spots based on the most abundant cell type detected by deconvolution algorithm, ISCHIA summarizes spot gene expression data in a presence-absence matrix. ISCHIA is therefore robust to variation in expression levels due to batch effects. This was also recently reported in the analytical tool Starfysh (He et al. 2022), which performs similar clustering of spots based on cell type composition. This is included in the Discussion:

      While preserving the complexity of the cell type composition of the analyzed tissue, composition-based clustering of spots also confers robustness towards variations in expression levels due to batch effects. Indeed, other spatial analysis methods such as Starfysh66 have found that finding inter-sample commonalities using composition-based clusters is easier compared to finding common transcriptome-based clusters between samples. Still, batch analysis and, if needed, correction of the ST data is recommended prior to analysis with ISCHIA.

      In Supplementary Table 1, I think it would be useful to include the minimum number of counts for the Ligand-Receptor genes. Given that the current threshold is 1, I think it warrants a discussion if the minimum number of counts has an effect on whether the ligand-receptor pair is significantly co-occurring (i.e. if ligand-receptor pairs with more counts are more likely to be significant).

      We agree with the reviewer that increasing the threshold to >1 will reduce the number of significantly co-occurring LRs, but also increase false negative predictions. We chose to set the threshold for gene count > 0 to account for the sparsity of captured transcripts. Indeed, dropouts due to low capture rate of Visium will lead to false negative predictions. In single cell RNA sequencing analysis, gene expression is analyzed in cell clusters rather than in single cells. Similarly, ISCHIA calculates LR co-occurrence in composition classes, that is clusters of spots of similar cell composition. Aggregating spots in composition classes thus mitigates the effects of low capture rate and consequent false negative predictions. We now include a sentence explaining this concept in the Results section:

      The count threshold is a user defined parameter that can be increased to restrict the co-occurrence analysis to highly expressed ligands and receptors. To account for the sparsity of ST data, ISCHIA calculates LR co-occurrence within composition classes, that is clusters of spots with similar cell mixtures. Aggregating spots in composition classes thus mitigates the effects of low transcript capture rate and consequent false negative predictions.

      Given the effect of outliers in the Pearson correlation and the nature of the expression values for VIsium data, I think that the Spearman rank correlation is better suited to estimate the correlation between the expression values of the ligand-receptor pairs than the Pearson correlation (the default in R).

      We thank the reviewer for the comment and now rank positively co-occurring LR based on Spearman correlation. See Fig 3a and Supplementary Table 1.

      In the section titled "Differential co-occurrence identifies niche-specific response programs", it is unclear whether the spatial co-occurrence analysis was done within each CC.

      We now specify that we computed co-occurrence analysis of ligands and receptor genes in all spots of our dataset across all CCs. We now include FDR corrected p-values in this analysis. Only after computing this broad co-occurrence analysis, we focus on differential co-occurrence comparing conditions or composition classes.

      Minor Comments

      I found a few typos in the manuscript

      In the Abstract, "tecniquee" instead of "techniques"

      On page 10, under "Integration and annotation of scRNASeq data.", "W" instead of "We"

      On page 11, there is an equation rendering error: P(lt) = $p_lt

      We thank the reviewer for these comments and have now corrected the typos.

      Reviewer #3 (Significance):

      The method proposed takes advantage of work done in ecology to leverage the spatial context of ST data. Furthermore, the methods proposed goes beyond describing spatial patterns present in the data, but allows for the comparison between two conditions of interest. The method proposed will be of interest to the growing number of researchers generating ST data.

      My expertise is in statistical methods for single cell and spatial transcriptomics data. Furthermore, I have extensive experience analyzing single cell and spatial transcriptomics data in the context of liver diseases.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary

      The authors provide a framework to analyze spatial transcriptomics (ST) data in terms of spatial co-occurrence of cell types, and ligand-receptor pairs. The method was applied to an ulcerative colitis sequencing-based data set (10x Visium) and validated using a matched hybridization-based data set (Molecular Cartography).

      Major Comments

      The Visium data set consisted of a single slide with four samples. The authors should clarify if the current implementation of their method is limited to a single Visium slide.

      In Supplementary Table 1, I think it would be useful to include the minimum number of counts for the Ligand-Receptor genes. Given that the current threshold is 1, I think it warrants a discussion if the minimum number of counts has an effect on whether the ligand-receptor pair is significantly co-occurring (i.e. if ligand-receptor pairs with more counts are more likely to be significant).

      Given the effect of outliers in the Pearson correlation and the nature of the expression values for VIsium data, I think that the Spearman rank correlation is better suited to estimate the correlation between the expression values of the ligand-receptor pairs than the Pearson correlation (the default in R).

      In the section titled "Differential co-occurrence identifies niche-specific response programs", it is unclear whether the spatial co-occurrence analysis was done within each CC.

      Minor Comments

      I found a few typos in the manuscript

      In the Abstract, "tecniquee" instead of "techniques"

      On page 10, under "Integration and annotation of scRNASeq data.", "W" instead of "We"

      On page 11, there is an equation rendering error: P(lt) = $p_lt

      Significance

      The method proposed takes advantage of work done in ecology to leverage the spatial context of ST data. Furthermore, the methods proposed goes beyond describing spatial patterns present in the data, but allows for the comparison between two conditions of interest. The method proposed will be of interest to the growing number of researchers generating ST data.

      My expertise is in statistical methods for single cell and spatial transcriptomics data. Furthermore, I have extensive experience analyzing single cell and spatial transcriptomics data in the context of liver diseases.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      The authors developed ISCHIA to study co-occurence of cell types and transcript species. This work was further extended to study cell-cell interactions based on ligand-receptor co-expression. The observation by ISCHIA was further validated using hybridization based spatial transcriptomics approaches. ISCHIA was applied to study healthy and inflamed human colons.

      Referees cross-commenting<br /> As the reviewer #1 pointed, there is no description about existing methods. The reviewer #1 only asked stating qualitative differences.

      If the manuscript is mainly for IBD and ISCHIA is the bioinformatics steps they followed, I would agree with the reviewer #1. However, the authors wanted to say that it is a new software. I still think that full benchmarking is needed in this circumstance.

      Significance

      As the authors wanted to introduce ISCHIA as a new tool, discussion and comparison with the previous approaches are essential. The manuscript lacks discussion and the comparison with others. Co-localization has been discussed already in many articles including [PMID:325799]. It does not seem to require additional packages to study co-localization for cell type. There are many cell-cell interaction studies using ligand-receptor co-localization [ref; stLern, SpaGene, and many]. It is not well documented about the relationships with the previous works. Given the advances in algorithms for spatial transcriptomics, it is very uncertain that ISCHIA can provide additional knowledge or contribute to algorithmic development.

      Previously, Visium data were generated by Elmentaite et al. (Nture 2021) against healty and IBD samples. what are the new findings of the manuscript?

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary:

      In this manuscript Lafzi et al. present a novel computational framework (ISCHIA) for the analysis of spatial occurrence patterns, be it of cells or transcript species, found in spatial transcriptomics datasets. The authors also show its applications in finding differentially co-occurring ligand-receptor pairs, as well as inter-species analysis to find conserved cell signalling pathways. ISCHIA consists of a well-documented R package and utilizes empirical probabilistic estimations of non-random co-occurrence, as used in the field of ecology, which to my knowledge is novel in the field. The authors also validate their predictions using an orthogonal technology (in situ hybridization-based spatial transcriptomics), which is a nice addition to the computational work presented in the manuscript.

      Major:

      • When determining the composition classes, the authors discard 4 out of 8 clusters of composition classes, partly due to being highly patient-specific. It's unclear how sensitive ISCHIA is for batch effects which might affect the measured cellular fractions. Given that the presence of batch effects is highly likely with ST methods, due to the sample processing procedures, it would help the reader/potential user to estimate the impact these could have on the resulting output. It would also be useful to plot a version of the UMAP with sample labels as to see if the remaining clusters are properly mixed (at least between replicates of the same condition). Additionally, it would help to illustrate that the biological findings reported in the manuscript are supported across more than 1 biological replicate.
      • In the LR analysis, the authors state that ISCHIA's predictions are agnostic to gene expression levels, as the authors model expression as a Boolean (gene count threshold > 0). Wouldn't low expression levels result in increased drop-out due to imperfect sensitivity? This would likely inflate false negative predictions at low expression levels.
      • The authors show the enrichment of particular pathways/genesets in differential gene expression comparing interacting vs noninteracting spots (through LR expression) within the same CC. It is however unclear if this enrichment stems from a random sampling of the CC (with possible confounding factors such as batch effect, QC metrics, which might also have a spatial component such as localized tissue degradation) or from the actual interaction. Adding a measure of uncertainty, such as by permuting over interaction-labels to generate a proper null distribution, would help the user to ascertain the robustness of the results. For clarity, it would also be good to add how this is exactly computed to the Methods section.
      • It's unclear if the p-values in the manuscript are adjusted for multiple comparisons or not. Given the number of hypotheses being tested here, this is a crucial issue.
      • The authors don't really mention any of the existing state-of-the-art methods (e.g. Squidpy, Spacemake, Giotto, ...). This doesn't necessitate a full benchmark, but at least the authors should then state qualitatively what the difference is between the chosen approach and already available packages, with their respective added advantages/disadvantages.

      Minor:

      • When a priori testing for LR interactions without restricting these interactions to predicted interactions, it would be informative to have an estimate of how many of the positively co-occurring interactions coincide with their predictions. As the authors state, it's hard to judge novel interactions without orthogonal validation, but a large overlap between predictions and the results presented here might instill confidence in the novel findings.
      • Fig 4D: It's hard to judge very small p-values on this plot, might be better to plot -log10(pval).
      • The axes on some of the plots should be better defined in the figure legends (e.g. Fig 4D, 5C)

      I'm not an expert in inflammation or IBD biology, so I will defer that to other reviewers more suited to comment on this.

      Significance

      The proposed method provides a reasonable framework for studying co-occurences of cell types and transcripts (particularly ligand-receptor pairs), which are currently questions of great interest to the community applying novel spatial transcriptomics technologies in many different domains of life sciences. The manuscript is very well written, and provides a clear and consistent logical flow. The manuscript can be easily read and understood both by specialized users as well as biologist/clinical end-users wanting to apply the proposed technique. The addition of experimental data using an orthogonal technology to validate computational predictions illustrates nicely the power of the proposed approach.

      Although the presented approach is methodologically rather simple (which is not necessarily a disadvantage), it is novel in the field as far as I know and a good implementation is likely to see great adoption by the field, especially if it's well documented, maintained and integrated into existing data processing workflows. The authors should however compare their approach fairly with the rest of the available packages in order to convince the reader.

      Although the presented data seems convincing to me, the authors should take greater care of defining good practice statistical reporting of their findings. Even though these tools are often hypothesis-generating and predictions should always be experimentally validated, some end-users might interpret p-values literally. As such, proper multiple-testing correction and analysis of critical confounding factors should be carried out as to set an example.

      I'm a computational biologist with expertise in method development (machine learning and statistical modelling) for spatial multi-omics assays. I'm not an expert in inflammation or IBD biology, so I will defer that to other reviewers more suited to comment on this.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity):

      Major comments:

      • 1/ The model system used in this work is referred to as "organoids", with the premise that organoids, as representatives of the original tissue, can be used to study tissue development. However, the organoids presented in the study are spherical structures, and the paper does not provide any information about how and to what extent these organoids represent the original tissue. Furthermore, it would be difficult to expect these organoids to accurately represent human breast tissue, as they are derived, to the best of the reviewer's understanding (it is not explicitly noted, but rather the text refers the reader to several previous works), from primary human breast epithelial cells that had been cultured for 6 passages in 2D culture. The CD24/CD44 flow cytometry profile of these 2D cultures, as well as the organoids derived from them, shows a unimodal distribution of CD24 and CD44 expression, and does not show distinct cell populations, as typical in primary breast epithelial cells that have not been cultured in 2D
      • Response 1:

        We understand the concern raised by the reviewer. Before initiating the study we have carefully characterized our model (See Revision Section part 2.2, for the revisions that have already been carried out).

        In parallel, to further address this point, we plan to perform an extensive characterization of our mammary primary cells as well as our 3D-matrigel embedded culture. This will be achieved through flow cytometry using other multiple lineage-specific surface markers for luminal progenitor cells (such as CD49f−/low/EpCAM+), and basal/myoepithelial cells (such as CD49f+/EpCAM−/low).

        Thus, overall our experiments will confirm that our growth conditions (which we intend to describe in greater details in the methods section) for multipotent mammary stem cells can generate multi-lineage organoids.

      2/ There appears to be confusion between concepts: primarily confusing a basal phenotype with a stem cell phenotype, and progenitor activity with stem cell activity. Because the 3D organoid model does not display a replication of luminal differentiation, it cannot be used as a proxy for stem cell function. The results from the miRNA screen and the subsequent experiments support two conclusions: 1. miR-160b-3p leads to an enhanced mesenchymal phenotype, manifested by reduced CD24 and enhanced CD44 expression. 2. miR-160b-3p leads to increased organoid formation. The latter may be interpreted, at best, as higher basal progenitor activity, but is not a measure of stem cell activity, as that would require the cells to give rise to more than one lineage, which is not shown here.

      • Response 2:

      We agree with the reviewer on the confusions between several concepts that we did not discriminate enough. The planned characterization of our cultures will allow us to better define the nature of our primary cell population and avoid any confusion (See Response 1). Indeed, an organoid is a self-organized 3D tissue that typically originates from stem cells (pluripotent, fetal or adult). Therefore, we will replace the term “stem cell activity” through the article by “stem/progenitor activity”.

      3/ Overall, the information from figures 1-4 indicate that miR-160b-3p is driving and is associated with mesenchymal differentiation, possibly with EMT.

      Response 3:

      We agree with the reviewer that our data suggest that miR-160b-3p is driving and is associated with mesenchymal differentiation. As suggested by reviewer, to further evaluate the possible involvement of EMT, we will analysed using RT-qPCR, as we described in Fessart et al, (May 30, 2016 https://doi.org/10.7554/eLife.13887), the expression of the main EMT genes in miR-106a-3p cells. These results will be also confirmed at the protein level.

      4/ In contrast to the work in the breast 3D culture model, the experiments with hESCs are interesting and do support a role of this miR in stemness.

      Response 4:

      We would like to extend our gratitude to the reviewer for their valuable comments on this aspect of our work.

      There are several relatively minor comments that cumulatively somewhat undermine the strength of the work:

      5/ Abstract: the sentence "organoids can be directly generated from human epithelial cells by only one miRNA, miR-106a-sp" needs better clarification.

      • We agree with the reviewer, this sentence will be modified accordingly.

      6/ Page 5 line 103: HMECs is a term that generally refers to human mammary epithelial cells, not a specific derivation or subpopulation thereof.

      • We will replace HMEC by human primary mammary epithelial cells.

      7/ The graph in Fig. 1A is unnecessary, it shows only one bar.

      • We will remove this panel in the revised version of the manuscript.

      8/ It is unclear if all the HMECs were derived from the same donor, or several donors. There is no information about the donor and how the tissue and cells were derived. In general, it is not entirely clear how the cells were collected, processed, stored, and cultured from the time they were obtained from the donor until their use in the current study.

      • We will include in the material section the details information on our primary cells and our culture conditions

      9/ The key for Fig. 2D is unclear. The axes read "density" but the text refers to "intensity". Fluorescence intensity in flow cytometry is usually measured on a log scale. Differences on a linear scale are not usually considered meaningful. The authors should clarify why they chose a linear scale for this screen.

      • The screening was conducted using a high throughput microscope that measures the relative signal intensity, thus the scale is based on linear signal intensity.

      10/ In the miRNA screen, how long were the cells cultured after transfection, and was it enough time for them to shift phenotype?

      • The timeline of the screening process is detailed in the Material section. The cells were cultured for 6 days following transfection for the CD44/CD24 staining and 8 days following transfection for the 3D culture, which provides sufficient time for shifting the phenotype.

      11/ Page 6 line 154: The authors likely mean z-score, not z factor (two different things).

      • We thank the reviewer for pointing this, this will be corrected.

      12/ Page 7 line 161: "mir-106a-3p directly promotes the "transdifferentiation" of CD44low/CD24high cells phenotype into CD44high/CD24low cell phenotype" - is an unsupported statement, given that there could be several alternative explanations for the observed change in population ratios, including effects on survival or growth of cells of a certain population.

      • Transdifferentiation (also known as lineage reprogramming, or -conversion), is a process in which one mature, specialized cell type changes into another without entering a pluripotent state. This process involves the ectopic expression of transcription factors and/or other stimuli. We agree with the reviewer's observation that we did not fully demonstrate the transdifferentiation process in terms of lineage. Therefore, we will use flow cytometry to analyse multiple lineage-specific surface markers for luminal progenitor cells (such as CD49f−/low/EpCAM+), and basal/myoepithelial cells (such as CD49f+/EpCAM−/low) following miR-106a-3p expression.
      • Additionally, we acknowledge that there may be other alternative explanations; so we have already assessed the impact of mir-106a-3p on the population doubling time in culture to determine whether it affects the cells' survival or growth of the cells (See Section Part 2.2 for a description of experiments already carried out).

      13/ There is need for quantification of the phenotypes described in Fig. 3C

      • We thank the reviewer for this valuable suggestion and we will indeed characterize the 3D structure using flow cytometry.

      14/ Figures 3 D-F it is not clear if the graphs display percentage or mean number (there is discrepancy between figure text and figure legend text), and when percentage, not clear for figure 3F out of what.

      • We appreciate the reviewer's suggestion, and we have replaced the term 'axis' with 'Organoid Formation Capacity (OFC),' which is the commonly used nomenclature for this measure. OFC corresponds to the percentage of organoids per cell seeded, as explained in the legend.

      15/ Fig. 5B, what is the statistical significance of the enrichment?

      • In Figure 5B, the statistical significance of the enrichment is an FDR value of 0.024 and it is based on the multiple rotation gene-set testing (mroast) from the Limma R package (https://doi.org/10.1093/bioinformatics/btq401). This information will be included in the figure legend.

      Reviewer #2 (Evidence, reproducibility and clarity):

      In this work, Robert et al. utilize mammary organoid culture as an in vitro model of stem cell renewal and maintenance. Authors show that a putative mammary stem cell population, characterized as CD44high CD24low, is enriched in organoid culture relative to 2D monolayer culture. They conduct a microRNA (miR) screen and identify miR-106a-3p as a miRNA that enriches for stem cell (CD44high CD24low) and organoid formation capacity, confirming these findings using miR-106a-3p overexpressing cells. Authors also show that CBX7 overexpression achieves a similar enrichment in CD44high CD24low and organoid formation capacity in an miR-106a-3p dependent manner, though the rationale behind the connection between CBX7 and miR-106a-3p is not well defined. Finally, the manuscript conducts a transcriptomic analysis on miR-106a-3p-OE cells and aims to functionally validate its role in embryonic stem cells (ESCs) as a model that is versatile for renewal and differentiation studies. How this relates to mammary adult stem cells (ASCs) is not entirely clear. Overall, the manuscript contains significant technical and conceptual limitations, and the data presented do not support the major conclusions of the study. There are two overarching issues that question the validity of most of the findings in this study. Firstly, there is no clear demonstration that the structures reported as 3D organoids are indeed driven by multipotent stem cells (in all data and experimental approaches associated with this). Secondly, there is a lack of evidence to support the claim that CD44high CD24low cells are stem cells with an exclusive or enhanced capacity to generate multi-lineage organoids.

      In addition to these general points, there are several specific major issues summarized below:

      1/ Authors base their findings about mammary ASC renewal using a poorly defined organoid culture system that they claim is driven by ASC renewal and differentiation. These organoid growth conditions were originally developed to support growth of bronchial epithelial cells, and the authors have not presented data to objectively assess the validity of this extrapolation to expansion of mammary organoids. The authors did not present data to support the notion that these growth conditions generate multi-lineage organoids that expand from multipotent mammary stem cells.

      • Response 1:
      • This concern has been also raised by the 1st reviewer (See Response 12 from Reviewer 1).
      • Our experiments will confirm that our growth conditions (which will be more comprehensively described in the methods section) can generate multi-lineage organoids from multipotent mammary stem cells. We will include these characterizations in the new version of the manuscript.

      2/ Authors claim that miR-106a-3p downregulates stem cell differentiation and utilize 'organoid' culture to track the temporal expression of OCT4, SOX2 and NANOG during phases of organoid renewal and differentiation. However, mammary stem cell differentiation is associated with the emergence of luminal progenitor, mature luminal and myoepithelial lineages that are characterized by the expression of a well-defined set of markers. The authors did not investigate the expression of these markers in their 'differentiation' settings. Furthermore, modulators of major pathways reported to be critical for mammary ASC maintenance are lacking, including modulators of WNT, TGF/BMP, Notch and other pathways. As such, it is difficult to ascertain that organoids emerging under such culture conditions are the result of stem cell renewal and differentiation, as opposed to lineage-restricted proliferative non-ASCs, thus questioning the validity of many of the findings in this work.

      • Response 2:
      • As suggested by the reviewer, we will investigate the expression of emergence of luminal progenitor, mature luminal and myoepithelial lineages in our 'differentiation' settings using flow cytometry. This analysis will involve the examination of multiple lineage-specific surface markers, including CD49f−/low/EpCAM+ for luminal progenitor cells and CD49f+/EpCAM−/low for basal/myoepithelial cells in the 3D context.

      • Secondly, we agree with the reviewer that major pathways such as Wnt, TGFb/BMP and Notch have been reported to be critical for mammary ASC maintenance. As suggested by the reviewer, to further evaluate the possible involvement of these pathways, we have analyzed our transcriptomic data, using PROGENy pathway, to investigate which pathways are regulated. The major pathways are depicted in a new figure and will be included in the manuscript (See Revision Section part 2.2, for the revisions that have already been carried out).

      • There was significant enrichment indicating down-regulation of TGFβ, MAPK, WNT, PI3K genes along with gene sets representing other oncogenic pathways, are up-regulated such as the hypoxia response, JAK/STAT pathway, and p53 pathway activity (Figure A and B). Stem cells possess self-renewal activities and multipotency, characteristics that tend to be maintained under hypoxic microenvironments [1], thus this is not surprising to observe an up-regulation of Hypoxia pathway and activation of HIF1α transcription factor. In mammary stem cells, it has also been shown that p53 is critical to control the maintenance of a constant number of stem cells pool [2, 3]. Remarkably, it has been shown that cell sorting of the cells with a putative cancer stem cell phenotype (CD44+/CD24 low) express a constitutive activation of Jak-STAT pathway [4], which we observed as up-regulated along with STAT1 and STAT2 transcription factors. In parallel, we observe a down-regulation of Wnt signaling as well as PI3K pathways. Wnt is known to play important role in the maintenance of stem cells; its inhibition has been shown to lead to the inactivation of PI3 kinase signaling pathways to ensures a balance control of stem cell renewal [5]. Moreover, we observe a down-regulation of SMAD4 and SMAD3 transcription factors correlated with a down-regulation of TGFβ pathway. Signals mediated by TGF-β family members have been implicated in the maintenance and differentiation of various types of somatic stem cells [6].
      • References

      • Semenza GL. Dynamic regulation of stem cell specification and maintenance by hypoxia-inducible factors. Molecular aspects of medicine2016 Feb-Mar;47-48:15-23.

      • Solozobova V, Blattner C. p53 in stem cells. World journal of biological chemistry2011 Sep 26;2(9):202-14.
      • Cicalese A, Bonizzi G, Pasi CE, Faretta M, Ronzoni S, Giulini B et al. The tumor suppressor p53 regulates polarity of self-renewing divisions in mammary stem cells. Cell2009 Sep 18;138(6):1083-95.
      • Hernandez-Vargas H, Ouzounova M, Le Calvez-Kelm F, Lambert MP, McKay-Chopin S, Tavtigian SV et al. Methylome analysis reveals Jak-STAT pathway deregulation in putative breast cancer stem cells. Epigenetics2011 Apr;6(4):428-39.
      • He XC, Zhang J, Tong WG, Tawfik O, Ross J, Scoville DH et al. BMP signaling inhibits intestinal stem cell self-renewal through suppression of Wnt-beta-catenin signaling. Nature genetics2004 Oct;36(10):1117-21.
      • Watabe T, Miyazono K. Roles of TGF-beta family signaling in stem cell renewal and differentiation. Cell research2009 Jan;19(1):103-15.

      3/ The authors base their work on the claim that CD44high CD24low cells represent bona fide mammary ASCs. This claim is not support by functional work to show that organoid generation is exclusive to or enhanced in CD44high CD24low cells relative to other cells. The claim of differentiation of this stem cell population in vitro is not supported by data to show emergence of luminal progenitor, mature luminal and myoepithelial lineages that are characterized by the expression of a well-defined set of reported markers as abovementioned. Although miR-106a-3p is claimed to downregulate stem cell differentiation based on a gene set enrichment analysis, authors did not investigate the expression of mammary differentiation markers or the association of miR-106a-3p-transfected HMECs with gene set pathways involved in mammary gland differentiation.

      • Response 3:
      • This concern has been also raised by the 1st reviewer (See Response 1 from Reviewer 1). As explained in response 1, to address this point, we will perform an extensive characterization of our mammary primary cells as well as our 3D-matrigel embedded cultures using flow cytometry This analysis will involve multiple lineage-specific surface markers, including luminal alveolar progenitor (such as CD49f−/low/EpCAM+) and basal/myoepithelial cells (such as CD49f+/EpCAM−/low).
      • Secondly, as suggested by the reviewer, we will investigate the expression of mammary differentiation markers or the association of miR-106a-3p-transfected human mammary epithelial cells with gene set pathways involved in mammary gland differentiation by bioinformatics using our transcriptomic data.

      4/ Line 129: "Together, these results indicate that cells grown as organoids acquired a CD44high / CD24low expression pattern similar to that of stem/progenitor cells, which suggests that 3D organoids can be used to enrich breast stem cell markers for further screening". This conclusion is not supported by the data presented. It is not clear if the expression of these markers was acquired upon 3D culture. It could be that 3D culture better maintained and expanded already existing CD44high CD24low cells in 2D culture. It is also unclear if these cells are indeed organoid-forming. Authors have not isolated and tested the organoid-forming capacity of CD44high CD24low cells relative to other cells. Along the same line, the conclusion that " mir-106a-3p directly promotes the "transdifferentiation" of CD44low/CD24high cell phenotype into CD44high/CD24low cell phenotype" isn't justified. Experiments required to conclude that 'transdifferentiation' is involved are lacking. miR-106a-3p overexpression could be creating conditions that are permissive for expansion of already existing CD44high CD24low cells as opposed to 'transdifferentiation' of other cell types into this phenotype. The authors could FACS-isolate CD44low CD24low cells and treat these with control or miR-106a-3p to conclusively establish 'transdifferentiation'.

      • Response 4:
      • This concern has been also raised by the 1st reviewer (See Response 12 from Reviewer 1). Transdifferentiation (lineage reprogramming, or -conversion), is a process in which one mature, specialized cell type changes into another without entering a pluripotent state. This process involves the ectopic expression of transcription factors and/or other stimuli. We agree with the reviewer that we did not demonstrate the transdifferentiation process in terms of lineage. Therefore, we will use flow cytometry to analyze multiple lineage-specific surface markers for luminal progenitor (CD49f−/low/EpCAM+), and basal/myoepithelial cells (CD49f+/EpCAM−/low) following miR-106a-3p expression.
      • Additionally, we cannot exclude the possibility that the 3D culture better maintained and expanded the pre-existing CD44high CD24low cells, as suggested by the reviewer. The reviewer recommends FACS-isolating CD44low CD24low cells. We apologise for any lack of clarity in our description. Technically, our primary cells have a low percentage of colony-forming efficiency (CFE) in 3D and not enough cells for FACS isolation of CD44low and CD24low cells. Therefore, we leveraged our knowledge that the expression of CBX7 potentiates the growth of 3D structures. We decided to FACS-isolate the different subpopulations of CD44 and CD24 cells to further elucidate the expression of miR-106a-3p in the different CD44/CD24 cell subpopulations. CBX7-transfected human mammary epithelial cells showed enrichment in CD44high/CD24low cells as compared to empty vector-transfected human mammary epithelial cells (Figure 4A-B). Subsequently, we separated the CD44high/CD24low (green) population from the CD44high/CD24high cell populations (blue) using flow cytometry to analyze the role of the endogenous expression of miR-106a-3p. The CD44high/CD24low population was the only one to exhibit endogenous expression of miR-106a-3p (Figure 4C). Blocking the endogenous expression of miR-106a-3p with LNA-anti-miR-106a-3p or LNA-control (Figure 4D) impacted organoid generation (Figure 4E-F). We will modify the text accordingly to include this point and this figure will be moved in the supplemental figure.

      5/ Line 242: "These data demonstrate that miR-106a-3p is involved in the early cell differentiation process into the three germ layers ". The authors have not conducted functional or mechanistic work to show that miR-106a-3p is involved in morphological or transcriptomic differentiation changes in ESCs. This and other data would be necessary to substantiate this conclusion.

      • Response 5:
      • Indeed, we agree that we cannot conclude that the miR-106a-3p is involved in the early cell differentiation process into the three germ layers without demonstrating the differentiation changes in ESCs through transcriptomic analysis. To clarify the take-home message, we did not include the transcriptomic characterization of the differentiation changes in ESCs. Instead, we focused on assessing the impact on Oct4, Sox2, and Nanog expression. However, to further understand the impact of miR-106a-3p depletion on hESCs differentiation, we have also monitored the expression of specific genes upon induction of the three embryonic germ layers (See Section Part 2.2 for a description of the experiments already carried out).

      Selected technical points:

      6) Figure 1A: The Y-axis label is misleading and suggests multiple organoids seeded per cell? Organoid Formation Efficiency (OFE) or Organoid Formation Capacity (OFC) are the commonly used nomenclature for this.

      • Response 6:
      • Since reviewer 1 found that the graph in Fig. 1A to be unnecessary, we have decided to remove this panel in the revised version of the manuscript. Furthermore, as suggested, we will replace the axis “Number of organoids per cell seeded” with “Organoid Formation Capacity” (OFC), which is the commonly used nomenclature for this measure in the article.

      7) Figure 2G: X-axis unclear. Is this meant to investigate the percentage of cells expressing CD44/CD24 as double high, double low, high/low and low/high?

      • Response 7:
      • We thank the reviewer for this careful examination of the manuscript. We apologize for this error, and will make the corresponding adjustment in Figure 2G.

      8) Figure 4C: In HMEC-CBX7 cells, it is unclear whether the high miR-106a-3p levels in CD44high CD24low cells are due to CBX7 expression. An important control, HMEC-Control Vector, is missing.

      • Response 8:
      • This control has been done (see Section 3, for details on experiments that have been carried out).

      Reviewer #3 (Evidence, reproducibility and clarity):

      In this study the authors identify miR-106a-3p as a potent inducer of organoid formation from HMECs. Overexpression of miR-106a-3p induced formation of more organoids, increased the number of stem/progenitor cells and overall positively affected the stemness properties of the organoids, likely by affecting SOx2, Oct4 and Nanog expression.

      Major comments:

      1/ the flow of the paper is confusing, it appears that the authors are trying to combine several non-completed studies into one paper. It is not immediately evident how is the rationale or the conclusion supported by published data. For example, is there published evidence that Sox2/Oct4/Nanog are expressed in healthy mammary gland stem cells in vivo, or whether they have a role in establishment of stem cell population?

      • Response 1:
      • There is still a controversy about the existence of unipotent, bipotent or multipotent stem cells in mammary gland tissue [7-9]. Notably, OCT4, SOX2, and NANOG collectively form the core transcriptional network responsible for maintaining pluripotency in embryonic stem cells [10]. Evidence has accumulated over the past few years, accumulating evidence has supported the presence of stem cells in both mouse and human mammary [11]. Various strategies have been used to identify and isolate human breast stem/progenitor cells, including FACS sorting based on cell surface antigen expression. In addition, an in vitro cell culture system has been described allowing the propagation of human mammary epithelial cells in an undifferentiated state through their ability to proliferate in suspension as non-adherent mammospheres [12].. Simoe et al have demonstrated that stem cells isolated from both normal human breast and breast tumor cells display an increased expression of the embryonic stem cell genes NANOG, OCT4 and SOX2 [13]. Moreover, they have shown that the ectopic expression of any one of these factors, but in particular NANOG and SOX2, in breast cancer cells increases the pool of stem cells and enhances the cells' ability to form mammospheres. They observed higher expression of NANOG, OCT4, and SOX2 in the stem cell populations CD44+CD24−/low and EMA+CALLA+ compared to the rest of the sample population. Cells overexpressing these factors displayed an increase in the stem cell populations, thereby confirming the role of Nanog, Oct4, and Sox2 in the maintenance of human mammary stem cells. We will include this rationale in the manuscript.
      • References

      • Van Keymeulen A, Rocha AS, Ousset M, Beck B, Bouvencourt G, Rock J et al. Distinct stem cells contribute to mammary gland development and maintenance. Nature2011 Oct 9;479(7372):189-93.

      • Deome KB, Faulkin LJ, Jr., Bern HA, Blair PB. Development of mammary tumors from hyperplastic alveolar nodules transplanted into gland-free mammary fat pads of female C3H mice. Cancer research1959 Jun;19(5):515-20.
      • Shackleton M, Vaillant F, Simpson KJ, Stingl J, Smyth GK, Asselin-Labat ML et al. Generation of a functional mammary gland from a single stem cell. Nature2006 Jan 5;439(7072):84-8.
      • Boyer LA, Lee TI, Cole MF, Johnstone SE, Levine SS, Zucker JP et al. Core transcriptional regulatory circuitry in human embryonic stem cells. Cell2005 Sep 23;122(6):947-56.
      • LaMarca HL, Rosen JM. Minireview: hormones and mammary cell fate--what will I become when I grow up? Endocrinology2008 Sep;149(9):4317-21.
      • Dontu G, Abdallah WM, Foley JM, Jackson KW, Clarke MF, Kawamura MJ et al. In vitro propagation and transcriptional profiling of human mammary stem/progenitor cells. Genes & development2003 May 15;17(10):1253-70.
      • Simoes BM, Piva M, Iriondo O, Comaills V, Lopez-Ruiz JA, Zabalza I et al. Effects of estrogen on the proportion of stem cells in the breast. Breast cancer research and treatment2011 Aug;129(1):23-35.

      2/ The organoids are all spherical, while mammary gland is characterized by branching. Therefore, the organoids are not recapitulating the gland morphology and the validation should include wider range of molecular markers.

      • Response 2:
      • This concern has been also raised by both reviewers 1 and 2. As explained in response 1 to reviewer 1, we will perform a comprehensive characterization of our mammary primary cells as well as our 3D-matrigel embedded culture culture using flow cytometry to examine multiple lineage-specific surface markers, including luminal alveolar progenitor (such as CD49f−/low/EpCAM+), and basal/myoepithelial cells (such as CD49f+/EpCAM−/low). As a result, our experiments will collectively confirm that our growth conditions (which will be more thoroughly described in the methods section) for multipotent mammary stem cells can indeed generate multi-lineage organoids.

      3/ The choice of control is not clear. For example, why was miR-106a-5p chosen as a control? And why choose miR-106a-5p when a better candidate would be miR-106b-3p, that produces very high number of organoids as well? And how did the other miRNAs affected the CD44/24 profile?

      • Response 3:
      • We apologize for any lack of clarity in our description. It's important to note that miRNAs consist of two strands, -5p and -3p, and both strands can coexist and play distinct roles. For example, paired species of members in the let-7 and mir-126 families coexist and have different regulatory functions in reprogramming and differentiation of embryonic stem cells [1]. Several deep sequencing studies have demonstrated the coexistence of 5p/3p pairs in approximately half of the miRNA populations analyzed [2, 3]. Therefore, to determine whether the biological effect specifically resulted from the -3p strand, we also assessed the -5p strand.
      • References

      • Koh W, Sheng CT, Tan B, Lee QY, Kuznetsov V, Kiang LS et al. Analysis of deep sequencing microRNA expression profile from human embryonic stem cells derived mesenchymal stem cells reveals possible role of let-7 microRNA family in downstream targeting of hepatic nuclear factor 4 alpha. BMC genomics2010 Feb 10;11 Suppl 1(Suppl 1):S6.

      • Jagadeeswaran G, Zheng Y, Sumathipala N, Jiang H, Arrese EL, Soulages JL et al. Deep sequencing of small RNA libraries reveals dynamic regulation of conserved and novel microRNAs and microRNA-stars during silkworm development. BMC genomics2010 Jan 20;11:52.
      • Kuchenbauer F, Mah SM, Heuser M, McPherson A, Ruschmann J, Rouhi A et al. Comprehensive analysis of mammalian miRNA* species and their role in myeloid cells. Blood2011 Sep 22;118(12):3350-8.

      4/ What is the CD44/CD24 profile in the organoid cultures from Figure 7?

      • Response 4:
      • The CD44/CD24 profile from the organoid cultures from Figure 7 will be assessed in the revised manuscript.

      Part 2.2 Following the experiment that have been already carried out that will be included in the manuscript after revisions.

      Reviewer #1 (Evidence, reproducibility and clarity):

      Major comments:

      The model system used in this work is referred to as "organoids", with the premise that organoids, as representatives of the original tissue, can be used to study tissue development. However, the organoids presented in the study are spherical structures, and the paper does not provide any information about how and to what extent these organoids represent the original tissue. Furthermore, it would be difficult to expect these organoids to accurately represent human breast tissue, as they are derived, to the best of the reviewer's understanding (it is not explicitly noted, but rather the text refers the reader to several previous works), from primary human breast epithelial cells that had been cultured for 6 passages in 2D culture. The CD24/CD44 flow cytometry profile of these 2D cultures, as well as the organoids derived from them, shows a unimodal distribution of CD24 and CD44 expression, and does not show distinct cell populations, as typical in primary breast epithelial cells that have not been cultured in 2D.

      • Response:
      • First, we assessed the aldehyde dehydrogenase activity (ALDH) [14] in our primary cells to demonstrate that these culture conditions preserve stem/progenitor properties (See Figure A, below). Additionally, we conducted immuno-staining of primary cells in 2D culture for lineage-specific luminal markers (CK18, MUC1) and basal markers (CK14, CK5), which revealed the heterogeneity of our population (See Figure B, below).

      FIGURE FOR REVIEWERS

      • Reference

      • Ginestier C, Hur MH, Charafe-Jauffret E, Monville F, Dutcher J, Brown M et al. ALDH1 is a marker of normal and malignant human mammary stem cells and a predictor of poor clinical outcome. Cell stem cell2007 Nov;1(5):555-67.

      • For the characterization of the 3D culture, we have presented early time points of 3D cell growth, which are mainly spherical (until Day 8). However, differentiation occurs in a stepwise manner, where single stem cells proliferate to form small spheroids before undergoing multilineage differentiation into organoids that initiate branching (Day 10). Subsequently, ducts undergo budding and lobule formation (Day 20). We have included a time-course representation of this 3D growth to illustrate the differentiation process (See Figure 1C).

      • Under these culture conditions, the 3D structure retains its self-renewal activity and the ability to reseed and regenerate secondary tissues. We have also assessed the self-renewal capacity of our 3D structure (See Figure 1D).

      FIGURE FOR REVIEWERS<br />

      Page 7 line 161: "mir-106a-3p directly promotes the "transdifferentiation" of CD44low/CD24high cells phenotype into CD44high/CD24low cell phenotype" - is an unsupported statement, given that there could be several alternative explanations for the observed change in population ratios, including effects on survival or growth of cells of a certain population.

      • Indeed, we cannot exclude the possibility of other alternative explanations. Therefore, we have already assessed the impact of miR-106a-3p on population doubling in culture to determine whether it has an effect on the survival or growth of the cells. We observed that miR-V cells stopped growing after approximately 15 population doublings, indicating their limited proliferative potential. In contrast, we found that miR-106a extended the lifespan of the cells, suggesting an effect on cell survival (Figure below). We will include this information in the manuscript.

      FIGURE FOR REVIEWERS

      • Why was GATA3 not included in the last analysis depicted in Fig. 7?
      • We apologize for any lack of clarity in our description. It's important to note that GATA3 was not included in Figure 7. As explained in the text, GATA3 plays a role in regulating Nanog expression. However, it's worth noting that the cells did not form organoids when GATA3 was depleted, as illustrated in the results below. We will include these results in the revised version of the manuscript.

      FIGURE FOR REVIEWERS

      Reviewer #2:

      2/ Authors claim that miR-106a-3p downregulates stem cell differentiation and utilize 'organoid' culture to track the temporal expression of OCT4, SOX2 and NANOG during phases of organoid renewal and differentiation. However, mammary stem cell differentiation is associated with the emergence of luminal progenitor, mature luminal and myoepithelial lineages that are characterized by the expression of a well-defined set of markers. The authors did not investigate the expression of these markers in their 'differentiation' settings. Furthermore, modulators of major pathways reported to be critical for mammary ASC maintenance are lacking, including modulators of WNT, TGF/BMP, Notch and other pathways. As such, it is difficult to ascertain that organoids emerging under such culture conditions are the result of stem cell renewal and differentiation, as opposed to lineage-restricted proliferative non-ASCs, thus questioning the validity of many of the findings in this work.

      • We agree with the reviewer that major pathways such as Wnt, TGFβ/BMP and Notch have been reported to be critical for mammary ASC maintenance. As suggested by the reviewer, to further evaluate the possible involvement of these pathways, we have analyzed our transcriptomic data, using the PROGENy R package (version 1.16.0) (https://doi.org/10.1038/s41467-017-02391-6) and DoRothEA (version 1.6.0)-decoupleR (version 2.1.6) computational pipeline (https://doi.org/10.1101/gr.240663.118, https://doi.org/10.1093/bioadv/vbac016), to investigate the differential activation of major signaling pathways and transcriptional factors. The major pathways are depicted in the figure below and will be included in the manuscript.

      FIGURE FOR REVIEWERS

      • There was significant enrichment indicating down-regulation of TGFβ, MAPK, WNT, PI3K genes along with gene sets representing other oncogenic pathways, are up-regulated such as the hypoxia response, JAK/STAT pathway, and p53 pathway activity (Figure A and B). Stem cells possess self-renewal activities and multipotency, characteristics that tend to be maintained under hypoxic microenvironments [15], thus this is not surprising to observe an up-regulation of Hypoxia pathway and activation of HIF1α transcription factor. In mammary stem cells, it has also been shown that p53 is critical to control the maintenance of a constant number of stem cells pool [16,17]. Remarkably, it has been shown that cell sorting of the cells with a putative cancer stem cell phenotype (CD44+/CD24 low) express a constitutive activation of Jak-STAT pathway [18], which we observed as up-regulated along with STAT1 and STAT2 transcription factors. In parallel, we observe a down-regulation of Wnt signaling as well as PI3K pathways. Wnt is known to play important role in the maintenance of stem cells; its inhibition has been shown to lead to the inactivation of PI3 kinase signaling pathways to ensure a balance control of stem cell renewal [19]. Moreover, we observe a down-regulation of SMAD4 and SMAD3 transcription factors correlated with a down-regulation of TGFβ pathway. Signals mediated by TGF-β family members have been implicated in the maintenance and differentiation of various types of somatic stem cells [20].
      • References

      • Semenza GL. Dynamic regulation of stem cell specification and maintenance by hypoxia-inducible factors. Molecular aspects of medicine2016 Feb-Mar;47-48:15-23.

      • Solozobova V, Blattner C. p53 in stem cells. World journal of biological chemistry2011 Sep 26;2(9):202-14.
      • Cicalese A, Bonizzi G, Pasi CE, Faretta M, Ronzoni S, Giulini B et al. The tumor suppressor p53 regulates polarity of self-renewing divisions in mammary stem cells. Cell2009 Sep 18;138(6):1083-95.
      • Hernandez-Vargas H, Ouzounova M, Le Calvez-Kelm F, Lambert MP, McKay-Chopin S, Tavtigian SV et al. Methylome analysis reveals Jak-STAT pathway deregulation in putative breast cancer stem cells. Epigenetics2011 Apr;6(4):428-39.

      • He XC, Zhang J, Tong WG, Tawfik O, Ross J, Scoville DH et al. BMP signaling inhibits intestinal stem cell self-renewal through suppression of Wnt-beta-catenin signaling. Nature genetics2004 Oct;36(10):1117-21.

      • Watabe T, Miyazono K. Roles of TGF-beta family signaling in stem cell renewal and differentiation. Cell research2009 Jan;19(1):103-15.

      5) Line 242: "These data demonstrate that miR-106a-3p is involved in the early cell differentiation process into the three germ layers ". The authors have not conducted functional or mechanistic work to show that miR-106a-3p is involved in morphological or transcriptomic differentiation changes in ESCs. This and other data would be necessary to substantiate this conclusion.

      • Response:
      • Indeed, we cannot conclude that miR-106a-3p is directly involved in the early cell differentiation process into the three germ layers without demonstrating the differentiation changes in ESCs through transcriptomic analysis. To clarify the take-home message, it's important to note that we did not include the transcriptomic characterization of differentiation changes in ESCs. Instead, we focused on assessing the impact of miR-106a-3p depletion on the expression of Oct4, Sox2, and Nanog. However, to gain a deeper understanding of the effects of miR-106a-3p depletion on hESCs differentiation, we also monitored the expression of specific genes upon the induction of the three embryonic germ layers (see Figure A, B, and C below). We observed that the expression of endodermal genes was not or only weakly affected by the level of miR-106a-3p expression (Figure A), whereas the expression of mesoderm- and ectoderm-specific genes increased upon miR-106a-3p down-regulation (Figure B and C). We will include these findings in the manuscript.

      FIGURE FOR REVIEWERS

      Reviewer 2 (Minor points)

      3) Figure 4C: In HMEC-CBX7 cells, it is unclear whether the high miR-106a-3p levels in CD44high CD24low cells are due to CBX7 expression. An important control, HMEC-Control Vector, is missing.

      • Response
      • The control HMEC-Vector is shown in panel Figure 4A for the FACS analysis. In Figure 4C, we did not include the control since there is no expression of miR-106a-3p, but it's important to note that this control was included in the experiment. As illustrated, there is no miR-106a-3p expression in the HMEC control cells. We intend to include this panel in Figure 4 of the manuscript.

      FIGURE FOR REVIEWERS

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In this study the authors identify miR-106a-3p as a potent inducer of organoid formation from HMECs. Overexpression of miR-106a-3p induced formation of more organoids, increased the number of stem/progenitor cells and overall positively affected the stemness properties of the organoids, likely by affecting SOx2, Oct4 and Nanog expression.

      Major comments: the flow of the paper is confusing, it appears that the authors are trying to combine several non-completed studies into one paper. It is not immediately evident how is the rationale or the conclusion supported by published data. For example, is there published evidence that Sox2/Oct4/Nanog are expressed in healthy mammary gland stem cells in vivo, or whether they have a role in establishment of stem cell population?<br /> The organoids are all spherical, while mammary gland is characterized by branching. Therefore, the organoids are not recapitulating the gland morphology and the validation should include wider range of molecular markers.<br /> The choice of control is not clear. For example, why was miR-106a-5p chosen as a control? And why choose miR-106a-5p when a better candidate would be miR-106b-3p, that produces very high number of organoids as well? And how did the other miRNAs affected the CD44/24 profile?<br /> What is the CD44/CD24 profile in the organoid cultures from Figure 7?

      Significance

      The study provides a novel methodology to enrich for the mammary stem cells. However, many of the experiments need further clarification.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      In this work, Robert et al. utilize mammary organoid culture as an in vitro model of stem cell renewal and maintenance. Authors show that a putative mammary stem cell population, characterized as CD44high CD24low, is enriched in organoid culture relative to 2D monolayer culture. They conduct a microRNA (miR) screen and identify miR-106a-3p as a miRNA that enriches for stem cell (CD44high CD24low) and organoid formation capacity, confirming these findings using miR-106a-3p overexpressing cells. Authors also show that CBX7 overexpression achieves a similar enrichment in CD44high CD24low and organoid formation capacity in an miR-106a-3p dependent manner, though the rationale behind the connection between CBX7 and miR-106a-3p is not well defined. Finally, the manuscript conducts a transcriptomic analysis on miR-106a-3p-OE cells and aims to functionally validate its role in embryonic stem cells (ESCs) as a model that is versatile for renewal and differentiation studies. How this relates to mammary adult stem cells (ASCs) is not entirely clear.

      Overall, the manuscript contains significant technical and conceptual limitations, and the data presented do not support the major conclusions of the study. There are two overarching issues that question the validity of most of the findings in this study. Firstly, there is no clear demonstration that the structures reported as 3D organoids are indeed driven by multipotent stem cells (in all data and experimental approaches associated with this). Secondly, there is a lack of evidence to support the claim that CD44high CD24low cells are stem cells with an exclusive or enhanced capacity to generate multi-lineage organoids.

      In addition to these general points, there are several specific major issues summarized below:

      1. Authors base their findings about mammary ASC renewal using a poorly defined organoid culture system that they claim is driven by ASC renewal and differentiation. These organoid growth conditions were originally developed to support growth of bronchial epithelial cells, and the authors have not presented data to objectively assess the validity of this extrapolation to expansion of mammary organoids. The authors did not present data to support the notion that these growth conditions generate multi-lineage organoids that expand from multipotent mammary stem cells.
      2. Authors claim that miR-106a-3p downregulates stem cell differentiation and utilize 'organoid' culture to track the temporal expression of OCT4, SOX2 and NANOG during phases of organoid renewal and differentiation. However, mammary stem cell differentiation is associated with the emergence of luminal progenitor, mature luminal and myoepithelial lineages that are characterized by the expression of a well-defined set of markers. The authors did not investigate the expression of these markers in their 'differentiation' settings. Furthermore, modulators of major pathways reported to be critical for mammary ASC maintenance are lacking, including modulators of WNT, TGF/BMP, Notch and other pathways. As such, it is difficult to ascertain that organoids emerging under such culture conditions are the result of stem cell renewal and differentiation, as opposed to lineage-restricted proliferative non-ASCs, thus questioning the validity of many of the findings in this work.
      3. The authors base their work on the claim that CD44high CD24low cells represent bona fide mammary ASCs. This claim is not support by functional work to show that organoid generation is exclusive to or enhanced in CD44high CD24low cells relative to other cells. The claim of differentiation of this stem cell population in vitro is not supported by data to show emergence of luminal progenitor, mature luminal and myoepithelial lineages that are characterized by the expression of a well-defined set of reported markers as abovementioned. Although miR-106a-3p is claimed to downregulate stem cell differentiation based on a gene set enrichment analysis, authors did not investigate the expression of mammary differentiation markers or the association of miR-106a-3p-transfected HMECs with gene set pathways involved in mammary gland differentiation.
      4. Line 129: "Together, these results indicate that cells grown as organoids acquired a CD44high / CD24low expression pattern similar to that of stem/progenitor cells, which suggests that 3D organoids can be used to enrich breast stem cell markers for further screening".

      This conclusion is not supported by the data presented. It is not clear if the expression of these markers was acquired upon 3D culture. It could be that 3D culture better maintained and expanded already existing CD44high CD24low cells in 2D culture. It is also unclear if these cells are indeed organoid-forming. Authors have not isolated and tested the organoid-forming capacity of CD44high CD24low cells relative to other cells. Along the same line, the conclusion that " mir-106a-3p directly promotes the "transdifferentiation" of CD44low/CD24high cell phenotype into CD44high/CD24low cell phenotype" isn't justified. Experiments required to conclude that 'transdifferentiation' is involved are lacking. miR-106a-3p overexpression could be creating conditions that are permissive for expansion of already existing CD44high CD24low cells as opposed to 'transdifferentiation' of other cell types into this phenotype. The authors could FACS-isolate CD44low CD24low cells and treat these with control or miR-106a-3p to conclusively establish 'transdifferentiation'.<br /> 5. Line 242: "These data demonstrate that miR-106a-3p is involved in the early cell differentiation process into the three germ layers "

      The authors have not conducted functional or mechanistic work to show that miR-106a-3p is involved in morphological or transcriptomic differentiation changes in ESCs. This and other data would be necessary to substantiate this conclusion.

      Selected technical points:

      1. Figure 1A: The Y-axis label is misleading and suggests multiple organoids seeded per cell? Organoid Formation Efficiency (OFE) or Organoid Formation Capacity (OFC) are the commonly used nomenclature for this.
      2. Figure 2G: X-axis unclear. Is this meant to investigate the percentage of cells expressing CD44/CD24 as double high, double low, high/low and low/high?
      3. Figure 4C: In HMEC-CBX7 cells, it is unclear whether the high miR-106a-3p levels in CD44high CD24low cells are due to CBX7 expression. An important control, HMEC-Control Vector, is missing.

      Significance

      The findings in this report do not represent a sufficient conceptual advance in mammary stem cell biology. There are some interesting data on the role of miR-106a-3p in differentiation and regulation of pluripotency-inducing factors OCT4, SOX2 and NANOG. This is, however, more relevant to ESC biology. The data presented do not sufficiently explain the proposed transcriptional and molecular influences of miR-106a-3p on ESC maintenance and differentiation. Furthermore, there are multiple instances in the manuscript of overstating conclusions in a manner that is not supported by the data presented, as well as several instances of a conceptually premature extrapolation of various aspects of ESC biology to mammary ASC biology. It is not clear what literature or experimental findings serve as the basis for the author's connection between these two developmentally and temporally distinct aspects of tissue biology.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Major comments:

      • The model system used in this work is referred to as "organoids", with the premise that organoids, as representatives of the original tissue, can be used to study tissue development. However, the organoids presented in the study are spherical structures, and the paper does not provide any information about how and to what extent these organoids represent the original tissue. Furthermore, it would be difficult to expect these organoids to accurately represent human breast tissue, as they are derived, to the best of the reviewer's understanding (it is not explicitly noted, but rather the text refers the reader to several previous works), from primary human breast epithelial cells that had been cultured for 6 passages in 2D culture. The CD24/CD44 flow cytometry profile of these 2D cultures, as well as the organoids derived from them, shows a unimodal distribution of CD24 and CD44 expression, and does not show distinct cell populations, as typical in primary breast epithelial cells that have not been cultured in 2D.
      • There appears to be confusion between concepts: primarily confusing a basal phenotype with a stem cell phenotype, and progenitor activity with stem cell activity. Because the 3D organoid model does not display a replication of luminal differentiation, it cannot be used as a proxy for stem cell function. The results from the miRNA screen and the subsequent experiments support two conclusions: 1. miR-160b-3p leads to an enhanced mesenchymal phenotype, manifested by reduced CD24 and enhanced CD44 expression. 2. miR-160b-3p leads to increased organoid formation. The latter may be interpreted, at best, as higher basal progenitor activity, but is not a measure of stem cell activity, as that would require the cells to give rise to more than one lineage, which is not shown here.
      • Overall, the information from figures 1-4 indicate that miR-160b-3p is driving and is associated with mesenchymal differentiation, possibly with EMT.
      • In contrast to the work in the breast 3D culture model, the experiments with hESCs are interesting and do support a role of this miR in stemness.<br /> There are several relatively minor comments, that cumulatively somewhat undermine the strength of the work:
      • Abstract: the sentence "organoids can be directly generated from human epithelial cells by only one miRNA, miR-106a-sp" needs better clarification.
      • Page 5 line 103: HMECs is a term that generally refers to human mammary epithelial cells, not a specific derivation or subpopulation thereof.
      • The graph in Fig. 1A is unnecessary, it shows only one bar.
      • It is unclear if all the HMECs were derived from the same donor, or several donors. There is no information about the donor and how the tissue and cells were derived. In general, it is not entirely clear how the cells were collected, processed, stored, and cultured from the time they were obtained from the donor until their use in the current study.
      • The key for Fig. 2D is unclear. The axes read "density" but the text refers to "intensity". Fluorescence intensity in flow cytometry is usually measured on a log scale. Differences on a linear scale are not usually considered meaningful. The authors should clarify why they chose a linear scale for this screen.
      • In the miRNA screen, how long were the cells cultured after transfection, and was it enough time for them to shift phenotype?
      • Page 6 line 154: The authors likely mean z-score, not z factor (two different things).
      • Page 7 line 161: "mir-106a-3p directly promotes the "transdifferentiation" of CD44low/CD24high cells phenotype into CD44high/CD24low cell phenotype" - is an unsupported statement, given that there could be several alternative explanations for the observed change in population ratios, including effects on survival or growth of cells of a certain population.
      • There is need for quantification of the phenotypes described in Fig. 3C
      • Figures 3 D-F it is not clear if the graphs display percentage or mean number (there is discrepancy between figure text and figure legend text), and when percentage, not clear for figure 3F out of what.
      • Fig. 5B, what is the statistical significance of the enrichment?
      • Why was GATA3 not included in the last analysis depicted in Fig. 7?

      Significance

      This manuscript describes experiments that aim to explore the role of miR-160b-3p in stem cells. It uses primarily a model of breast epithelial cells in 3D Matrigel culture, termed organoids.

      The first part of the paper describes a screen that identified miR-160b-3p as changing the expression profile of the two surface markers CD24 and CD44 in breast epithelial cells, which the authors refer to as a stem cell population, and enhancing organoid formation capability, which the authors interpret as stem cell capacity. In the second part of the paper, the experiments use another cell model - human embryonic stem cells (ESCs). In the second part, the authors link the expression of miR-160b-3p to the expression of Nanog, Sox2, and Oct4, which are key transcription factors that play essential roles in maintaining pluripotency and self-renewal of ESCs.<br /> The premise of the work is strong, namely that genetic screens that use an organoid model have the potential to uncover genes and pathways that direct tissue development and regulate stem cell fate and function. Several issues make it difficult to draw conclusions about stem cell function from the first part of the paper, namely the experiments with breast epithelial organoids. The second part of the paper is stronger and more convincing of the main claim, which is that miR-160b-3p has a role in stem cell maintenance.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary:

      This manuscript attempts to answer how the maternal and paternal chromosomes are organized, and probe the determinants of this organization.

      The authors use two divergent strains of worms - Bristol(N2) and Hawaiian - and hybrids progeny to study this as there are large regions of sequence variants between chromosome V in the two strains, making it an ideal candidate to design specific FISH probes. The authors build on their previously published work and optimize a protocol to trace chromosomes by using a multiple-probe FISH approach to investigate chromosome architecture. This approach is well illustrated in Figure 1.

      Overall, this manuscript does a good job of describing a potentially useful technique with wide application. The claims about differences (and similarities) require statistical analysis to be appreciated, and much work is necessary to make the analysis approachable to readers outside the immediate field.

      Major comments:

      Nearly all claims regarding the organization, compactness and pair-wise distances of chromosomes lack any statistical measures of significance. This is particularly important for the clustering and scaling analysis. This makes interpretation of the claims made in the text impossible. For example, claims such as "the step size remained virtually unchanged" or "the paternal chromosomes adopt the maternal conformation in hybrids" cannot be currently analyzed.

      Throughout the manuscript (including in the abstract), the authors use the term "sister chromosomes" to (presumably) refer to the maternal and paternal chromosomes. This is a confusing term, since "sister chromatids" usually refers to the identical products of DNA replication, and "homologous chromosomes" is usually used to describe the parental chromosomes. The term would ideally be changed, and at the very least, it should be clearly defined.

      Presentation: The manuscript in its current state (excluding figure one) is essentially impossible to interpret by readers who are unfamiliar with this subfield. The authors could include a blurb on the methodology behind each data type to help the manuscript reach a larger audience. The pipeline, meaning, and potential caveats of the clustering analysis should also be explicated.

      Other suggestions:

      The use of Hi-C-like heatmaps is good, since they are commonly used and are clear and easy to understand. However, it would be best to explain how the FISH data were used to construct the maps. The implications of the map could also be better explained (e.g., that the red cluster means relatively looser regions, and the blue means more tightly compacted ones).

      The last sentence in the Introduction does not make clear sense. How does the similarity between N2 & HI open up the possibility of interrogating inheritance effects?

      Several of the additional analysis that could improve the paper are: 1. Measure the nucleus diameter in N2/HI hybrid and HI/N2 hybrid. 2. Normalize the spatial distance to the nucleus size, rather than directly using the distance. 3. Explore some of the patterns in the spatial distance plots (e.g., red/blue lines and boxes). Are the sequences that are in them any different between N2 and HI in a way that might be able to account for these patterns?

      Significance

      The manuscript introduces a technical advance in the study of chromosomal territories - an important area of study that benefitted from recent advances in microscopy and in development of FISH approaches. However, it lacks mechanistic analysis and remains almost purely descriptive. It is also not clear what motivated the work beyond the technical feasibility. These issues make it impossible to assign biological significance to the seemingly minor differences that are documented.

      However, as a report of a technical advance, it could be useful to many chromosome biologists who might apply it to diverse organisms and biological questions.

      I am a chromosome biologist working on worms. However, my research does not directly deal with parental effects or with the development of novel FISH methodologies, so I did not examine claims regarding these specific points.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Building on their previous work using sequential fluorescent in situ hybridization (FISH) to follow the path of entire chromosomes in C. elegans (Sawh et al. 2020; Sawh and Mango 2020), the authors developed and then applied a method that distinguishes maternal and paternal homologs. In particular, they designed probes specific for ChrV in two strains, N2 and HI, and then demonstrated their effectiveness in homozygotes and hybrids. They found that HI ChrV is more compact in HI homozygotes as compared to N2 homozygotes, but decompacts in the F1 of N2 hermaphrodites x HI males. A different outcome was observed with respect to decompaction in the reverse cross, where both N2p and HIm ChrV chromosomes (p=paternal, m=maternal) exhibit decompaction. Through unsupervised clustering, the authors further found both dominant and minor patterns of chromosome-wide organization, with maternal chromosomes similar in terms of their dominant clusters regardless of the direction of the cross, but paternal chromosomes less so. Finally, the authors measured the degree to which homologous chromosomes interact, concluding that, although homologs overlap quite frequently, they rarely align (pair).

      In sum, the significance of the authors' work lies in its chromosome-level observations and the application of computationally designed probes that distinguish homologs by targeting strain-specific insertions. While homolog distinction by FISH has been previously demonstrated, this study is the first to demonstrate this approach in C. elegans as well as implement it via insertions in a chromosome-wide manner. As such, the manuscripts should be of interest to a broad range of researchers, especially those in the fields of genetics, genomics, and 3D genome organization. That said, the study falls short in several ways, and we recommend the authors i) present a more thorough summary of what is known about homolog positioning across species, ii) describe how homologs have been previously distinguished by FISH and, thus, more clearly elucidate the specific advances they have enabled, iii) ground their work in more rigorous quantitation, and iii) provide a better description of the technologies (strengths as well as limitations) carried over from their previous studies so that readers can better evaluate the current study. We detail our suggestions and questions, below:

      Major Comments:

      1. Page 1: We suggest the authors broaden the reach of their introduction to include well-known examples outside of C. elegans of the impact of parent-of-origin on 3D genome organization. Such examples would include X-inactivation, selective silencing of paternal genomes, the physical elimination of paternal chromosomes, and the like.
      2. Page 1: We also suggest the authors consider including mention of observations from the following research publications and review:

      Mayer W et al. Spatial separation of parental genomes in preimplantation mouse embryos. 2003 PMC2169371

      Reichmann J et al. Dual-spindle formation in zygotes keeps parental genomes apart in early mammalian embryos. 2018 PMID: 30002254

      Nagele R, Freeman T, McMorrow L, Lee HY. Precise spatial positioning of chromosomes during prometaphase: evidence for chromosomal order. 1995 PMID: 8525379

      Hua LL et al. Mitotic antipairing of homologous and sex chromosomes via spatial restriction of two haploid sets. 2018 PMID: 30530674

      Hua LL, Casas CJ, Mikawa T. Mitotic antipairing of homologous chromosomes. 2022 PMC9731508 3. Page 5: The authors designed their strain-specific probes to target 172 insertions that are over 1 kb in size and distributed across ChrV. We ask the authors to describe these insertions in greater detail, especially as, later in the manuscript, the authors touch on the possibility that sequence differences between the two strains may account for differences in chromatin architecture. How many insertions were on the N2 and HI chromosomes, respectively? What is the range and distribution of insertion sizes for all insertions as well as specifically for the N2 and HI ChrV chromosome? Do the insertions contain repetitive sequences, or are they predominantly composed of unique sequences? What is their distribution with respect to genes, active regions, TADs? Is there an explanation for why some are clustered? If they contain genes, are the genes enriched in certain GO categories? Do the insertions differ in their characteristics across the different chromosomes? This information could be included as graphs and/or tables. 4. Page 5: Given that N2 and HI ChrV chromosomes differ by the number of insertions and, ultimately, probes, how might these differences have skewed the authors' results, especially with respect to overlap between the homologs? Here, simulations of different ratios of insertions between N2 and HI could be clarifying. 5. What difficulties were encountered when tracing the paths of overlapping homologs, and how were these difficulties accounted for and/or solved? Did the different numbers and distributions of insertions between N2 and HI exacerbate the challenge? What confidence levels accompanied their findings? 6. Page 4: It would be helpful if the authors to put their insertion-based method into the context of other studies that have developed and used FISH to distinguish homologs. 7. Pag 6: It would clarifying if the authors provided details about the mis-annotation of the Thompson genome and how it is pertains to probe design. 8. Page 6: The authors state that "...N2 and HI...harbor sequence differences, some of which are predicted to affect chromatin architecture" and that HI lacks ppw-1. We ask the authors to provide a more thorough discussion. To what extent might such predictions rest on the insertional differences between the strains? 9. Page 7: How much smaller is the HI genome and what percent of this difference is due to insertions (deletions)? Related to this, how much smaller is the HI ChrV chromosome as compared to N2? 10. Page 7 and throughout: For those readers who have not read Sawh and Mango 2020 and Sawh et al. 2020, or who are unfamiliar with the broader category of imaging technologies that support the current study, we ask the authors to provide much more background and citations to key methods. Without this information, many readers will neither sufficiently understand the strategies used for imaging acquisition, processing, and analysis nor grasp the relevance of terms such as step size, polymer step size, power-law fitting, etc. and therefore be less able to assess the authors' data and conclusions. 11. General statement: When the authors infer similarity or differences between power-law fittings, scaling exponents, step sizes, etc. what is the statistical significance of those comparisons? 12. Experiments in general: We suggest the authors provide considerably more quantitation. For example, we urge them to provide the number of trials, sample sizes, numbers of embryos examined for all experiments. Equally important would be information regarding the stage of embryos examined and, where more than one embryonic stage was involved, the number of embryos for each stage. Are there stage-specific changes? We are also concerned about the impact of mixed populations of embryos on studies using unsupervised clustering. In other words, what was the contribution of developmental stage to the outcome of the clustering? Furthermore, if not all nuclei in an embryo were captured, we ask the authors to give the percent of nuclei captured from an embryo and reasons why only a subset of nuclei were included in the analysis. 13. With regard to cluster analyses both here and elsewhere, will the authors please include statements of statistical significance whenever they note differences and/or similarities? 14. Page 8: It would be helpful if the authors explained how they implemented the nearest-neighbor approach, including caveats and limitations (success rates, drop-out rates, etc.) and providing statistical assessment wherever possible. 15. Page 8: "In some instances (6-8% of traces), traces were ambiguous and excluded from further analysis". We ask the authors to provide more detail. For example, what does ambiguous mean and, with respect to the 6-8% value, what was the total number of traces? What was the distribution of all traces (prior to filtering) with respect to percent of targets detected? Also, how coincident were the two homologs of a nucleus to each other in terms of capturing all the targets? 16. Page 8: "...we classified traces into N2 or HI based on whether the trace was located closest to a strain marking volume for N2 or HI." Will the authors please quantify "closest" and explain what this means, whether there was a cut-off and, if there had been, how it was determined and implemented? What percent of cells were problematic, and were there traces that did not overlap the strain marking volumes at all? As stated in the Materials and Methods, only a subset of traced chromosomes were analyzed for overlap - why were only a subset analyzed for overlap, how was the subset selected, and how many/what percentage did these traces represent? It would also be helpful if the authors provided a quantitative summary of the traces. 17. Page 8: Did the authors account for chromatic aberration and, if so, what protocol did they use? 18. Page 8: "...counting how often more than two N2 or HI traces were detected in one nucleus." This is puzzling, and we suggest that the authors include explanations for how this might have happened. Did the nuclei not contain signal from the other strain marking probe at all? Was there a bias for this to happen with N2 or HI chromosomes? Could this have been a consequence of biology or of the algorithm for tracing? The authors' observations are reminiscent of the many implications raised by Jia et al. (2023; A spatial genome aligner for resolving chromatin architectures from multiplexed DNA FISH. PMID: 36593410), and we ask the authors to comment on the relevance of their observations to those in this recent publication. 19. Page 8: "We found only a minority of 2% of HI traces and 7% of N2 traces were mis-assigned and excluded these from downstream analysis." 2% and 7% of what total? 20. Page 8: How do pairwise distances remain almost identical between N2 and HI and yet generate different scaling exponents? 21. Page 9: Figure 1F shows images of embryos derived from N2 hermaphrodites x HI males. It would be helpful if the authors added analogous images from the reciprocal cross as a supplementary figure. 22. Page 2, 9, 9, and 12: The authors make several comments regarding the action of factors in trans: "... factors from the mother impact chromosome folding in trans (p. 2)"; "... the HIp decompacts when subjected to the N2m environment and implies that the paternal chromosome is influenced by the maternal environment in trans (p. 9)"; "...N2 chromosomes influence HI chromosomes in trans, while N2 chromosome structure seems to be resistant to influences by the HI chromosomes (p. 9)"; and "...implicating maternal factors that act in trans (p. 12). While provocative, these statements call for more concrete consideration. Are the authors using "in trans" in lieu of "indirectly", or are they alluding to factors, such as ppw-1, or direct physical contact? Without further substantiation or argument, mention of in trans activity might best be reserved for the Discussion. 23. Page 10: "While HIp subpopulations were characterized by folding of one or the other chromosome arm, N2p clusters were more open and a subpopulation with a highly folded right arm was not present" (Figure 5CD). Was there a significant correlation between left vs. right arm folding and overall genome organization and function? 24. Page 11: Will the authors please provide a more explicit definition of alignment as well as a more detailed description of how alignment is quantified in the main text? 25. Page 11: With respect to direct physical contact, the authors mention transvection, which they conclude in the abstract is unlikely because pairing between homologs was observed to be rare. As transvection and pairing can both be short-lived, and the data are not compelling, the statement may need to be toned down considerably and/or be moved to the discussion. 26. Page 11: The authors draw a distinction between % territory overlap and physical distances between homologs. In particular, the differences between % overlap across different stages is quite interesting and potentially suggests embryo stage-specific changes. Could the authors explore this further by breaking down mean pairwise distances into different embryo stages (Figure 6B and C)? 27. Pages 2, 11-13: When the authors use "sisters", do they mean "homologs"? If the latter, we recommend they use "homologs", only, as "sisters" refers to the sister chromatids after replication. If, however, the authors are using "sisters" to mean sister chromatids, will they please explain how their data can distinguish sisters? 28. Discussion: We encourage the authors to speculate further regarding the basis of decompaction. Is it a hybrid-specific phenomenon?

      Minor comments:

      1. Page 1: Although the introduction focuses on C. elegans, the genome length that is mentioned (2 meters) is more aligned with that of mammalian species. The authors could cite a range of lengths or make more clear which species is being discussed.
      2. Page 5: As the figures label the strains as Hawaiian and Bristol, the authors might wish to include this nomenclature in the main text. Curiously, the authors use several different spellings for the Hawaiian/Hawai'ian/Hawaiin/Hawaii strain.
      3. Page 5: Will the authors please explain why the common whole-chromosome tracing probes have only one tail, while the strain-specific probes have two tails, as shown in Figure 1D?
      4. Figures in general: The axes of a number graphs and heat maps need to be labeled.
      5. Materials and Methods: The section on "Cluster analysis" is missing units for the resolution.
      6. Page 8: Will the authors please give a reference for and explain watershed segmentation?

      Significance

      In sum, the significance of the authors' work lies in its chromosome-level observations and the application of computationally designed probes that distinguish homologs by targeting strain-specific insertions. While homolog distinction by FISH has been previously demonstrated, this study is the first to demonstrate this approach in C. elegans as well as implement it via insertions in a chromosome-wide manner. As such, the manuscript should be of interest to a broad range of researchers, especially those in the fields of genetics, genomics, and 3D genome organization. That said, the study falls short in several ways, and we recommend the authors i) present a more thorough summary of what is known about homolog positioning across species, ii) describe how homologs have been previously distinguished by FISH and, thus, more clearly elucidate the specific advances they have enabled, iii) ground their work in more rigorous quantitation, and iii) provide a better description of the technologies (strengths as well as limitations) carried over from their previous studies so that readers can better evaluate the current study.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      The authors designed an elegant series of FISH probes taking advantage of insertions that are divergent between HI and N2 strains of C. elegans to identify the maternal versus paternal chromosomes in hybrid embryos. Overall, the conclusions are well supported by the data. I only have minor comments, which are numbered below in relation to each figure.

      In figure 1 they demonstrate that the probes can specifically recognize their corresponding chromosome in hybrid embryos

      In figure 2 they demonstrate that overall chromosome 5 adopts a similar shape from both strains.

      In figure 3, they demonstrate that in the hybrids, the chromosomes are generally the same as in the homozygous embryos. However, when the HI chromosome is brought in paternally in the hybrids, it is more decompacted. In this cross, the maternal N2 chromosome is normal. In figure 5, when the N2 chromosome is now brought in paternally, it is similarly decompacted. However, in this cross, the HI chromosome that is brought in maternally is also decompacted. This appears to be the biggest difference, but is somewhat mitigated by a decrease in the scaling component, which I believe means it takes a straighter path? This is in contrast to the reciprocal cross where the maternal N2 chromosome is normal.

      1. In figures 2-4, it is important to note what stages of embryos are being analyzed and whether any analysis was done to determine if the chromosomes varied with embryonic stage?
      2. The authors need to clearly define chromosomal step size, scaling coefficient and pair wise distance and then describe the difference between these measurements. For example, it would be nice in relation to figure 4F if it was described exactly what it means to have an increase in step size along with a decrease in scaling exponent. This will enable the reader to more easily interpret the results.
      3. Is there any way to determine if changes in the step size and scaling are significant? It would be good to know if the changes are actually significant.

      In figure 5, the authors examine sub-clusters of where individual chromosomes locate. 4. In figure 5 (and maybe in earlier figures as well), it would also be helpful to mark the different clusters in the figures to show what is meant by a folder arm or a compacted central domain and refer to every panel in the text (only some descriptions in the text reference specific panels).

      In figure 6, the authors determine whether the two chromosomes 5's overlap in nuclear territory and whether they the align along the length of the chromosome. From this analysis, they conclude that the chromosomes overlap a fair amount of time, but do not align. This makes it unlikely that transvection might occur. 5. In figure 6, the authors need to do a better job of describing how the data is being presented. The % overlap is being graphed by density, but density of what? Also, the text mentions the total number of nuclei that overlap, but how is that number derived from the presented data? Finally, the data are broken down by embryonic stage, but there is no mention of this in the text. It is not mentioned until the discussion. Overall, this makes it very difficult to determine what the data are showing. 6. In the discussion, the authors perhaps should spend more time interpreting their results in light of others work on the maternal and paternal inheritance of chromatin in C. elegans. For example, Arico et al 2011 Plos Genetics from the Kelly Lab. In addition to examining chromatin in the early embryo, in this paper the authors examine translocations, which might be interesting to look at using the technique presented here. Also, a number of recent papers from the Strome lab have examined chromatin inheritance from sperm. It would be interesting to interpret the finding that paternal chromosomes are influenced by the maternal environment, in light of this work.

      Significance

      These studies are the important extension of the elegant chromosome tracing that the Mango lab has pioneered. The authors have clearly demonstrated that the technique works well to identify individual chromosomes in a hybrid background. This provides the opportunity for the system to be used in numerous different ways, not just in C. elegans. This is the most significant advance of this paper and should be of interest to a fairly broad audience. However, using this technique, the authors also provide the initial characterization of sister chromosomes in C. elegans embryos and draw important initial conclusions, such as finding that the chromosomes do not pair, as they do in Drosophila. This makes the paper of interest to the C. elegans audience, as well as the general field of chromosomal organization. My expertise is in C. elegans biology and chromatin biology in general. I also am familiar with the field of chromosome biology. As a result, I believe I am capable of judging the significance of this paper in these areas.

  2. Sep 2023
    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Point-by-point response to reviewers, including our plans for the revision:

      ­­­Review____er #1 (Evidence, reproducibility and clarity (Required)):

      * Summary: In this manuscript by the Sanson group, Lye and colleagues try to definitively answer the question of whether pulling forces from the ventral mesoderm have significant effects on convergent extension in the Drosophila germband (germband extension). While germband extension does occur in mutant embryos lacking mesoderm invagination, it has long been an open question in the field as to whether ventral pulling forces from the mesoderm have significant effects (positive or negative) on cell intercalation during germband extension. To definitely address this question, Lye and colleagues generated high-quality, directly comparable datasets from wild-type and twist mutant embryos, and then systematically assessed nearly all aspects of cell intercalation, myosin recruitment, and tissue elongation over time. They demonstrate that pulling forces from the ventral mesoderm have negligible impacts on the course of germband extension. While there are indeed some interesting differences between wild-type and twist embryos with respect to cell intercalation and myosin recruitment, such differences are relatively minor. They conclude that the events of germband extension neither require nor are strongly affected by external forces from the mesoderm. While this is largely a negative results paper, I believe that it should be published and that it will be an impactful paper within the field. Namely, it will settle once and for all the question of whether mesoderm invagination is required for optimal germband extension in the early Drosophila embryo, and it suggests that tissues are largely autonomous developmental units that are buffered from outside mechanical inputs.*

      • * *Major comments: *

      * It seems to me that the one obvious omission from this paper is a general measure of convergent extension over time. I think it would be useful to the reader to include some measure of change in tissue aspect ratio over time between wild-type and twist embryos. This could be included in Figure 5 or 6. *

      • *

      We are happy to include a graph with what we call “tissue strain rate”, which measures the deformation of the germ-band in the direction of extension (along AP) over time, and propose to add it as a panel in Supplementary Figure 6. Note that in our measures, the “tissue” strain rate is decomposed into contributions from two cell behaviors, the “cell intercalation” strain rate and the “cell shape” strain rate (Blanchard et al., 2009). “Tissue” and “cell shape” strain rate are directly measured, and “cell intercalation” strain rate is what remains when “cell shape” strain rate is removed from “tissue” strain rate. The “cell intercalation” strain rate calculated in that way is a “continuous” measure of cell intercalation, measuring the progressive shearing of cells during convergent extension. We also use a “discrete” measure of cell intercalation, which measures the number of cell neighbor exchanges, also called T1 swaps. We found that both “continuous” and “discrete” measures of cell intercalation are unchanged in twist mutant compared to wild-type embryos (Fig. 6F and 6E, respectively). In contrast, we find that the “cell shape” strain rate is increased in twist mutants (Fig. 5B and Fig. 5S1A). Consistent with this finding, the “tissue” strain rate is also increased in twist mutants (see graph below).

      Otherwise, I have no major comments on the experimental approach or the findings of this manuscript. It seems to me a straightforward and systematic approach for determining whether mesoderm invagination affects germband extension. I do have several minor comments that should be addressed prior to publication (below).

      *Minor comments: *

      *I understand why cells would initially stretch more along the DV axis in wild-type embryos compared with twist embryos, but why do cells become so much more stretched along the AP axis (and become smaller apically) after 10 minutes of GBE in wild type compared with twist (Figure 2C and E). *

      *I think this is an interesting and non-intuitive result that would warrant a bit of explanation/conjecture. *

      This is not what Fig. 2C and E show, and we realize now that our schematics on the graphs might have been confusing. We will work on those to improve their clarity (or remove them), and also review our text.

      Figure 2C shows how cells deform along DV (cell shape strain rate projected onto the DV axis). So the graph does not show that the cells are elongating in AP, as only the DV component of the strain rate is shown in this figure. In the wild type, the DV strain rate is positive (the cells are elongating in DV) at developmental times when the mesoderm invaginate (from about -10 minutes to until 7.5 minutes). The DV strain shows an acceleration until about 5 mins, then decelerates, crossing the x-axis to become negative at 7.5 minutes. From this timepoint and until the end of GBE, the DV strain rate is negative (the cells are contracting along DV). Mirroring the positive section of the curve, the DV contraction of the cells accelerate until about 12 mins and then slows down. The strong rate of DV contraction between 7.5 and 20 mins could in part be due to the endoderm invagination pulling in the orthogonal direction (AP) and helping the cells regaining a more isotropic shape. We could add a mention about this in the discussion.

      In Figure 2E, the rate of change in cell area follows a similar time course in the wild type, showing that the cells are increasing their areas until about 10 mins (positive values) and then reduce their areas again until the end of GBE (negative values). Note that the graph does not show raw (instantaneous) cell areas as suggested by the comment, but rather a rate of change.

      So in wild type, the cells get stretched by the invaginating mesoderm, and once the mesoderm is not pulling anymore, the cells appear to relax back. As there is no stretching in twist mutants, there is no equivalent relaxation of the cells along DV. Note that in twist, there is a milder increase in cell area in the first 15 mins of GBE (Fig. 2E). This could again be caused by the pull from endoderm invagination stretching the cells along AP, which, as we have shown before, increases both cell shape strain rates along AP and cell areas (Butler et al., 2009). So the pull from endoderm invagination (along AP) will have an impact on cell area rates of change and possibly also, indirectly, on DV cell shape strain rates, in both twist and wild type embryos, during most of GBE. Therefore cell area and DV cell shape strain rates are affected by more than one process during GBE. In this paper, we are focusing on the impact of mesoderm invagination, which happens around the start of GBE, so have focused our analysis of the graphs in the results section to this period, and the differences between wildtype and *twist. *

      *I don't understand how you are defining cell orientation in Figure 2G. How are you choosing the cell axis that you are then comparing with the body axis? Is it the long axis, or something more complicated than that? I think you should briefly provide this information in the results section. If it is included in the methods, I wasn't able to locate it. *

      Yes, it is the orientation of the long axis of the cell relative to the antero-posterior embryonic axis. We will clarify this in the text, in particular in the Methods, and also try improve our schematics.

      Figure 2: Since you have the space, it might help the reader if you simply wrote out "strain rate" for panels B, D, and F, rather that used the abbreviation "SR." Thank you for this suggestion, we will reduce use of abbreviations where space permits.

      *Please ensure that all axis labels are fully visible in the final figures. In several figures, the Y-axis labels were cut off (e.g., Fig 2I, 4A, 4D, 6B, 6C). *

      These were visible to us in our submitted version, but of course we will ensure everything is visible on the final version.

      *Where space permits, I would suggest using fewer abbreviations in axis labels to increase readability of the figures (e.g., in Figures 3H or 4D). *

      Thank you for this suggestion, will do.

      * In Figure 7, I would move the wild-type panels to the left and the twist panels to the right. I think it is more conventional to describe the normal wild-type scenarios first, and then contrast the mutant state.*

      Will do.

      To be consistent with the literature, "wildtype" should be hyphenated (wild-type) when used as an adjective, or two separate words (wild type) when used as a noun. Thank you, we will change this.

      Review*er #1 (Significance (Required)): *

      * Advance: The advances in this manuscript are largely methodological, but the experiments and analyses are quite rigorous and allow the authors to make strong conclusions concerning their hypotheses. Their findings are based on a high-quality collection of movies from control and twist mutant embryos expressing a cell membrane marker and knock-in GFP-tagged myosin. Importantly, I think the researchers were correct in choosing to analyze twist single-mutant embryos (as opposed to snail or twist, snail double-mutant embryos), as the overall embryo geometry of these mutants is fairly similar to wild-type embryos, allowing the researchers to directly compare cell behaviors and myosin dynamics during germband extension. This approach also allows them to avoid indirect effects on the germband due to a completely non-internalized mesoderm. *

      *

      Audience: The primary audience for this article will be basic science researchers working in the early Drosophila embryo who are interested in the interplay between the germband and neighboring tissues. Secondary audiences will include developmental biologists more broadly who are interested in biomechanical coupling (or in this case decoupling) of neighboring tissues. *

      *

      Describe your expertise: I have been a Drosophila developmental geneticist for over twenty years, and I have been working directly on Drosophila germband extension for over a decade. I have published numerous papers and reviews in this field, and I am very familiar with the genetic backgrounds and types of experimental analyses used in this manuscript. Therefore, I believe I am highly qualified to serve as a reviewer for this manuscript.*

      ­­

      Review____er #2 (Evidence, reproducibility and clarity (Required)):

      *

      In the present manuscript, Lye et al. describe a highly detailed quantification of cell shape changes during germband extension in Drosophila melanogaster early embryo. During this process, ectodermal tissue contracts along the dorso-ventral axis, simultaneously expanding along the perpendicular antero-posterior direction, migrating from the ventral to the dorsal surface of the embryo as it extends. This important morphogenetic event is preceded by ventral furrow formation when mesodermal tissue (located in the ventral part of the embryo) contracts along the dorso-ventral axis and invaginates into the embryonic interior. The study compares cell shape dynamics in the wildtype Drosophila with that in the twist mutant, which largely lacks mesoderm and does not form ventral furrow. The major motivation of the study is to examine whether cellular behaviors and myosin recruitment in the ectoderm is cell autonomous, or if those cellular behaviors depend on mechanical interactions between mesoderm and ectoderm.*

      • The authors first examine whether transcriptional patterning of key genes involved in germband extension is different between the wildtype and the twist mutant and find no significant difference. Next, the authors thoroughly quantify cellular behaviors and patterns of myosin recruitment in the two genetic backgrounds. A number of different measures are investigated, notably the rate of change in the degree of cellular asymmetry, rate of cell area change, rate of change of cell orientation, differences in myosin recruitment to cell edges of various orientation, as well as the rates of growth, shrinkage, and re-orientation of the various cellular interfaces. It is thoroughly documented how these quantities change as a function of developmental timing and spatial position within the embryo. These data serve basis for quantitative comparison between cellular dynamics in the two genetic backgrounds considered.*

      • Overall, the study shows that cellular behaviors observed in the ectoderm are largely the same during the period of time following ventral furrow formation, as would be expected if those cellular behaviors were predominantly cell autonomous and not dependent on stresses generated in the mesoderm.*

      • The data presented in the manuscript are of excellent quality and presentation is very clear.

      Minor comments: none *

      * Reviewer #2 (Significance (Required)): *

      * I find that the study provides a thorough quantification of cell behaviors in a widely studied important model of morphogenesis. The work may be of particular interest for future model-to-data comparison, perhaps providing a basis for future modeling work. I therefore certainly think that this work warrants publication.*

      • However, the results of the study largely parallel previous findings and do not appear novel or surprising. It is well established that in snail mutant that lack mesoderm entirely, germband extension proceeds largely normally. This well-established fact suggests that since tissue dynamics in complete absence of mesoderm are largely unaffected, behaviors of individual cells are likely to not be affected either*.

      *The work is pretty much entirely observational, and for most part provides a more detailed documentation/quantification of previous findings. I do not think it is appropriate for high profile publication. *

      We are not sure which evidence the reviewer is referring to here specifically. We agree that the single mutants twist or snail, or the double twist snail mutants do extend their germ-band. However, the question we are asking here, is how well do they extend their germband and to answer this question, quantitation is needed. The first quantitation of GBE were performed by (Irvine and Wieschaus, 1994). While they quantified GBE in various mutant contexts, they did not perform quantitation for snail, twist, or twist snail mutants. Instead, they refer to these mutants once in p839, with the following sentence: Additionally, twist and snail mutant embryos, which lack mesoderm, extend their germbands almost normally (Leptin and Grunewald, 1990; Simpson, 1983)*.” *

      Following these earlier qualitative observations, various studies have quantified different aspects of GBE in mesoderm invagination mutants, with contradictory results. For example, some studies, including from our own lab, report a reduction in cell intercalation in the absence of mesoderm invagination (Butler et al., 2009; Wang et al., 2020), but there have also been reports that tissue extension and T1-transistions occur normally (Farrell et al., 2017)(see also introduction of our manuscript). These contradictory results have motivated our present study, and we have implemented rigorous comparison between wild type and mesoderm invagination mutants, being careful i) to check that the regions analyzed were comparable in terms of cell fate, and ii) to control for any confounding effects between experiments (see also response to reviewer 4, main question 2). We have also considered which mesoderm invagination mutants to use. We rejected snail or twist snail mutants because the absence of snail means that the mesodermal cells do not contract and thus stay at the surface of the embryo, which changes the spatial configuration of the embryo considerably and would make a fair quantitative comparison very difficult. Instead, we decided to use twist mutants, as in those, cell contractions still happen so the cells do not take as much space at the surface of the embryo, but the contractions are uncoordinated which means that there is no invagination (and we demonstrate here, no significant pulling on the ectoderm). We note that reviewer 1 highlights the merit of settling the question of the impact of mesoderm invagination on GBE and the pertinence of choosing twist mutants versus the alternatives (see also response to reviewer 4, suggestion 1).

      ­­

      __Review____er #3 (Evidence, reproducibility and clarity (Required)): __

      During morphogenesis, the final shape of the tissue is not only dictated by mechanical forces generated within the tissue but can also be impacted by mechanical contributions from surrounding tissues. The way and extent to which tissue deformation is influenced by tissue-extrinsic forces are not well understood. In this work, Lye et al. investigated the potential influence of Drosophila mesoderm invagination on germband extension (GBE), an epithelial convergent extension process occurring during gastrulation. Drosophila GBE is genetically controlled by the AP patterning system, which determines planar polarized enrichment of non-muscle myosin II along the DV-oriented adherens junctions. Myosin contractions drive shrinking of DV-oriented junctions into 4-way vertices, followed by formation of new, AP-oriented junctions. This process results in cell intercalation, which causes tissue convergence along the DV-axis and extension along the AP-axis. In addition, GBE is facilitated by tissue-extrinsic pulling forces produced by invagination of the posterior endoderm. Interestingly, some recent studies suggest that the invagination of the mesoderm, which occurs immediately prior to GBE, also facilitates GBE. In the proposed mechanism, invaginating mesoderm pulls on the germband tissue along the DV-axis; the resulting strain of the germband cells generates a mechanotransduction effect that promotes myosin II recruitment to the DV-oriented junctions, thereby facilitating cell intercalation. Here, the authors revisited this proposed mechanotransduction effect using quantitative live imaging approaches. By comparing the wildtype embryos with twist mutants that fail to undergo mesoderm invagination, the authors show that although the DV-oriented strain of the germband cells was greatly reduced in the absence of mesoderm pulling, this defect had a negligible impact on junctional myosin density, myosin planar polarity, the rate of junction shrinkage or the rate of cell intercalation during GBE. A mild increase in the rate of new junction extension and a slight defect in cell orientation were observed in twist mutants, but these differences did not cause obvious defects in cell intercalation. The authors conclude that myosin II-mediated cell intercalation during GBE is robust to the extrinsic mechanical forces generated by mesoderm pulling.

      • * *Overall, I found that the results described here are very interesting and of high quality. The data acquisition and analyses were elegantly performed, statistics were appropriately used, and the manuscript was clearly written. However, there are a few points where some further explanation or clarification is necessary, as detailed below: *

      • The main conclusion of the manuscript relies on appropriate quantification of myosin intensity at cell junctions. It is therefore important that the methods of quantification are well justified. Below are a few questions regarding the methods used in the analyses:*
      • -For myosin quantification, the authors state that "Background signal was subtracted by setting pixels of intensities up to 5 percentile set to zero for each timepoint" [Line826]. The rationale for selecting 5 percentile as the threshold for background should be explained. Also, how does this background value change over time? *

      • *

      For our normalization method, we stretched the intensity histogram of images to use the full dynamic range for quantification and enable meaningful comparison of intensities between different movies. The 5th percentile was chosen to set to zero intensity as this removed background signal without removing any structured Myosin signal (i.e., non-uniform, low level fluorescence - this was assessed by eye). We will provide some before and after normalization images at different timepoints to illustrate this (See reviewer 3, minor point 4 below). Since the cytoplasmic signal is uniform, it is difficult to discern from true ‘background’, therefore some cytoplasmic signal might be set to zero with this method, but all medial and junctional Myosin structures will still be visible and have none-zero intensity values. However, since cytoplasm takes up a large majority of pixels in the image, and we only set 5% of pixels to zero, the majority of the cytoplasm will have non-zero pixel values. ‘Background’ changes increases slightly as Myosin II levels increase in general over time, as expected from the embryo accumulating Myosin II as they develop.

      -The authors mention that "Intensities varied slightly between experiments due to differences in laser intensity and therefore histograms of pixel intensities were stretched" [Line828]. The method of intensity justification should be justified. For example, does this normalization result in similar cytoplasmic myosin intensity between control and twist mutant embryos?

      • *

      As stated above, we stretched the intensity histogram of images to enable meaningful comparison of intensities between different movies, as stretching the histograms would bring Myosin II structures of similar intensities into the same pixel value range. We chose to stretch histograms using a reference timepoint (30 minutes, the latest timepoint analyzed), rather than on a per timepoint basis, because we saw a general increase in Myosin II over time, and we wanted to ensure that this increase was preserved in our analysis.

      • *

      Note that we quantify Myosin from 2 µm above to 2 µm below the level of the adherens junctions (see Methods), not throughout the entire cell, and therefore we have no true measure of cytoplasmic Myosin. However, we can plot non-membrane Myosin from this same apicobasal position in the cell. Non-membrane Myosin will include both the cytoplasmic signal and the Myosin II medial web (see above). When plotting these, we find that Myosin II intensities in this pool are similar in wildtype and twist (see graph below, dotted lines show standard deviations), confirming that that we are not inappropriately brightening one set of images compared to the other (e.g., twist versus wildtype).

      Finally, our observations of rate of junction shrinkage and intercalation are consistent with our Myosin II quantification results (see Figures 4A, 4D and 6F). This further validates our methods.

      • *

      • *

      - A previous study demonstrates that the accumulation of junctional myosin is substantially reduced in twist mutant embryos compared to the wild type (Gustafson et al., 2022). In that work, junctional myosin was quantified as (I_junction - I_cytoplasm)/I_cytoplasm. In contrast, the cytoplasmic myosin intensity does not appear to be subtracted from the quantification in this study. How much of the difference in the conclusions of the two studies can be explained by this difference in myosin quantification?

              As explained above, we choose to normalize our data by stretching histograms, rather than subtracting and dividing intensities between different pools of Myosin. The setting pixels of intensities up to 5 percentiles set to zero for each will have a similar effect to subtracting a small fraction of the cytoplasmic pool. We note that the intensity measurements in (Gustafson et al., 2022) are in the apical-top 5µm of the cell, and therefore their ‘cytoplasmic’ signal is likely to also include the apical medial web of Myosin. Also, after subtraction they use division by the cytoplasmic intensity in an attempt to bring pixel intensities between different movies into a comparable range, whereas we do this by stretching the histograms themselves (see above).  We carefully designed our method to preserve the increase in Myosin levels that we see over time in our post-normalization data. This is something that their method of normalization would not be predicted to capture, if their ‘cytoplasmic’ signal increase over time as well as their junctional signal.  Indeed, in FigS6D of their paper, Myosin II levels do not appear to increase over time in these (presumably normalized) images.
      

      Additionally, we note that in (Gustafson et al., 2022), not all Myosin II is fluorescently tagged since they use a sqhGFP transgene located on the balancer chromosome. This means that the line they use will have a pool of exogeneous Myosin tagged with GFP (expressed from the CyO balancer) and a pool of endogenous Myosin (expressed from the sqh gene on the X chromosome. It is not known whether endogenous and exogeneous GFP-tagged Myosin II will be recruited equally to cell junctions when in competition with each other. Therefore, in their genetic background, the ratio of junctional/cytoplasmic sqhGFP might not reflect the true ratio. To avoid this potential caveat, in our study we have used a new knock-in of Myosin, which tags the sqh gene at the endogenous locus (Proag et al., 2019). The line is homozygous viable and thus all the molecules of Myosin II Regulatory Light Chain (encoded by sqh), and thus the Myosin II mini-filaments, are labelled with GFP.

      Additionally, we note that when comparing their images of Myosin II in wildtype and twist (Figure 5D and D’), the overall Myosin signal appears reduced in twist mutants (including in the head and posterior midgut, which is outside the area that they are claiming Myosin II is recruited in response to mesoderm invagination). This suggests that Myosin II is generally reduced in their twist mutants (or images thereof), which is not expected and might indicate issues with their methods.

      Therefore differences in the methods may explain the discrepancies between studies. Importantly, we have quantified junctional shrinkage rates and intercalation, and our analysis of these rates is consistent with our Myosin II quantification results (see above).

      -The authors used the tissue flow data to register the myosin channel and the membrane channel, which were acquired at slightly different times. The accuracy of this channel registration should be demonstrated.

      As stated in our methods: “the channel registration was corrected post-acquisition in order that information on the position of interfaces in the Gap43 channel could be used to locate them in the Myosin channel. Therefore the local flow of cell centroids between successive pairs of time frames in the Gap43 channel is used to give each interface/vertex pixel a predicted flow between frames. A fraction of this flow is applied, equal to the Myosin II to Gap43 channel time offset, divided by the frame interval. Because cells deform as well as flow, the focal cell’s cell shape strain rate is also applied, in the same fractional manner as above.”

      The images in Figure 3C and C’ show the Myosin II, with quantified membrane Myosin superimposed on the image as a color-code. Images in Figure 3B and B’ show the (normalized) Myosin II. Comparison of these images demonstrates that the channel registration is accurate. We will add a reference to these images in the methods.

      • The authors show that cell intercalation is not influenced in twist mutant embryos. However, a previous study demonstrates that the speed of GBE is substantially reduced in twist mutants (Gustafson et al., 2022). It would be interesting to see whether a similar reduction in the speed of GBE was observed in this study. *

      We do not see a reduction in the speed of GBE as reported by (Gustafson et al., 2022), we will add “tissue strain rate” graphs to demonstrate this. On the contrary, we find a slight increase in the “tissue strain rate”, because there is a slight increase in the “cell shape strain rate” contributing to extension (while “cell intercalation strain rate” is unchanged). See also response to Reviewer 1 (major comment) .

      • It has been previously shown that contractions of medioapical myosin in germband cells also contribute to cell intercalation. The authors should explain why medioapical myosin was not included in the comparison between wildtype and twist mutant embryos. *

      • *

      Indeed, it has been shown that there is a flow of medial Myosin towards the junctions (Rauzi et al., 2010). However, and as described in that paper, this flow ‘feeds’ the enrichment of Myosin II at shrinking junctions, and thus the junctional Myosin II can be taken as a readout of polarized Myosin II behavior. Additionally, medial flows are more technically challenging to quantify, especially when quantification is required in a large number of cells as is the case for our study.

      Importantly, our junctional Myosin II and junctional shrinkage rate results are consistent with each other, therefore it is very unlikely that analyzing medial Myosin II would lead us to form a different conclusion. We will add a sentence to explain why we chose to quantify junctional, and not medial, Myosin II.

      *Minor points: *

      1. * Fig. 1-S1 panel C: the number of cyan cells changes non-monotonically. It first decreases from -10 min to 10 min, then increases from 10 min to 20 min. This is confusing since in theory the number of tracked cells should not increase over time if the cells are tracked from the beginning of the movie. *
      2. *

      The cyan cells highlight tracked mesodermal and mesectodermal cells, which are not included in the analysis. The low number of mesodermal cells highlighted at 10mins germband extension is because mesodermal and mesectodermal cells are not always tracked successfully at this time. Note that the legend includes a note that ‘”Unmarked cells are poorly tracked and excluded from the analysis”. Also see Methods: “Note on number of cells in movies, for notes on changes to the number of tracked ectodermal cells throughout the timecourse of the movies.”

      • Fig. 1-S2: the vnd band in panel A appears to be much narrower than in panel B. *

      • *

      These are fixed embryos, therefore this could be (at least partially) due to slight differences in exact developmental age of the embryo. Note that we wanted to check that vnd and ind are expressed in the correct places in the ectoderm. We were motivated to check this because the width of mesoderm is reduced in twist, so we thought it was important to verify that there is not a population of ‘ectodermal’ cells with a strange fate (i.e., negative for both vnd and ind). Our experiments show that vnd abuts the mesoderm/mesectoderm in twist as in wildtype, and that the cells immediately lateral to the vnd cell population express ind as expected.

      It is possible that there is a slight difference in the number of vnd cells in twist mutants compared to wildtype, but we see no differences in Myosin II bipolarity that would coincide with the vnd/ind boundary (Fig3-S1). Therefore, this would not change the interpretation of our results. Counting the number of rows of vnd cells prior to any cell intercalation (the number of rows will reduce as cells intercalate) would be technically challenging as the lateral border of vnd expression is hard to discern at this time due to lower levels of vnd expression laterally within the vnd expression domain.

      • The schematic in Fig. 2J suggests that at the onset of mesoderm pulling the germband cells have a uniform angle of rotation (towards bottom right). Is this the case?*

      • *

      No, this schematic is purely supposed to show that as cells stretch, they also reorient. Note that we will review our schematics in Fig. 2 to increase clarity (see response to reviewer 1, first minor comment).

      • The description of myosin intensity normalization in the Methods section is somewhat difficult to follow [Line 829 - 832]. It would be helpful if the authors can show one or two images before and after intensity normalization as examples. *

      We will add some examples of before and after normalization images to this section. We will also review the Methods to improve the text’s clarity.

      • Line 704: "Z-stacks for each channel were collected sequentially" - the step size in Z-axis should be reported. *

      Thank you for this, the step size was 1µm. We will add this information.

      • Fig. 4C: what are the thin, black lines in the image? *

      This image is a 2D representation of the Gap43Cherry signal at the level of the adherens junctions extracted for tracking, not a simple confocal z-slice. When viewing these representations, you can see lines showing borders between where information from different z-stacks was used for the tracking layer. Unfortunately, our software does not allow us to remove these lines, but they do not affect tracking, quantification etc.

      Reviewer #3 (Significance (Required)):

      While most previous work on tissue mechanics and morphogenesis focuses on tissue-intrinsic mechanical input, recent studies have started to emphasize the contribution of tissue-extrinsic forces. An important challenge in understanding the function of tissue-extrinsic forces lies in the difficulties in properly comparing the wild type and the mutant samples that disrupt extrinsic forces, in particular when cell fate specification is altered in the mutants. In this work, the authors addressed this challenge by employing a number of approaches to warrant a parallel comparison between genotypes, including examining the AP- and DV-patterning of the tissue, selecting sample regions with comparable cell fate for analysis, and carefully aligning the stage of the movies. With these approaches, the authors provide compelling evidence to support their main conclusions. By teasing apart the role of the intrinsic genetic program and the extrinsic tissue forces, the work provides important clarifications on the function of mesoderm pulling in GBE and adds new insights into this well-studied tissue morphogenetic process. This work should be of interest to the broad audience of epithelial morphogenesis, tissue mechanics and myosin mechanobiology.

      • *

      Review____er #4 (Evidence, reproducibility and clarity (Required)):

      *Lye and colleagues investigate the impact of tissue-tissue interactions on morphogenesis. Specifically, they ask how disrupting mesoderm internalization affects convergence and extension of the ectoderm (germband) in Drosophila embryos. Using twi mutants in which mesoderm invagination fails, the authors find that the invagination of the mesoderm deforms germband cells, but does not significantly contribute to patterning, cell alignment, myosin polarization and cell-cell contact disassembly (which drive germband convergence). The authors find modest effects of mesoderm invagination on new junction formation and orientation (which drive extension), but these changes do not have a significant effect on germband elongation. The authors conclude that germband extension is robust to external forces from the invagination of the mesoderm. *

      *MAIN 1. The authors clearly show that myosin density is not different in wild-type and twi mutant embryos, and subsequently argue that the pulling force from the mesoderm does not elicit a mechanosensitive response in early germband extension. But if the cell density is constant, doesn't that mean that the longer, DV-oriented interfaces in the wild type accumulate more total myosin than their shorter counterparts in twi mutants? Assuming that the total number of myosin molecules per cell is not greater in the wild type, wouldn't increased total myosin at the membrane suggest a response to the increased deformation? Certainly the cells are able to maintain the same cell density despite the pulling force from the mesoderm, so can the authors rule out a mechanosensing mechanism? *

      • *

      We do not rule out a mechanosensing mechanism. We agree the total Myosin at stretched interfaces is higher than at unstretched interfaces and proposed a homeostatic mechanism to maintain Myosin II density on the cortex upon rapid stretching (summarized in Fig. 7). Indeed it is possible that this mechanism could itself be due to mechanosensitive recruitment of Myosin II (though there are also other possibilities). We have tried to address this in our discussion (under “Mechanisms regulating Myosin II density at the cortex and consequences for cell intercalation” and “Restoration of DV cell length after being stretched by mesoderm invagination”), but we will amend the wording the make the possibility of mechanosensitive recruitment of Myosin II to maintain cortical density more explicit.

      *What happens to the Gap43mCherry signal? From Figure 2A, it seem to be diluted ventrally in the wild type as compared to twi mutants? Comparing myosin and Gap43 dynamics may shed light on whether myosin accumulates more or less than one would expect simply on the basis of having longer contacts. *

      We quantify the density of Myosin, rather than the total amount. Therefore, the length of the contact should not matter. The suggestion of comparing Myosin density to Gap43Cherry density is in principle a good one, as it would allow us to compare a protein which is not diluted as cell contact length increases (Myosin) to one which appears to be (Gap43). However, it is not essential for the conclusions that we make. However, in practice quantifying the Gap43Cherry signal would not be straightforward on our existing movies due to the imaging parameters used. We capture the Gap43Cherry channel (but not the Myosin channel) with a ‘spot noise reducer’ tuned on in the camera software, due to very occasional bright spot noise, which confuses the tracking software. Therefore, our Gap43Cherry signal is manipulated during acquisition and to quantify from these images would not be appropriate. Therefore, we would have to acquire, track and quantify some new movies, which is not possible within the timeframe of a revision.

      In summary, we think that we have sufficient evidence from our analysis that Myosin II is not diluted upon junctional stretching without comparing to quantification of Gap43Cherry, and the time investment required to quantify the Gap43Cherry would not be worthwhile as it would require more data to be acquired and processed.

      • The authors previously argued that mesoderm invagination was required for the fast phase of cell intercalation [Butler et al., 2009]. However, here the authors interpret that loss of twi does not significantly slow down interface contraction, but accelerates the elongation of junctions and cells along the AP axis, which overall would mean that mesoderm invagination is (slightly) detrimental for axis elongation. The discrepancy between their previous and current results should be discussed. *

      We are happy to add more information about these discrepancies in the discussion. In a nutshell, we think that these discrepancies arise from the challenges of comparing wildtype and twist mutant embryos relative to each other, and as a consequence we have made various improvements to our methods since (Butler et al., 2009). These improvements included using markers that would be expressed at the same levels in wildtype and twist embryos. Additionally, we did not use overexpressed cadherin-FPs (namely, the ubi-CadGFP transgene), which may have confounding effects, and we used a knock-in sqhGFP to ensure we could all Myosin II molecules were labelled by GFP. We also carefully controlled the temperature at which we acquired the movies, standardized the level at which to track cells and quantify Myosin between movies, as well as improving the accuracy of our image segmentation and cell type identification since our previous study (Butler et al., 2009). See also response to reviewer 2.

      • Related to the previous point, it is surprising that the differences shown in Figure 4A-B are not significant. This is particularly troubling when in Figure 5B the authors claim a significant difference in cell elongation rate, which is higher in twi mutants (but only in very short time intervals and actually switches sign at the end of germband extension). These are just two examples, but I think the analysis of significance on a per-time point basis is problematic. *

      *Have the authors considered analyzing their results as time series rather than comparing individual time points? Or perhaps integrating the different metrics over the duration of germband extension (e.g. using areas under the curve)? That way they would not have to arbitrarily decide if significant differences in a few time points should or not be interpreted as significant overall differences. *

      • *

      For graphs plotted against time of germband extension, we do not think it is appropriate to analyze as a time series rather than comparing individual time points, since different developmental events (such as mesoderm invagination) occur at different times. For graphs plotted against time to/from cell neighbor swap, these can also change over time (e.g., ctrd-ctrd orientation, Fig6D). Therefore we do not feel that it appropriate to run statistical analyses as a timeseries for these comparisons either. Statistically cut-offs are by their nature arbitrary. We have tried to highlight non-significant trends throughout the text (including for Fig4A&B), in addition to stating where we see significant differences to highlight where there may be minor (but not significant) differences.


      • While the number of cells analyzed is impressive, the number of embryos is relatively low, particularly for the wild type (only four embryos analyzed). If I understood correctly (if not, please clarify) the authors ran their statistics using cells and not embryos as their measurement unit. But I could not find any evidence that cells from the same embryo can be considered as independent measurements. This could be easily done by demonstrating that the variance of any of the measurements (e.g. elongation, area change rate, etc.) for cells in an embryo is comparable to that calculated when mixing cells from different embryos. *

      • *

      We do not simply use the number of cells as an n for our experiments. We use a mixed effects model for our statistics as previously (Butler et al., 2009; Finegan et al., 2019; Lye et al., 2015; Sharrock et al., 2022; Tetley et al., 2016). This estimates the P value associated with a fixed effect of differences between genotypes, allowing for random effects contributed by differences between embryos within a given genotype. We will make sure that this is clear in the Methods.

      MINOR 1. Figure 4D: the authors show no difference in the proportion of neighbor swaps per minute between wild-type and twi- mutant embryos. But how about the absolute number of neighbour swaps per minute? Does that change in twi mutants (and if so, why?).

      The number of interfaces involved in a T1 swap are expressed as a proportion of the total number of DV-oriented interfaces for all tracked ectodermal germband cells, to take account of differences in the number of tracked cells between different timepoints and different movies. Presenting the absolute number of swaps per minute could lead to misleading interpretations.

      • I was a bit confused about the reason why in Figure 4A the authors measure the rate of interface contraction in units of “proportion/min”, but in Figure 5A they measure interface elongation in units of “um/min”. Unless there is a good reason not to, these two metrics should be reported using the same units. Is there a difference in the rate of interface contraction when measured in absolute units (um/min)? *

      Thank you, we will amend so that both measures are expressed in the same units.

      • The discussion of previous work on cell deformation within the mesoderm (page 16, first paragraph) should probably include recent work from Adam Martin's lab (e.g. [Heer et al., 2017]; or [Denk-Lobnig et al., 2021]). *

      Thank you, and apologies for this oversight, we will add these references__.__

      SUGGESTIONS 1. While I appreciate the arguments that the authors provide to use twi mutants rather than sna mutants or twi sna double mutants, as the authors indicate, in twi mutants there is still contractility in the mesoderm (albeit not ratcheted). Therefore, it is possible that contractile pulses from the mesoderm in twi mutants could still facilitate cell alignment and polarization of myosin in the germband. Given the previous results from the Zallen lab using twi sna double mutants (see above) this is unlikely to be the case, but the findings in this manuscript would be significantly stronger if they included similar analysis in the double mutants.

      We had concerns about using sna or twi sna double mutants due to the large amount of space the un-internalized mesoderm takes up on the exterior of the embryo. This concern is also shared by reviewer 1 “Importantly, I think the researchers were correct in choosing to analyze twist single-mutant embryos (as opposed to snail or twist, snail double-mutant embryos), as the overall embryo geometry of these mutants is fairly similar to wild-type embryos, allowing the researchers to directly compare cell behaviors and myosin dynamics during germband extension. This approach also allows them to avoid indirect effects on the germband due to a completely non-internalized mesoderm.” * In addition to this concern, imaging of snail or twist snail* embryos by confocal imaging to include the ventral midline (which is required to define embryonic axes) is problematic as the un-constricted mesodermal cells occupy virtually all the field of view, leaving very few ectodermal cells to analyze.

      Whilst we acknowledge that there are some (un-ratcheted) contractions of mesodermal cells in twist mutants, we have clearly shown that there is no DV stretch and very little reorientation of cells. Therefore, any residual contractile activity in the mesodermal cells of twist mutants does not appear to have a mechanical impact on the ectoderm. We cannot exclude the possibility that there is some transmission of forces between contracting cells of the mesoderm and the ectoderm in twist mutants. However, our evidence suggests that the large tissue scale force that transmits to the ectoderm from the invaginating mesoderm is missing in twist mutants, and it was the effects of that force that we wished to investigate (See also response to reviewer 2).

      Review*er #4 (Significance (Required)): *

      *This is an interesting study, with careful quantitative analysis of cellular and subcellular dynamics. The results follow previous findings from Jennifer Zallen and the authors themselves. The Zallen lab showed that cell alignment, myosin polarization and germband extension are normal in sna twi mutants [Fernandez-Gonzalez et al., 2009], a result that the authors fail to cite. The results in the present manuscript are similar, but the analysis is much more in depth here, so the findings by Lye and colleagues certainly warrant publication. *

      We did not specifically cite this result from (Fernandez-Gonzalez et al., 2009), because the subject of their study is the formation of multicellular rosettes, not whether a pull from mesoderm affects Myosin II polarity and cell intercalation. The formation of multicellular rosettes occurs later in germband extension, and therefore these results are not directly relevant to our study. Additionally, their measures of alignment are defined as linkage to other approximately DV oriented interfaces, rather than directly measuring orientation compared to the embryonic axes as we do here, as a different question is being addressed. Specifically, the quoted sna twi experiment is interpreted as extrinsic forces from the mesoderm not being required for linkage of Myosin enriched DV-oriented interfaces together. Myosin II quantification is more rudimentary with edges being assigned as Myosin positive or Myosin negative, as opposed to quantifying the density of Myosin on each interface and we cannot see any comparison of Myosin II quantification between wildtype and twist embryos.­

      So, although the results are consistent with each other, they are not directly comparable due to methods used and we are happy that the reviewer acknowledges that our analysis is more in depth, which was necessary to address the specific questions that we investigate in our study.

              In general, there have been inconsistencies in results between previous studies, leading reviewer one to recognize that *“…it should be published and that it will be an impactful paper within the field. Namely, it will settle once and for all the question of whether mesoderm invagination is required for optimal germband extension in the early Drosophila embryo.”  *The high amount of conflicting information in the literature led us to not exhaustively describe individual findings, but we will ensure the results from the Zallen lab are appropriately cited.
      

      However, there are a number of experimental points that I think need to be addressed to solidify the manuscript, particularly in terms of statistical analysis.

      Please see more details above (main points 3 and 4) regarding specific concerns about experimental points and statistics. Additionally, we note that reviewer 3 states “statistics were appropriately used”, and our statistical methods are the same as we have used in previous studies comparing live imaging data (Butler et al., 2009; Finegan et al., 2019; Lye et al., 2015; Sharrock et al., 2022; Tetley et al., 2016).

      • *

      __REFERENCES

      __

      Blanchard, G. B., Kabla, A. J., Schultz, N. L., Butler, L. C., Sanson, B., Gorfinkiel, N., Mahadevan, L. and Adams, R. J. (2009). Tissue tectonics: morphogenetic strain rates, cell shape change and intercalation. Nat Methods 6, 458-464.

      Butler, L. C., Blanchard, G. B., Kabla, A. J., Lawrence, N. J., Welchman, D. P., Mahadevan, L., Adams, R. J. and Sanson, B. (2009). Cell shape changes indicate a role for extrinsic tensile forces in Drosophila germ-band extension. Nat Cell Biol 11, 859-864.

      Farrell, D. L., Weitz, O., Magnasco, M. O. and Zallen, J. A. (2017). SEGGA: a toolset for rapid automated analysis of epithelial cell polarity and dynamics. Development 144, 1725-1734.

      Fernandez-Gonzalez, R., Simoes Sde, M., Roper, J. C., Eaton, S. and Zallen, J. A. (2009). Myosin II dynamics are regulated by tension in intercalating cells. Dev Cell 17, 736-743.

      Finegan, T. M., Hervieux, N., Nestor-Bergmann, A., Fletcher, A. G., Blanchard, G. B. and Sanson, B. (2019). The tricellular vertex-specific adhesion molecule Sidekick facilitates polarised cell intercalation during Drosophila axis extension. PLoS Biol 17, e3000522.

      Gustafson, H. J., Claussen, N., De Renzis, S. and Streichan, S. J. (2022). Patterned mechanical feedback establishes a global myosin gradient. Nat Commun 13, 7050.

      Irvine, K. D. and Wieschaus, E. (1994). Cell intercalation during Drosophila germband extension and its regulation by pair-rule segmentation genes. Development 120, 827-841.

      Leptin, M. and Grunewald, B. (1990). Cell shape changes during gastrulation in Drosophila. Development 110, 73-84.

      Lye, C. M., Blanchard, G. B., Naylor, H. W., Muresan, L., Huisken, J., Adams, R. J. and Sanson, B. (2015). Mechanical Coupling between Endoderm Invagination and Axis Extension in Drosophila. PLoS Biol 13, e1002292.

      Proag, A., Monier, B. and Suzanne, M. (2019). Physical and functional cell-matrix uncoupling in a developing tissue under tension. Development 146.

      Rauzi, M., Lenne, P. F. and Lecuit, T. (2010). Planar polarized actomyosin contractile flows control epithelial junction remodelling. Nature 468, 1110-1114.

      Sharrock, T. E., Evans, J., Blanchard, G. B. and Sanson, B. (2022). Different temporal requirements for tartan and wingless in the formation of contractile interfaces at compartmental boundaries. Development 149.

      Simpson, P. (1983). Maternal-Zygotic Gene Interactions during Formation of the Dorsoventral Pattern in Drosophila Embryos. Genetics 105, 615-632.

      Tetley, R. J., Blanchard, G. B., Fletcher, A. G., Adams, R. J. and Sanson, B. (2016). Unipolar distributions of junctional Myosin II identify cell stripe boundaries that drive cell intercalation throughout Drosophila axis extension. Elife 5.

      Wang, X., Merkel, M., Sutter, L. B., Erdemci-Tandogan, G., Manning, M. L. and Kasza, K. E. (2020). Anisotropy links cell shapes to tissue flow during convergent extension. Proc Natl Acad Sci U S A 117, 13541-13551.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #4

      Evidence, reproducibility and clarity

      Lye and colleagues investigate the impact of tissue-tissue interactions on morphogenesis. Specifically, they ask how disrupting mesoderm internalization affects convergence and extension of the ectoderm (germband) in Drosophila embryos. Using twi mutants in which mesoderm invagination fails, the authors find that the invagination of the mesoderm deforms germband cells, but does not significantly contribute to patterning, cell alignment, myosin polarization and cell-cell contact disassembly (which drive germband convergence). The authors find modest effects of mesoderm invagination on new junction formation and orientation (which drive extension), but these changes do not have a significant effect on germband elongation. The authors conclude that germband extension is robust to external forces from the invagination of the mesoderm.

      Main

      1. The authors clearly show that myosin density is not different in wild-type and twi mutant embryos, and subsequently argue that the pulling force from the mesoderm does not elicit a mechanosensitive response in early germband extension. But if the cell density is constant, doesn't that mean that the longer, DV-oriented interfaces in the wild type accumulate more total myosin than their shorter counterparts in twi mutants? Assuming that the total number of myosin molecules per cell is not greater in the wild type, wouldn't increased total myosin at the membrane suggest a response to the increased deformation? Certainly the cells are able to maintain the same cell density despite the pulling force from the mesoderm, so can the authors rule out a mechanosensing mechanism? What happens to the Gap43mCherry signal? From Figure 2A, it seem to be diluted ventrally in the wild type as compared to twi mutants? Comparing myosin and Gap43 dynamics may shed light on whether myosin accumulates more or less than one would expect simply on the basis of having longer contacts.
      2. The authors previously argued that mesoderm invagination was required for the fast phase of cell intercalation [Butler et al., 2009]. However, here the authors interpret that loss of twi does not significantly slow down interface contraction, but accelerates the elongation of junctions and cells along the AP axis, which overall would mean that mesoderm invagination is (slightly) detrimental for axis elongation. The discrepancy between their previous and current results should be discussed.
      3. Related to the previous point, it is surprising that the differences shown in Figure 4A-B are not significant. This is particularly troubling when in Figure 5B the authors claim a significant difference in cell elongation rate, which is higher in twi mutants (but only in very short time intervals and actually switches sign at the end of germband extension). These are just two examples, but I think the analysis of significance on a per-time point basis is problematic. Have the authors considered analyzing their results as time series rather than comparing individual time points? Or perhaps integrating the different metrics over the duration of germband extension (e.g. using areas under the curve)? That way they would not have to arbitrarily decide if significant differences in a few time points should or not be interpreted as significant overall differences.
      4. While the number of cells analyzed is impressive, the number of embryos is relatively low, particularly for the wild type (only four embryos analyzed). If I understood correctly (if not, please clarify) the authors ran their statistics using cells and not embryos as their measurement unit. But I could not find any evidence that cells from the same embryo can be considered as independent measurements. This could be easily done by demonstrating that the variance of any of the measurements (e.g. elongation, area change rate, etc.) for cells in an embryo is comparable to that calculated when mixing cells from different embryos.

      Minor

      1. Figure 4D: the authors show no difference in the proportion of neighbor swaps per minute between wild-type and twi-mutant embryos. But how about the absolute number of neighbour swaps per minute? Does that change in twi mutants (and if so, why?).
      2. I was a bit confused about the reason why in Figure 4A the authors measure the rate of interface contraction in units of "proportion/min", but in Figure 5A they measure interface elongation in units of "um/min". Unless there is a good reason not to, these two metrics should be reported using the same units. Is there a difference in the rate of interface contraction when measured in absolute units (um/min)?
      3. The discussion of previous work on cell deformation within the mesoderm (page 16, first paragraph) should probably include recent work from Adam Martin's lab (e.g. [Heer et al., 2017]; or [Denk-Lobnig et al., 2021]).

      Suggestions

      1. While I appreciate the arguments that the authors provide to use twi mutants rather than sna mutants or twi sna double mutants, as the authors indicate, in twi mutants there is still contractility in the mesoderm (albeit not ratcheted). Therefore, it is possible that contractile pulses from the mesoderm in twi mutants could still facilitate cell alignment and polarization of myosin in the germband. Given the previous results from the Zallen lab using twi sna double mutants (see above) this is unlikely to be the case, but the findings in this manuscript would be significantly stronger if they included similar analysis in the double mutants.

      Significance

      This is an interesting study, with careful quantitative analysis of cellular and subcellular dynamics. The results follow previous findings from Jennifer Zallen and the authors themselves. The Zallen lab showed that cell alignment, myosin polarization and germband extension are normal in sna twi mutants [Fernandez-Gonzalez et al., 2009], a result that the authors fail to cite. The results in the present manuscript are similar, but the analysis is much more in depth here, so the findings by Lye and colleagues certainly warrant publication. However, there are a number of experimental points that I think need to be addressed to solidify the manuscript, particularly in terms of statistical analysis.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      During morphogenesis, the final shape of the tissue is not only dictated by mechanical forces generated within the tissue but can also be impacted by mechanical contributions from surrounding tissues. The way and extent to which tissue deformation is influenced by tissue-extrinsic forces are not well understood. In this work, Lye et al. investigated the potential influence of Drosophila mesoderm invagination on germband extension (GBE), an epithelial convergent extension process occurring during gastrulation. Drosophila GBE is genetically controlled by the AP patterning system, which determines planar polarized enrichment of non-muscle myosin II along the DV-oriented adherens junctions. Myosin contractions drive shrinking of DV-oriented junctions into 4-way vertices, followed by formation of new, AP-oriented junctions. This process results in cell intercalation, which causes tissue convergence along the DV-axis and extension along the AP-axis. In addition, GBE is facilitated by tissue-extrinsic pulling forces produced by invagination of the posterior endoderm. Interestingly, some recent studies suggest that the invagination of the mesoderm, which occurs immediately prior to GBE, also facilitates GBE. In the proposed mechanism, invaginating mesoderm pulls on the germband tissue along the DV-axis; the resulting strain of the germband cells generates a mechanotransduction effect that promotes myosin II recruitment to the DV-oriented junctions, thereby facilitating cell intercalation. Here, the authors revisited this proposed mechanotransduction effect using quantitative live imaging approaches. By comparing the wildtype embryos with twist mutants that fail to undergo mesoderm invagination, the authors show that although the DV-oriented strain of the germband cells was greatly reduced in the absence of mesoderm pulling, this defect had a negligible impact on junctional myosin density, myosin planar polarity, the rate of junction shrinkage or the rate of cell intercalation during GBE. A mild increase in the rate of new junction extension and a slight defect in cell orientation were observed in twist mutants, but these differences did not cause obvious defects in cell intercalation. The authors conclude that myosin II-mediated cell intercalation during GBE is robust to the extrinsic mechanical forces generated by mesoderm pulling.

      Overall, I found that the results described here are very interesting and of high quality. The data acquisition and analyses were elegantly performed, statistics were appropriately used, and the manuscript was clearly written. However, there are a few points where some further explanation or clarification is necessary, as detailed below:

      1. The main conclusion of the manuscript relies on appropriate quantification of myosin intensity at cell junctions. It is therefore important that the methods of quantification are well justified. Below are a few questions regarding the methods used in the analyses:
        • For myosin quantification, the authors state that "Background signal was subtracted by setting pixels of intensities up to 5 percentile set to zero for each timepoint" [Line826]. The rationale for selecting 5 percentile as the threshold for background should be explained. Also, how does this background value change over time?
        • The authors mention that "Intensities varied slightly between experiments due to differences in laser intensity and therefore histograms of pixel intensities were stretched" [Line828]. The method of intensity justification should be justified. For example, does this normalization result in similar cytoplasmic myosin intensity between control and twist mutant embryos?
        • A previous study demonstrates that the accumulation of junctional myosin is substantially reduced in twist mutant embryos compared to the wild type (Gustafson et al., 2022). In that work, junctional myosin was quantified as (I_junction - I_cytoplasm)/I_cytoplasm. In contrast, the cytoplasmic myosin intensity does not appear to be subtracted from the quantification in this study. How much of the difference in the conclusions of the two studies can be explained by this difference in myosin quantification?
        • The authors used the tissue flow data to register the myosin channel and the membrane channel, which were acquired at slightly different times. The accuracy of this channel registration should be demonstrated.
      2. The authors show that cell intercalation is not influenced in twist mutant embryos. However, a previous study demonstrates that the speed of GBE is substantially reduced in twist mutants (Gustafson et al., 2022). It would be interesting to see whether a similar reduction in the speed of GBE was observed in this study.
      3. It has been previously shown that contractions of medioapical myosin in germband cells also contribute to cell intercalation. The authors should explain why medioapical myosin was not included in the comparison between wildtype and twist mutant embryos.

      Minor points:

      1. Fig. 1-S1 panel C: the number of cyan cells changes non-monotonically. It first decreases from -10 min to 10 min, then increases from 10 min to 20 min. This is confusing since in theory the number of tracked cells should not increase over time if the cells are tracked from the beginning of the movie.
      2. Fig. 1-S2: the vnd band in panel A appears to be much narrower than in panel B.
      3. The schematic in Fig. 2J suggests that at the onset of mesoderm pulling the germband cells have a uniform angle of rotation (towards bottom right). Is this the case?
      4. The description of myosin intensity normalization in the Methods section is somewhat difficult to follow [Line 829 - 832]. It would be helpful if the authors can show one or two images before and after intensity normalization as examples.
      5. Line 704: "Z-stacks for each channel were collected sequentially" - the step size in Z-axis should be reported.
      6. Fig. 4C: what are the thin, black lines in the image?

      Significance

      While most previous work on tissue mechanics and morphogenesis focuses on tissue-intrinsic mechanical input, recent studies have started to emphasize the contribution of tissue-extrinsic forces. An important challenge in understanding the function of tissue-extrinsic forces lies in the difficulties in properly comparing the wild type and the mutant samples that disrupt extrinsic forces, in particular when cell fate specification is altered in the mutants. In this work, the authors addressed this challenge by employing a number of approaches to warrant a parallel comparison between genotypes, including examining the AP- and DV-patterning of the tissue, selecting sample regions with comparable cell fate for analysis, and carefully aligning the stage of the movies. With these approaches, the authors provide compelling evidence to support their main conclusions. By teasing apart the role of the intrinsic genetic program and the extrinsic tissue forces, the work provides important clarifications on the function of mesoderm pulling in GBE and adds new insights into this well-studied tissue morphogenetic process. This work should be of interest to the broad audience of epithelial morphogenesis, tissue mechanics and myosin mechanobiology.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      In the present manuscript, Lye et al. describe a highly detailed quantification of cell shape changes during germband extension in Drosophila melanogaster early embryo. During this process, ectodermal tissue contracts along the dorso-ventral axis, simultaneously expanding along the perpendicular antero-posterior direction, migrating from the ventral to the dorsal surface of the embryo as it extends. This important morphogenetic event is preceded by ventral furrow formation when mesodermal tissue (located in the ventral part of the embryo) contracts along the dorso-ventral axis and invaginates into the embryonic interior. The study compares cell shape dynamics in the wildtype Drosophila with that in the twist mutant, which largely lacks mesoderm and does not form ventral furrow. The major motivation of the study is to examine whether cellular behaviors and myosin recruitment in the ectoderm is cell autonomous, or if those cellular behaviors depend on mechanical interactions between mesoderm and ectoderm. The authors first examine whether transcriptional patterning of key genes involved in germband extension is different between the wildtype and the twist mutant and find no significant difference. Next, the authors thoroughly quantify cellular behaviors and patterns of myosin recruitment in the two genetic backgrounds. A number of different measures are investigated, notably the rate of change in the degree of cellular asymmetry, rate of cell area change, rate of change of cell orientation, differences in myosin recruitment to cell edges of various orientation, as well as the rates of growth, shrinkage, and re-orientation of the various cellular interfaces. It is thoroughly documented how these quantities change as a function of developmental timing and spatial position within the embryo. These data serve basis for quantitative comparison between cellular dynamics in the two genetic backgrounds considered. Overall, the study shows that cellular behaviors observed in the ectoderm are largely the same during the period of time following ventral furrow formation, as would be expected if those cellular behaviors were predominantly cell autonomous and not dependent on stresses generated in the mesoderm.

      The data presented in the manuscript are of excellent quality and presentation is very clear.

      Minor comments: none

      Significance

      I find that the study provides a thorough quantification of cell behaviors in a widely studied important model of morphogenesis. The work may be of particular interest for future model-to-data comparison, perhaps providing a basis for future modeling work. I therefore certainly think that this work warrants publication. However, the results of the study largely parallel previous findings and do not appear novel or surprising. It is well established that in snail mutant that lack mesoderm entirely, germband extension proceeds largely normally. This well-established fact suggests that since tissue dynamics in complete absence of mesoderm are largely unaffected, behaviors of individual cells are likely to not be affected either. The work is pretty much entirely observational, and for most part provides a more detailed documentation/quantification of previous findings. I do not think it is appropriate for high profile publication.

    5. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary: In this manuscript by the Sanson group, Lye and colleagues try to definitively answer the question of whether pulling forces from the ventral mesoderm have significant effects on convergent extension in the Drosophila germband (germband extension). While germband extension does occur in mutant embryos lacking mesoderm invagination, it has long been an open question in the field as to whether ventral pulling forces from the mesoderm have significant effects (positive or negative) on cell intercalation during germband extension. To definitely address this question, Lye and colleagues generated high-quality, directly comparable datasets from wild-type and twist mutant embryos, and then systematically assessed nearly all aspects of cell intercalation, myosin recruitment, and tissue elongation over time. They demonstrate that pulling forces from the ventral mesoderm have negligible impacts on the course of germband extension. While there are indeed some interesting differences between wild-type and twist embryos with respect to cell intercalation and myosin recruitment, such differences are relatively minor. They conclude that the events of germband extension neither require nor are strongly affected by external forces from the mesoderm. While this is largely a negative results paper, I believe that it should be published and that it will be an impactful paper within the field. Namely, it will settle once and for all the question of whether mesoderm invagination is required for optimal germband extension in the early Drosophila embryo, and it suggests that tissues are largely autonomous developmental units that are buffered from outside mechanical inputs.

      Major comments:

      It seems to me that the one obvious omission from this paper is a general measure of convergent extension over time. I think it would be useful to the reader to include some measure of change in tissue aspect ratio over time between wild-type and twist embryos. This could be included in Figure 5 or 6.

      Otherwise, I have no major comments on the experimental approach or the findings of this manuscript. It seems to me a straightforward and systematic approach for determining whether mesoderm invagination affects germband extension. I do have several minor comments that should be addressed prior to publication (below).

      Minor comments:

      I understand why cells would initially stretch more along the DV axis in wild-type embryos compared with twist embryos, but why do cells become so much more stretched along the AP axis (and become smaller apically) after 10 minutes of GBE in wild type compared with twist (Figure 2C and E). I think this is an interesting and non-intuitive result that would warrant a bit of explanation/conjecture.

      I don't understand how you are defining cell orientation in Figure 2G. How are you choosing the cell axis that you are then comparing with the body axis? Is it the long axis, or something more complicated than that? I think you should briefly provide this information in the results section. If it is included in the methods, I wasn't able to locate it.

      Figure 2: Since you have the space, it might help the reader if you simply wrote out "strain rate" for panels B, D, and F, rather that used the abbreviation "SR."

      Please ensure that all axis labels are fully visible in the final figures. In several figures, the Y-axis labels were cut off (e.g., Fig 2I, 4A, 4D, 6B, 6C).

      Where space permits, I would suggest using fewer abbreviations in axis labels to increase readability of the figures (e.g., in Figures 3H or 4D).

      In Figure 7, I would move the wild-type panels to the left and the twist panels to the right. I think it is more conventional to describe the normal wild-type scenarios first, and then contrast the mutant state.

      To be consistent with the literature, "wildtype" should be hyphenated (wild-type) when used as an adjective, or two separate words (wild type) when used as a noun.

      Significance

      Advance: The advances in this manuscript are largely methodological, but the experiments and analyses are quite rigorous and allow the authors to make strong conclusions concerning their hypotheses. Their findings are based on a high-quality collection of movies from control and twist mutant embryos expressing a cell membrane marker and knock-in GFP-tagged myosin. Importantly, I think the researchers were correct in choosing to analyze twist single-mutant embryos (as opposed to snail or twist, snail double-mutant embryos), as the overall embryo geometry of these mutants is fairly similar to wild-type embryos, allowing the researchers to directly compare cell behaviors and myosin dynamics during germband extension. This approach also allows them to avoid indirect effects on the germband due to a completely non-internalized mesoderm.

      Audience: The primary audience for this article will be basic science researchers working in the early Drosophila embryo who are interested in the interplay between the germband and neighboring tissues. Secondary audiences will include developmental biologists more broadly who are interested in biomechanical coupling (or in this case decoupling) of neighboring tissues.

      Describe your expertise: I have been a Drosophila developmental geneticist for over twenty years, and I have been working directly on Drosophila germband extension for over a decade. I have published numerous papers and reviews in this field, and I am very familiar with the genetic backgrounds and types of experimental analyses used in this manuscript. Therefore, I believe I am highly qualified to serve as a reviewer for this manuscript.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      1. General Statements

      We thank the editors for sending our manuscript for peer review and the reviewers for careful reading and their critical comments to improve the manuscript. Below, we describe the experiments that have been carried out in response to the reviewers and incorporated in the preliminary revision. We also describe our plan for the revisions that will address the remaining comments of the reviewers. Most of the comments are addressable with additional experiments (some of which are already ongoing) and these experiments will surely strengthen the study reported in this manuscript without affecting the fundamental findings. We would require up to 4-6 weeks to complete these experiments.

      2. Description of the planned revisions

      Insert here a point-by-point reply that explains what revisions, additional experimentations and analyses are planned to address the points raised by the referees.

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      ­Summary: The authors used a conditional transgenic mouse model to demonstrate that deletion of serum response factor (SRF) from adult astrocytes provides neuroprotection in various insult/ diseases contexts without promoting any obvious phenotypic deficiencies. The work builds on the group’s previous study where SRF was embryonically deleted from astrocytes and their precursor cells. Given the role of SRF in promoting glial cell differentiation, the adult conditional KO used in the current study was designed to circumvent the limitations of the previous approach. The authors used a variety of complementary approaches (including immunohistochemistry, electrophysiology, transcriptomics, and behavior) to demonstrate the therapeutic potential of their approach. However, I have questions regarding the validity of the behavioral analyses as well as some of the imaging results that dampen my overall enthusiasm.

      Major Comment #1

      The synaptogenic factors probed in Figure 3C (e.g. glypicans, thrombospondins, etc.) are not likely to play major roles in the adult brain in a non-injury context, so I do not know that these analyses provide any significant insight into potential functional changes in the mutant mice. Along the same lines, the analysis of synapse count (Figure 3D-E) seems inconsequential given that SRF was knocked out well after the period of developmental synaptogenesis. It would have been much more interesting to have performed these analyses following insult (such as the kainate injury model used by the authors) or in one of the disease models presented later in the manuscript. As it stands, I don't think they add very much to the study.

      Response: We are grateful to the reviewer for the careful reading of the manuscript. Astrocytes are known to regulate the formation, maintenance, and elimination of synapses. It has been previously shown that LPS-induced reactive astrocytes exhibit reduced expression of several synaptogenic factors, were unable to promote synapse formation and showed reduced phagocytic activity (PMID: 28099414). We wanted to determine whether the SRF-deficient reactive-like astrocytes were likely compromised in their ability to produce pro-synaptogenic factors and/or adversely affect synapse maintenance. We agree with the reviewer that analysis of synapses in the adult brain may not address the role of these mutant astrocytes in synaptogenesis. But our results indicate that the mutant astrocytes are likely not affecting synapse maintenance or exhibit altered phagocytotic activity that would result in increased or decreased synapse numbers. We will make this clearer in the revised manuscript.

      Minor Comment #2:

      The authors should note that the use of GluA1 as a postsynaptic marker will not identify silent synapses (i.e. structurally "normal" but functionally inert).

      Response: We agree with the reviewer that GluA1 will not identify silent synapses. To study silent vs functional synapses, we will stain for Piccolo (presynaptic) and NMDA receptor NR1 subunit (post-synaptic) to label all synapses and compare this with Piccolo/GluA1 co-localized synapses to identify the functional synapses.

      Reviewer #2 (Significance (Required):

      The manuscript addresses the important area of the cellular mechanisms that underlie neuroprotection. The ms adds to our understanding of genetic control of neuroprotection and should be of significant interest to others in the field. The experimental approach systematic and the data presented are generally of high quality and believable. While the ms presents quite a bit of overall cellular data that underlies various areas of neuronal and brain function that may be affected by loss of SRF, it is still somewhat descriptive. It is unclear what aspect of astrocyte reactivity is determinative, how mechanistically in normal cells SRF suppresses reactivity, and how SRF -negative reactive astrocytes confer such broad neuroprotection. While the latter is well beyond the scope of this study, the authors do propose SRF may be involved in regulating oxidative stress and amyloid plaque clearance as a potential pathway to account for SRF's role, however a more systematic discussion based on the gene expression data and known pathways would be welcome. Overall, this is a high quality ms that should be of interest to the field that identifies a SRF as a novel player in neuroprotection.

      Response: We thank the reviewer for the careful reading of the manuscript and for the positive comments. We will include a more detailed discussion on the genes and pathways based on our gene expression data that may provide insights into how SRF may regulate astrocyte reactivity and neuroprotection.

      Additional considerations:

      1. Quantification of the extent of SRF loss in astrocytes in conditional tamoxifen knockout would strengthen the quality of the data.

      Response: We will provide this data in the revised manuscript.

      While the authos did use a Sholl analysis to show hypertophic changes in SRF negative astrocytes, given that SRF is an important regulator of actin and other cytoskeletal related proteins in other cell types, and that cytoskeletal components can play an important role in cell signaling, it is somewhat surprising that the gene array analysis did not include actin and other cytoskeletal proteins, nor did the authors consider a more careful analysis of intracellular cytoskeletal changes and the potential mechanistic implications of this for observed reactivity and neuroprotection.

      Response: We agree with the reviewer that SRF is a well-established regulator of actin cytoskeleton. However, we did not any significant changes in gene expression for actin or actin-regulatory proteins. We would have expected a decrease in astrocyte morphology similar to the neurite/axon defects exhibited by SRF-deficient neurons. It is unclear whether the hypertrophic morphology is due to transcriptional regulation of actin/actin-binding proteins or due to astrocyte reactivity. This would be a very interesting question and we will investigate these aspects in future studies.

      Reviewer #3 (Evidence, reproducibility and clarity (Required):

      Summary: The study by Thumu et al., suggests that astrocytic specific deletion of SRF in mice results in morphological changes in these cells that does not affect neuronal survival, synapse number, plasticity or cognition. However, in in vivo mouse models of excitotoxic damage and neurodegenerative disease, deletion of SRF reduced neurotoxicity. The authors provide sufficient evidence to suggest that astrocytic SRF contributes to neurotoxicity in various models however some claims are made that are currently not supported by evidence.

      Major comments:

      2) The authors claim that SRF KO astrocytes undergo hypertrophy. However, the quantification of the number of intersections gives information about morphology rather than hypertrophy. Quantification of cell size (area of S100B staining) should be provided.

      Response: We will provide the data suggested by the reviewer.

      6) For the RNAseq of isolated astrocytes did the authors confirm that other cell types (e.g microglia) did not contaminate their samples?

      Response: We will provide the information requested by the reviewer.

      Reviewer #3:

      Minor comments:

      1) The authors say that in Figure 1B many astrocytes did not show any SRF expression. However, overall averages of SRF intensity are plotted in Figure 1C. It would support their claim to instead to calculate the percentage of SRF expressing cells above a certain threshold in each condition, rather than plotting the mean intensity. As a control for their method of quantifying SRF intensity in Figure 1B, demonstrating no change in SRF in neurons would provide confidence for the specificity of the knockout.

      Response: We will provide the quantification of the extent of SRF loss in astrocytes (percent astrocytes that are deleted for SRF) as suggested by Reviewer 2. We will also provide SRF intensity from neurons as suggested by the reviewer.

      2) The authors use the term "reactivation" throughout the manuscript. This could be misconstrued as re-activation and so I would suggest using the terms "reactivity" or "reactive transformation". Furthermore, only one region is quantified in Figure 1C while in later figures multiple regions are quantified. The authors should justify this decision or update the figures with data from missing regions.

      Response: We will make this change in using the term “reactivity” as suggested by the reviewer.

      3) In Figure S2 the authors should provide a positive control for their staining.

      Response: We will provide the positive control data for this experiment.

      4) Can the authors explain the large amount of variability in number of synapses in 15 mpi in Figure 3E?

      Response: We will perform more immunostainings and update the data presented in this figure.

      5) Images in Figure 2C are poorly visible and should be improved in terms of either quality or magnification.

      Response: We will provide better quality image for Figure 2C.

      8) The authors should provide a list of differentially expressed genes from RNAseq of SRF KO mice. No information is currently given in the text about the number of differentially expressed genes in the conditional knockout.

      Response: We will include this information in the revised manuscript.

      9) In figure 5A data would be better illustrated as a volcano plot (similar to Fig. S7C).

      Response: We will provide this in the revised manuscript.

      3. Description of the revisions that have already been incorporated in the transferred manuscript

      Please insert a point-by-point reply describing the revisions that were already carried out and included in the transferred manuscript. If no revisions have been carried out yet, please leave this section empty.

      Reviewer #1: Major Comment #2

      There is considerable variability in the behavioral results, particularly the fear conditioning and Barnes maze tasks (Figures 4F-G). Given the extremely low sample size for mouse behavior (n=5 in on group, n=7 in the other), it is highly likely that the behavioral tests were done with a single cohort of animals (which would be far from ideal) and that these experiments are significantly underpowered. Furthermore, it does not appear that the fear conditioning task was properly optimized. For example, in the control mice in context A, there were two animals that were at or very close to 0 percent freezing; these were likely outliers, or even an indication that the foot shock conditioning protocol was not working as it should. The highest percent freezing of either group was ~70%, which would have been an ideal starting place as an average for the control group. In addition, sex of the animals was not reported for these experiments. If the authors combined sexes as they did in other analyses in this paper, it is possible that they missed reaching the appropriate reaction threshold for the foot shock for some of the animals, as sex differences have previously been demonstrated in mice (DOI: 10.1037/bne0000248). Given the age at which the animals are assessed with these tasks, these specific revisions would require greater than 6 months to complete. However, as currently presented, there simply are not enough data points to make any conclusions regarding behavior.

      Response: We have performed the behavioural experiments with an additional cohort of animals for both control and mutant groups and reanalysed the data. We now have n=11 for control and n=9 for mutant group. Only males were used for the behaviour experiments, and we do not see any significant difference in behaviour between the two groups. These results are included in revised Figure 4E-G in the Preliminary Revision of the manuscript. However, we are waiting to perform the remote recall memory for the fear conditioning experiment and will include this date in the revised manuscript.

      Minor Comment #1:

      The representative GFAP images (Figure 1 E/G) do not appear to have been taken at the same magnification. This was particularly apparent in the comparison between the control and CKO hippocampus at 12mpi. It is difficult to say with certainty, due to the lack of fiducial markers in many of the images. Inclusion of a nuclear stain (DAPI) would be highly beneficial to allow the reader to make a more informed comparison.

      Response: These images were taken at the same magnification. We have included the DAPI staining for these images in Suppl. Figure 2 in the Preliminary Revision of the manuscript.

      **Referees cross-commenting**

      After reading the comments of the other reviewer, I think we're in agreement that the cellular and molecular data, while descriptive, is of mostly excellent quality. Moreover, the significance of the study is high, and the potential readership broad. However, I stand by my initial assessment of the behavioral data and find the manuscript quite lacking in this regard. Proper revisions would take at least half a year or more, so the authors may be disinclined to go this route. That being said, if the behavioral data were to be excised, I would be happy to sign off on the rest of the manuscript provided that the other major criticisms are addressed.

      Response: We thank the reviewer for the appreciation of our work. We have increased the number of animals in the behavioural experiments and do not see any significant difference between the two groups. These results are included in revised Figure 4E-G in the Preliminary Revision of the manuscript.

      In response cross-comment of Rev 2:

      Agreed that if properly conducted and presented, the behavioral data would indeed provide a nice functional correlate to the cellular work. In its current state, I'm afraid that it is instead a hindrance to the study and I would recommend that they just remove it if they choose not to address my concerns with the quality (particularly the extreme variability and the complete lack of freezing by several of the animals, especially in the controls).

      Response: We hope that the revised behaviour data would provide a strong functional correlate to the other findings in the study.

      Additional cross-comments:

      I agree with the added criticisms raised by Reviewer #3, and I think that the manuscript would be greatly improved by revisions that address those and the original criticisms from myself and Reviewer #2. I still think that the behavioral data should be omitted, provided that the authors are not capable or willing to appropriately address those concerns within a reasonable time frame.

      Response: We will address all the concerns raised by the reviewers with the required experiments to further strengthen the findings in this study.

      Reviewer #3

      Major Comment

      3) In Figure S1 the authors provide evidence showing lack of B-gal in cell types other than astrocytes (neurons/OPCs). However, microglia are missing, which could be important as later they show that microglia undergo changes in the SRF knockout model. This staining should be provided.

      Response: We have performed double immunostaining for b-gal and IbaI and do not see any overlap between IbaI and b-gal, suggesting that there is no Cre expression in microglia. We have included this data in revised Figure S1F in the Preliminary Revision of the manuscript.

      5) The authors claim in the text that microglia have thicker processes and an amoeboid shape however no evidence of this is provided in Figure S5.

      Response: We have provided data to show larger microglia area and morphology in revised Figure S5 in the Preliminary Revision of the manuscript.

      7) In the text "Enrichment analysis of Gene Ontology terms for Biological Process (GO BP) revealed that Srf deficient astrocytes showed enrichment of pathways related to cellular response to beta amyloid and beta-amyloid clearance." This is not shown in fig 5. It would be more accurate to say that there is a downregulation of genes involved in B amyloid metabolic process.

      Response: We apologize for the omission in showing that this data was presented in Suppl. Fig. S8E. We have now indicated this in the main text.

      Minor Comments:

      4) Figure 1E is missing body weight data noted in the figure legend.

      Response: We apologize for this oversight. This data was actually included in Suppl. Figure S3E and not in Figure 1. We have made the appropriate correction to Figure legend 1.

      6) In Figure 2B figure labels are missing.

      Response: We thank the reviewer for pointing out this omission. We have added the missing labels.

      7) Details of houskeeping gene normalisation are missing from qPCR data.

      Response: We apologize for not providing this information. We have included this in the revised Methods section.

      4. Description of analyses that authors prefer not to carry out

      Please include a point-by-point response explaining why some of the requested data or additional analyses might not be necessary or cannot be provided within the scope of a revision. This can be due to time or resource limitations or in case of disagreement about the necessity of such additional data given the scope of the study. Please leave empty if not applicable.

      Reviewer #3, Major Comment 1:

      1) The title of the manuscript is "SRF-deficient astrocytes provide neuroprotection in mouse models of excitotoxicity and neurodegeneration". It would be more accurate to say that SRF is involved in neurotoxicity in these models. To make a comment on the role of SRF in neuroprotection, experiments should be performed in spinal cord injury or ischaemia, where deficiency of SRF would be hypothesised to worsen recovery.

      Response: We disagree with the reviewer with this assessment. There is no evidence to suggest that SRF is involved in neurotoxicity. What our data suggests is that SRF deficiency results in a reactive astrocyte state that is neuroprotective in these models. We hypothesize that in injury/infection/disease conditions that would result in generation of neuroprotective astrocytes, SRF expression or function may be negatively regulated. It would be interesting to see whether the SRF-deficient astrocytes alleviate or exacerbate pathology and recovery following spinal cord injury and ischaemia.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary: The study by Thumu et al., suggests that astrocytic specific deletion of SRF in mice results in morphological changes in these cells that does not affect neuronal survival, synapse number, plasticity or cognition. However, in in vivo mouse models of excitotoxic damage and neurodegenerative disease, deletion of SRF reduced neurotoxicity. The authors provide sufficient evidence to suggest that astrocytic SRF contributes to neurotoxicity in various models however some claims are made that are currently not supported by evidence.

      Major comments: The title of the manuscript is "SRF-deficient astrocytes provide neuroprotection in mouse models of excitotoxicity and neurodegeneration". It would be more accurate to say that SRF is involved in neurotoxicity in these models. To make a comment on the role of SRF in neuroprotection, experiments should be performed in spinal cord injury or ischaemia, where deficiency of SRF would be hypothesised to worsen recovery.

      The authors claim that SRF KO astrocytes undergo hypertrophy. However, the quantification of the number of intersections gives information about morphology rather than hypertrophy. Quantification of cell size (area of S100B staining) should be provided.

      In Figure S1 the authors provide evidence showing lack of B-gal in cell types other than astrocytes (neurons/OPCs). However, microglia are missing, which could be important as later they show that microglia undergo changes in the SRF knockout model. This staining should be provided.

      Can the authors explain the large amount of variability in number of synapses in 15 mpi in Figure 3E?

      The authors claim in the text that microglia have thicker processes and an amoeboid shape however no evidence of this is provided in Figure S5.

      For the RNAseq of isolated astrocytes did the authors confirm that other cell types (e.g microglia) did not contaminate their samples?

      In the text "Enrichment analysis of Gene Ontology terms for Biological Process (GO BP) revealed that Srf deficient astrocytes showed enrichment of pathways related to cellular response to betaamyloid and beta-amyloid clearance." This is not shown in fig 5. It would be more accurate to say that there is a downregulation of genes involved in B-amyloid metabolic process.

      OPTIONAL: Figure 6 would be greatly strengthened by functional in vivo experiments showing reversal of motor/ cognitive phenotypes.

      OPTIONAL: The study would be improved by isolating astrocytes from the models used in figure 6 and performing RNAseq to provide information about how SRF knockout affects astrocyte reactivity in these models.

      Minor comments: The authors say that in Figure 1B many astrocytes did not show any SRF expression. However, overall averages of SRF intensity are plotted in Figure 1C. It would support their claim to instead to calculate the percentage of SRF expressing cells above a certain threshold in each condition, rather than plotting the mean intensity. As a control for their method of quantifying SRF intensity in Figure 1B, demonstrating no change in SRF in neurons would provide confidence for the specificity of the knockout.

      The authors use the term "reactivation" throughout the manuscript. This could be misconstrued as re-activation and so I would suggest using the terms "reactivity" or "reactive transformation".

      Furthermore, only one region is quantified in Figure 1C while in later figures multiple regions are quantified. The authors should justify this decision or update the figures with data from missing regions.

      In Figure S2 the authors should provide a positive control for their staining.

      Figure 1E is missing body weight data noted in the figure legend.

      Images in Figure 2C are poorly visible and should be improved in terms of either quality or magnification.

      In Figure 2B figure labels are missing.

      Details of houskeeping gene normalisation are missing from qPCR data.

      The authors should provide a list of differentially expressed genes from RNAseq of SRF KO mice. No information is currently given in the text about the number of differentially expressed genes in the conditional knockout. In figure 5A data would be better illustrated as a volcano plot (similar to Fig. S7C).

      Significance

      The strength of the manuscript is that the authors demonstrate in more than one model that astrocyte specific knockout of SRF rescues neuronal death, implicating SRF in astrocyte mediated neurotoxicity. The limitations of the study are that the mechanism by which SRF deletion reduces excitotoxicity is not addressed and there is no supporting data beyond neuronal survival in the excitotoxicity/OHDA models or plaque density in the APP/PS1 model.

      This study adds SRF to an expanding understanding of the neurotoxic capacity of astrocytes in certain reactive states. It will be of broad interest to the astrocyte reactivity field.

      My field of expertise is in astrocyte and microglia interactions in neurodegenerative diseases.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      The manuscript, "SRF-deficient astrocytes provide neuroprotection in mouse models of excitotoxicity and neurodegeneration" by Thumu et al., describes the observation astrocyte specfic SRF deficient mice exhibit neuroprotection against a broad range of brain pathologies. The current ms follows up on previous work done by the corresponding author Ramanan and colleagues in which they showed that astrocyte-specific deletion of SRF early during mouse development resulted in persistent reactive-like astrocytes throughout the postnatal mouse brain. In the current ms the authors present data that adult astrocyte specific conditional deletion of serum response factor results in reactive-like hypertrophic astrocytes that localize throughout the mouse brain. They further show that SRF deficient astrocytes do not affect neuron survival, synapse numbers, synaptic plasticity or learning and memory. Strikingly, they further show that brains of Srf knockout mice exhibit protection against neurodegenerative disease related pathologies including induced excitotoxic cell death and that SRF-deficient astrocytes abrogate dopaminergic neuron death and reduce beta-amyloid plaques in mouse models of Parkinson's and Alzheimer's disease. Based on their results, the authors proposes that SRF is a key molecular switch for the generation of reactive astrocytes with neuroprotective functions can attenuate neuronal injury in the setting of neurodegenerative diseases.

      Referees cross-commenting

      Reviewer #1 raises an important concern regarding the quality of the behavioral studies. I would also agree that the ms is still strong and the findings are significant without them, although they do extend the functional dimensions of the overall study.

      Significance

      The manuscript addresses the important area of the cellular mechanisms that underlie neuroprotection. The ms adds to our understanding of genetic control of neuroprotection and should be of significant interest to others in the field. The experimental approach systematic and the data presented are generally of high quality and believable. While the ms presents quite a bit of overall cellular data that underlies various areas of neuronal and brain function that may be affected by loss of SRF, it is still somewhat descriptive. It is unclear what aspect of astrocyte reactivity is determinative, how mechanistically in normal cells SRF suppresses reactivity, and how SRF -negative reactive astrocytes confer such broad neuroprotection. While the latter is well beyond the scope of this study, the authors do propose SRF may be involved in regulating oxidative stress and amyloid plaque clearance as a potential pathway to account for SRF's role, however a more systematic discussion based on the gene expression data and known pathways would be welcome. Overall, this is a high quality ms that should be of interest to the field that identifies a SRF as a novel player in neuroprotection.

      Additional considerations:

      1. Quantification of the extent of SRF loss in astrocytes in conditional tamoxifen knockout would strengthen the quality of the data.
      2. While the authos did use a Sholl analysis to show hypertophic changes in SRF negative astrocytes, given that SRF is an important regulator of actin and other cytoskeletal related proteins in other cell types, and that cytoskeletal components can play an important role in cell signaling, it is somewhat surprising that the gene array analysis did not include actin and other cytoskeletal proteins, nor did the authors consider a more careful analysis of intracellular cytoskeletal changes and the potential mechanistic implications of this for observed reactivity and neuroprotection.
    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary: The authors used a conditional transgenic mouse model to demonstrate that deletion of serum response factor (SRF) from adult astrocytes provides neuroprotection in various insult/diseases contexts without promoting any obvious phenotypic deficiencies. The work builds on the group's previous study where SRF was embryonically deleted from astrocytes and their precursor cells. Given the role of SRF in promoting glial cell differentiation, the adult conditional KO used in the current study was designed to circumvent the limitations of the previous approach. The authors used a variety of complementary approaches (including immunohistochemistry, electrophysiology, transcriptomics, and behavior) to demonstrate the therapeutic potential of their approach. However, I have questions regarding the validity of the behavioral analyses as well as some of the imaging results that dampen my overall enthusiasm.

      Major Comments:

      1. The synaptogenic factors probed in Figure 3C (e.g. glypicans, thrombospondins, etc.) are not likely to play major roles in the adult brain in a non-injury context, so I do not know that these analyses provide any significant insight into potential functional changes in the mutant mice. Along the same lines, the analysis of synapse count (Figure 3D-E) seems inconsequential given that SRF was knocked out well after the period of developmental synaptogenesis. It would have been much more interesting to have performed these analyses following insult (such as the kainate injury model used by the authors) or in one of the disease models presented later in the manuscript. As it stands, I don't think they add very much to the study.
      2. There is considerable variability in the behavioral results, particularly the fear conditioning and Barnes maze tasks (Figures 4F-G). Given the extremely low sample size for mouse behavior (n=5 in on group, n=7 in the other), it is highly likely that the behavioral tests were done with a single cohort of animals (which would be far from ideal) and that these experiments are significantly underpowered. Furthermore, it does not appear that the fear conditioning task was properly optimized. For example, in the control mice in context A, there were two animals that were at or very close to 0 percent freezing; these were likely outliers, or even an indication that the foot shock conditioning protocol was not working as it should. The highest percent freezing of either group was ~70%, which would have been an ideal starting place as an average for the control group. In addition, sex of the animals was not reported for these experiments. If the authors combined sexes as they did in other analyses in this paper, it is possible that they missed reaching the appropriate reaction threshold for the foot shock for some of the animals, as sex differences have previously been demonstrated in mice (DOI: 10.1037/bne0000248). Given the age at which the animals are assessed with these tasks, these specific revisions would require greater than 6 months to complete. However, as currently presented, there simply are not enough data points to make any conclusions regarding behavior.

      Minor Comments:

      1. The representative GFAP images (Figure 1 E/G) do not appear to have been taken at the same magnification. This was particularly apparent in the comparison between the control and CKO hippocampus at 12mpi. It is difficult to say with certainty, due to the lack of fiducial markers in many of the images. Inclusion of a nuclear stain (DAPI) would be highly beneficial to allow the reader to make a more informed comparison.
      2. The authors should note that the use of GluA1 as a postsynaptic marker will not identify silent synapses (i.e. structurally "normal" but functionally inert).

      Referees cross-commenting

      After reading the comments of the other reviewer, I think we're in agreement that the cellular and molecular data, while descriptive, is of mostly excellent quality. Moreover, the significance of the study is high, and the potential readership broad. However, I stand by my initial assessment of the behavioral data and find the manuscript quite lacking in this regard. Proper revisions would take at least half a year or more, so the authors may be disinclined to go this route. That being said, if the behavioral data were to be excised, I would be happy to sign off on the rest of the manuscript provided that the other major criticisms are addressed.

      In response cross-comment of Rev 2:

      Agreed that if properly conducted and presented, the behavioral data would indeed provide a nice functional correlate to the cellular work. In its current state, I'm afraid that it is instead a hindrance to the study and I would recommend that they just remove it if they choose not to address my concerns with the quality (particularly the extreme variability and the complete lack of freezing by several of the animals, especially in the controls).

      Additional cross-comments:

      I agree with the added criticisms raised by Reviewer #3, and I think that the manuscript would be greatly improved by revisions that address those and the original criticisms from myself and Reviewer #2. I still think that the behavioral data should be omitted, provided that the authors are not capable or willing to appropriately address those concerns within a reasonable time frame.

      Significance

      General assessment: Overall strengths of this study are the implications of SRF as a broad spectrum anti-neurodegeneration agent and the variety of techniques used. Limitations of this study include a lack of meaningful synaptic comparisons and underpowered behavioral assays.

      Advance: Provided the above limitations are addressed, this study would provide a meaningful advance in our understanding of controlled reactive astrogliosis as a potential therapeutic strategy for neuroprotection.

      Audience: This study would be of interest to a wide audience, particularly neuro- and gliobiologists as well as clinicians who deal with brain disorders and injury.

      Expertise: imaging; behavior; synaptic development

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We appreciate the valuable suggestions and the overall highly positive review of our manuscript. We have now included many suggestions provided by the reviewers, which have made our manuscript much stronger and more rigorous. One reviewer acknowledged, “This study uncovers sex-dependent mechanisms underlying cold sensitivity between male and female mice. The detailed IHC analysis of MHCII expression in DRG neurons is a clear strength of this study and supports flow cytometry results as well as existing literature. The specificity of MHCII expression on small diameter is well characterized and supported by conditional knockout mouse models of MHCII in TRVPV1-lineage neurons.”

      R1: It is not, yet, possible to conclude that all experiments are adequately powered as N's for some studies are not provided.

      All experiments include N’s both in the text and in the figure legend.

      R1: It is unclear what is meant by "novel" expression, used throughout the manuscript.

      MHCII is traditionally thought to be constitutively expressed on antigen-presenting cells (APCs) and induced by inflammation on some non-APCs, including endothelial, epithelial, and glial cells (van Velzen et al., 2009). RNA seq data sets (Nguyen et al., 2021, Tavares- Ferreira et al., 2022, Usoskin et al., 2015, Lopes et al., 2017) demonstrate that mouse and human DRG neurons express transcripts for MHCII and MHCII-associated genes. However, there are no reports to date that demonstrate MHCII protein expression in terminally differentiated neurons. To the best of our knowledge, we are the first group to show that MHCII protein is expressed in DRG neurons.

      R1: The statement at the end of the abstract, "and that neuronal MHCII may also contribute to many other neurological disorders" seems premature, beyond the scope of the present study.

      We agree with the reviewer’s comment and have changed the sentence to the following: “Collectively, our results demonstrate expression of MHCII on DRG neurons and a functional role during homeostasis and inflammation” (pg. 1).

      R1: While cold allodynia (hypersensitivity) is a clinically important feature of CIPN, especially in CIPN associated with the platinum based chemotherapeutic agents, it is less so taxane CIPN. Do 60% of patients with PTX CIPN express cold allodynia or does that number refer to CIPN in general?

      This statistic is based on a study that conducted a meta-analysis of CIPN incidence and prevalence with paclitaxel, bortezomib, cisplatin, oxaliplatin, vincristine or thalidomide. However, we now include another reference (PMID: 15082135) that demonstrates patients receiving PTX experience cold hypersensitivity (pg.3).

      R1: Again, the future direction of expanding studies of the role of MHCII in other aspects of the CIPN phenotype might bear mention.

      We have included future directions regarding other aspects of CIPN phenotype in the discussion. We state, “Reducing the expression of MHCII in TRPV1-lineage neurons exacerbated PTXinduced cold hypersensitivity in both male and female mice. Future studies will evaluate the role of MHCII in PTX-induced mechanical hypersensitivity, another prominent feature of CIPN” (pg. 29).

      R1: Is there any evidence that IL-4 and/or IL-10 influence cold sensitivity?

      IL-10 and IL-4 have been shown to suppress spontaneous activity from sensitized nociceptors (Krukowski et al., 2016; Laumet et al., 2020; Chen et al., 2020) and to reduce neuronal hyperexcitability (Li et al., 2018), respectively. In addition, IL-10 has been shown to reduce mechanical hypersensitivity (Krukowski et al., 2016); however, cold sensitivity has not been evaluated. IL-4 KO mice do not have an increase in tactile allodynia or cold sensitivity after CCI; however, there is an increase in anti-inflammatory cytokines, specifically IL-10, and opioid receptors, which may be a compensatory mechanism that protects against enhanced pain after injury (Nurcan Üçeyler et al. 2011).

      R1: Are these experiments run blinded?

      Yes, this is discussed in the materials and methods section (pg. 31).

      R1: The term "directly contacts" is unclear. No synaptic structure is identified. It might be more accurate to estimate the actual proximity between the two cells, especially as direct contact would not be necessary for the type of intercellular communication they are studying. This is not an EM study.

      We agree with the reviewer’s comment and have changed the wording to “in close proximity” (pgs. 1,5, 7, 27).

      R1: Two abbreviations are used for immunohistochemistry, ICC and IHC.

      IHC refers to immunohistochemistry, and ICC refers to immunocytochemistry. We accidently wrote ICC in the immunohistochemistry section in the materials and methods section. We have now corrected it to say IHC (pg. 32).

      R1: In some figure, group sizes are not indicated (e.g., Fig. 4D).

      All group sizes are indicated in the text and figure legends.

      R1: "small non-nociceptive neurons" - seems to refer to TRPV1+ neurons. There are, however, TRPV1-nociceptors. "Therefore, the majority of MHCII+ neurons in the DRG of naïve female mice were not TRPV1- lineage neurons but non-nociceptive C-LTMRs." Could use some clarification here. Are the authors suggesting that being TRPV1- defines a neuron a non-nociceptive?

      We never said small non-nociceptive neurons are TRPV1+ neurons. We crossed TRPV1 lineage mice with td-tomato to label TRPV1 lineage neurons, which include TRPV1 neurons, IB4, and a subset of Aẟ neurons. We found that TRPV1 lineage neurons comprise about 65% of small diameter neurons, so 35% of small diameter neurons are not TRPV1 lineage cells. These non- TRPV1 lineage small diameter neurons are non-nociceptive LTMRs, most likely TH and MrgB4 neurons.

      R2: The most pressing concern regarding this study is a lack of a vehicle control group. It is not appropriate to be comparing paclitaxel treated mice to naïve mice. Please include a vehicle treatment (cremophor:ethanol 1:1 diluted 1:3 in PBS) group for all experiments involving paclitaxel.

      We believe the most appropriate control to paclitaxel treatment is the naïve control because clinically, paclitaxel is always administered to the patient in a formulation of 50% Cremophor and 50% ethanol. In clinical studies, the controls are healthy no-pain individuals and patients receiving paclitaxel without pain. However, the percentage of patients receiving paclitaxel that do not develop CIPN is low, emphasizing the need for healthy individuals not taking paclitaxel.

      R2: Figure 1A only includes representative images of a small number of T cells in presumable contact with DRG neurons in female Day 14 paclitaxel mice but does not include images from other groups. Similarly, B-D show a single CD4+ T cell in contact with DRG neurons in Day 14 paclitaxel and naïve female mice. Please include quantification of the frequency of CD4+ T cells interacting with DRG neurons in the different experimental groups utilized in this study.

      We have now quantified the number of CD4+ T cells per mm2 of DRG tissue, which is found in the text (pg. 5) and figures (Fig. S1 and Fig. 1A). We plan to add the quantification of CD4+ T cells per mm2 of DRG tissue for naïve and day 14 PTX-treated male mice. This data will be included in the text (pg. 5) and in Fig. S1.

      R2: Please include entire blot for Figure 2A (or at least more of the blot). There is plenty of space in the figure and as it currently appears is not free from apparent manipulation.

      We included a larger area of the western blot in Fig 2A (pg. 9).

      R2: The authors conclude that MHCII helps to suppress chemotherapy-induced peripheral neuropathy, resolving cold allodynia following paclitaxel treatment. To support this conclusion, I think it is necessary to include a time-course experiment highlighting whether cKO of MHCII in TRPV1 neurons indeed increases the duration for cold hypersensitivity to resolve following paclitaxel treatment.

      We conclude that neuronal MHCII suppresses cold hypersensitivity in naïve male mice and reduces the severity of PTX-induced cold hypersensitivity at the peak of the response (day 6) (pg. 1-2). In addition, knocking out one copy of MHCII in male TRPV1-lineage mice reduced total neuronal MHCII in naïve and PTX-treated mice (day 7 and 14) (pgs. 21-22; Fig.7). Moreover, knocking out one copy of MHCII in female TRPV1-lineage mice reduced surface- MHCII in female 7 days post-PTX (pgs. 19-20; Fig.6). Future studies will investigate the distinct roles of surface and intracellular neuronal MHCII and the contribution of MHCII to the resolution of CIPN.

      R2: The graphical abstract is misleading. The authors suggest paclitaxel is acting exclusively via TLR4 and that signaling is resolved at Day 14 which their data does not support. Please adjust to reflect findings from the experiments included in this study.

      We have removed TLR4 from our graphical abstract as we do not investigate the role of TLR4 in this manuscript. However, we do not suggest paclitaxel is acting exclusively through TLR4. We modified our wording to indicate both pro-inflammatory cytokines and PTX act on neurons to induce hyperexcitability and neurotoxicity: “Pro-inflammatory cytokines and PTX act on DRG neurons inducing hyperexcitability (Li et al., 2018, Boehmerle et al., 2006, Li et al., 2017) and neurotoxicity (Goshima et al., 2010, Flatters and Bennett, 2006), which manifests as pain, tingling, and numbness in a stocking and glove distribution (Rowinsky et al., 1993)” (pg. 9).

      R2: Figure 4 and 6 MHCII labelling is oversaturated in most of the images, creating a blurry hue in the representative images. This should be fixed.

      The signal intensity of immune cell MHCII is >5 times greater than neuronal MHCII; therefore, in order to visualize neuronal MHCII, the immune cell MHCII is oversaturated. We reference this in the discussion (pg. 26).

      R2: The effects of the PTX cHET group are very mild in both the male and female cohorts, and specific to 1 trial. R3: Furthermore, the behavioral effect is seemingly variable, with only one of the three trials being significantly different between groups. This variable response needs to be discussed further.

      This behavioral assay was developed by the UNE COBRE Behavior Core, under the guidance of Dr. Tamara King, who has extensive experience in using learning and memory measures to determine changes in pain such as development of thermal hypersensitivity (1-3, King et al, Nat Neuro 2009). Methodologically, the process is as follows: In the temperature placed preference assay, mice are placed on the reference plate (25 °C) to begin each 3-minute trial. For the habituation trial, both the test and reference plates are set to 25 °C, and the mice are allowed to explore for 3 minutes. The following 3 trials are the acquisition trials where the reference plate is set to 25 °C and the test plate to 20 °C. If the animals have cold hypersensitivity, modeling cold allodynia, then they will demonstrate faster acquisition of a learned avoidance response compared to the WT controls. For the results, we will clarify our findings, which are outlined below: 1) We will change the axis labels to better distinguish BL/habituation trial from reference trials in the graphs. 2) We will add graphs comparing naïve versus PTX for male and female WT mice. 3) The changes in the graphs will now reflect 3 key findings: First, we note that PTX-treated mice learn to avoid the cold test plate faster than the naive controls in the WT mice reflecting PTX-induced cold hypersensitivity. Of interest, both males and females demonstrate learned avoidance by trial 2 and that the percent of time on the cold plate continued to decline only in the PTX-treated mice. We had not graphed this in the original figure and plan to add graphs for both male and female WT mice. These graphs are important to include as it validates that this TPP can capture the expected PTX-induced cold hypersensitivity in WT mice. Second, in terms of the naïve cHET mice, these data show that both female and male cHET mice demonstrate faster learning to avoid the cold (20 °C) plate compared to the WT mice (Fig. 8A, B. We note that the males demonstrate a more robust effect, (faster learned avoidance of the cold plate) with significant avoidance to the cold plate emerging in the cHET mice by trial 3 compared to trial 4 in the females (sig diff compared to BL trial). Third, we observed that cHET mice treated with PTX demonstrate even more accelerated learning to avoid the cold plate compared to WT mice treated with PTX. This observation suggests that PTX-treated cHET mice have heightened cold allodynia compared to the WT mice.

      R2: The statistical analysis (for the behavior) should also have been a mixed-effects repeated measures between groups ANOVA.

      We agree and re-analyzed our behavior data using repeated measures mixed-effects model (REML) with Dunnett’s multiple comparison test comparing trials 2-4 to trial 1 within same group, and Sidak’s multiple tests for significance between groups at the same trial (pgs. 23-25; Fig. 8)

      R3: Presented in Figure 3, the authors present data to show surface expression of MHCII, along with the ability of MHCII to present OVA peptide, on naïve and PTX-treated DRG neurons. These data are probably the most relevant in terms of expression as they look at the surface expression of MHCII along with the potential of MHCII to function; therefore, it is unclear why the authors only conducted this analysis on female neurons, and not both male and female neurons. Given the claims of the paper in terms of sex differences for MHC expression, I strongly suggest this is done in order to put the other observations into context.

      We completely agree and have added male mice data in Figs. 2 and 3. By western blot, we show that PTX increased the amount of MHCII protein 14 days post-PTX in DRG neurons from female mice, but there’s no change in MHCII protein after PTX in male mice (Fig. 2). In agreement with the western blot, surface-MHCII determined by flow cytometry did not increase after PTX on DRG neurons from male mice (Fig. 3B). Moreover, the frequency of DRG neurons from male mice with surface-MHCII (determined by ICC) and OVA peptide did not change after PTX treatment (Fig. 3D, E). However, the percent area with polarized MHCII on DRG neurons from male mice increased 14 days post-PTX, indicating a modest PTX-induced response in males (Fig. 3F). We have now included the frequency of surface-MHCII on DRG neurons from male and female mice after PTX treatment, and again there was no change in surface-MHCII in male mice (Fig. 6). Collectively, our data demonstrates that neuronal MHCII in male mice is not strongly regulated by PTX treatment.

      R3: Given the data presented in Figure 3, it is not clear what the relevance of investigating the subcellular puncta expression of MHCII neurons is, particularly when considering the sex differences observed, and how this was not been performed for surface expression.

      We now include surface and total MHCII quantification for male and female WT and cHET mice (Figs. 6,7). In the text, we describe the significance of surface versus endosomal MHCII. “While endosomal MHCII can promote TLR signaling events(Liu et al., 2011), expression of MHCII on the cell surface is required to activate CD4+ T cells.” (pg. 10). “Although the major role for surface MHCII is to activate CD4+ T cells, cAMP/PKC signaling occurs in the MHCII-expressing cell(Harton, 2019). In addition, it has recently been shown that endosomal MHCII plays an important role in promoting TLR responses(Liu et al., 2011), and since DRG neurons are known to express TLRs (Lopes et al., 2017, Wang et al., 2020, Cameron et al., 2007, Barajon et al., 2009, Xu et al., 2015, Zhang et al., 2018), this suggests the potential for T-independent responses in MHCII+ neurons. Knocking out one copy of MHCII in TRPV1- lineage neurons (cHET) from female mice did not change total MHCII 7 days post-PTX but reduced surface-MHCII. Accordingly, PTX-treated cHET female mice were more hypersensitive to cold than PTX-treated WT female mice, suggesting a role for neuronal MHCII in CD4+ T cell activation and/or neuronal cAMP/PKC signaling. In contrast, knocking out one copy of MHCII in TRPV1-lineage neurons (cHET) from male mice did not change surface-MHCII in naïve or PTX-treated mice but reduced total MHCII, indicating endosomal MHCII and potentially a role in TLR signaling. Future studies are required to delineate MHCII surface and endosomal signaling mechanisms in naïve and PTX-treated female and male mice.” (pg. 28).

      R3: Furthermore, the authors should provide details of what the abundant non-neuronal structures are within the DRG images that appear positive for MHCII staining.

      We now include an image of the high MHCII+ cells in mouse DRG co-stained with macrophage and dendritic cell markers (CD11b/c), indicating the presence of immune cells (Fig. S6).

      R3: The behavioral data presented in Figure 7 is somewhat confusing. Can the authors confirm how many alleles of MHCII were knocked out from the Trpv1-lineage neurons for these experiments? In Figure 7, it states cKO Het, which suggests that only one allele was deleted within the Trpv1 population. If this is the case, this needs to be clearly outlined within the results section and not simply referred to as "knocking out MHCII in Trpv1-lineage neurons". In addition, an explanation as to why heterozygous cKO were used rather than homozygous cKO needs to be provided. This is particularly relevant when discussing potential sex differences.

      The mouse behavior is performed in wild type and TRPV1lin MHCII+/- heterozygote mice (Fig 8). Instead of saying we knocked out MHCII, we changed the text to “knocking out one copy of MHCII in TRPV1-lineage neurons” (pgs. 23, 29). In the methods section, we state that “cHET×MHCIIfl/fl crosses only yielded 8% cKO mice (4% per sex) instead of the predicted 25% (12.5% per sex) based on normal Mendelian genetics. Thus, cKO mice were only used to validate MHCII protein in small nociceptive neurons” (pg. 30) (Fig 7).

      R3: A significant gap in the current manuscript is the functional assessment of MHCII protein expressed on DRG neurons in terms of T cell activity. I would suggest the authors consider performing a co-culture DRG-T cell (i.e. Treg) assay where anti-inflammatory cytokine release can be measured in the presence and absence of MHCII on DRG neurons.

      The functional implication of MHCII protein on DRG neurons in terms of T cell activity is out of the scope of this manuscript. We currently have another manuscript in progress investigating CD4+ T cell signaling and cytokine production when co-cultured with DRG neurons. R3: Within the first paragraph of the results section, the authors reference Goode et al, 2022, stating that they have previously shown that CD4+ T cells in the DRG secrete anti-inflammatory cytokines. I have read this paper and could not find any data that showed increased secretion of cytokines, only that there is an increase in T-cell populations that contain anti-inflammatory markers. Please consider rewording to reflect the observations made in the original paper. We have changed “secrete” to “produce” (pg. 5) because we detected anti-inflammatory cytokines (IL-10 and IL-4) within CD4+ T cells using intracellular staining and multi-color flow cytometry.

      R3: Figure 1A states that it is "day 14 PTX", however, there is no reference to this in the corresponding text - please state what Figure 1A is showing in the main text and legend regarding PTX treatment.

      We have now included text and Fig. 1. legend that states that the images in Fig1A are of DRG tissue collected from female mice 14 days after PTX treatment (pg. 5).

      R3: Throughout the results section (Figure 3-Figure 6), the authors provide percentage changes in observed difference in expression, however, in addition to this, it would be valuable to have the actual number of neurons analysed for each group and sex.

      We now report in the materials and methods section the number of neurons that were analyzed (pg. 33).

      R3: For Figure 5, can the authors confirm whether this was performed on tissue sections or dissociated cell culture?

      This analysis was performed in DRG tissue sections. The legend now states, “Gaussian distribution of the diameter of MHCII+ DRG neurons in DRG tissue from naïve (pink), day 7 (orange) and day 14 PTX-treated (blue) (A) female and (E) male mice (n=8/sex, pooled neurons).”

      R3: Can the authors comment on why surface expression for MHCII was not performed on the these reporter neurons?

      In the future, we plan to delineate which subsets of neurons express MHCII by co-staining for MHCII and specific neuronal markers. However, these studies are beyond the scope of the current manuscript.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      This manuscript sets out to investigate the mechanism by which the previously reported infiltration CD4+ T cells into the DRG parenchyma can mediate analgesia in the paclitaxel (PTX) model of chemotherapy-induced neuropathic pain (CIPN). The authors provide good rationale for the purpose of the study and make a number of interesting observations, including the expression of MHCII on DRG neurons, the effect of PTX on MHCII expression on DRG neurons, and the effect of targeted deletion of MHCII on Trpv1-expressing putative nociceptive neurons in exacerbating the effect of PTX-induced cold hypersensitivity. These data culminate to a hypothesis that MHCII expression on DRG neurons may drive T-cell mediated anti-inflammatory effects (and analgesia) in models where their recruitment is notable. Overall I enjoyed reading the manuscript, however, I believe there are a number of points that need to be considered further.

      Major comments.

      • Presented in Figure 3, the authors present data to show surface expression of MHCII, along with the ability of MHCII to present OVA peptide, on naïve and PTX-treated DRG neurons. These data are probably the most relevant in terms of expression as they look at the surface expression of MHCII along with the potential of MHCII to function; therefore, it is unclear why the authors only conducted this analysis on female neurons, and not both male and female neurons. Given the claims of the paper in terms of sex differences for MHC expression, I strongly suggest this is done in order to put the other observations into context.
      • Given the data presented in Figure 3, it is not clear what the relevance of investigating the subcellular puncta expression of MHCII neurons is, particularly when considering the sex differences observed, and how this was not been performed for surface expression. Furthermore, the authors should provide details of what the abundant non-neuronal structures are within the DRG images that appear positive for MHCII staining.
      • The behavioural data presented in Figure 7 is somewhat confusing. Can the authors confirm how many alleles of MHCII were knocked out from the Trpv1-lineage neurons for these experiments? In Figure 7, it states cKO Het, which suggests that only one allele was deleted within the Trpv1 population. If this is the case, this needs to be clearly outlined within the results section and not simply referred to as "knocking out MHCII in Trpv1-lineage neurons". In addition, an explanation as to why heterozygous cKO were used rather than homozygous cKO needs to be provided. This is particularly relevant when discussing potential sex differences. Furthermore, the behavioural effect is seemingly variable, with only one of the three trials being significantly different between groups. This variable response needs to be discussed further.
      • A significant gap in the current manuscript is the functional assessment of MHCII protein expressed on DRG neurons in terms of T cell activity. I would suggest the authors consider performing a co-culture DRG-T cell (i.e. Treg) assay where anti-inflammatory cytokine release can be measured in the presence and absence of MHCII on DRG neurons.

      Minor comments.

      • Within the first paragraph of the results section, the authors reference Goode et al, 2022, stating that they have previously shown that CD4+ T cells in the DRG secrete anti-inflammatory cytokines. I have read this paper and could not find any data that showed increased secretion of cytokines, only that there is an increase in T-cell populations that contain anti-inflammatory markers. Please consider rewording to reflect the observations made in the original paper.
      • Figure 1A states that it is "day 14 PTX", however, there is no reference to this in the corresponding text - please state what Figure 1A is showing in the main text and legend regarding PTX treatment.
      • Throughout the results section (Figure 3-Figure 6), the authors provide percentage changes in observed difference in expression, however, in addition to this, it would be valuable to have the actual number of neurons analysed for each group and sex.
      • For Figure 5, can the authors confirm whether this was performed on tissue sections or dissociated cell culture? In addition, can the authors comment on whey surface expression for MHCII was not performed on the these reporter neurons?

      Significance

      This paper presents interesting data on the expression of MHCII on DRG neurons, which corroborates existing and published RNA expression data from the literature. In addition, this paper builds on our current understanding of how T-cells may be able to interact with DRG neurons in order to modulate their responses in instances of nerve injury. However, there are significant gaps in the data presented which prevent a more informative conclusion being drawn regarding the role of MHCII in modulating neuronal responses following PTX-induced CIPN.

      Audience: I would suggest basic scientists working within the field of pain and neuroimmunology would be interested in this work.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      In this manuscript, Whitaker EE and co-authors implicate MHCII expression in DRG neurons in the resolution of pain following paclitaxel treatment. The authors demonstrate that CD4 T cells closely interact with DRG neurons, which also express MHCII proteins. They further characterize neuronal MHCII expression in naïve and paclitaxel treated mice in small diameter TRPV1+ neurons. Utilizing genetic animal models with MHCII knockout in TRPV1-lineage neurons, the authors highlight that loss of MHCII in TRPV1 neurons exaggerates cold sensitivity in naïve male mice, and in both sexes following paclitaxel treatment.

      Major concerns:

      The most pressing concern regarding this study is a lack of a vehicle control group. It is not appropriate to be comparing paclitaxel treated mice to naïve mice. Please include a vehicle treatment (cremophor:ethanol 1:1 diluted 1:3 in PBS) group for all experiments involving paclitaxel. This would also improve statistics as unpaired T tests comparing naïve vs paclitaxel is not convincing.

      Figure 1A only includes representative images of a small number of T cells in presumable contact with DRG neurons in female Day 14 paclitaxel mice, but does not include images from other groups. Similarly, B-D show a single CD4+ T cell in contact with DRG neurons in Day 14 paclitaxel and naïve female mice. Please include quantification of the frequency of CD4+ T cells interacting with DRG neurons in the different experimental groups utilized in this study.

      Please include entire blot for Figure 2A (or at least more of the blot). There is plenty of space in the figure and as it currently appears is not free from apparent manipulation.

      The authors conclude that MHCII helps to suppress chemotherapy-induced peripheral neuropathy, resolving cold allodynia following paclitaxel treatment. To support this conclusion, I think it is necessary to include a time-course experiment highlighting whether cKO of MHCII in TRPV1 neurons indeed increases the duration for cold hypersensitivity to resolve following paclitaxel treatment.

      Minor concerns:

      The graphical abstract is misleading. The authors suggest paclitaxel is acting exclusively via TLR4 and that signaling is resolved at Day 14 which their data does not support. Please adjust to reflect findings from the experiments included in this study.

      Figure 4 and 6 MHCII labelling is oversaturated in most of the images, creating a blurry hue in the representative images. This should be fixed

      The effects of the PTX cHET group are very mild in both the male and female cohorts, and specific to 1 trial. I believe these assessments were conducted at Day 6 post injection. Why was this timepoint chosen considering differences in MHCII expression in small neurons was only present at Day 14 relative to naïve? The statistical analysis should also have been a mixed-effects repeated measures between groups ANOVA.

      Significance

      This study uncovers sex-dependent mechanisms underlying cold sensitivity between male and female mice. The detailed IHC analysis of MHCII expression in DRG neurons is a clear strength of this study, and supports flow cytometry results as well as existing literature. The specificity of MHCII expression on small diameter is well characterized and supported by conditional knockout mouse models of MHCII in TRVPV1-lineage neurons. The clear limitations of this study is the lack of a vehicle control group and limited behavioral analysis. They undermine the conclusions made by the author, and in extension, the significance of this study.

      This study adds to the understanding of neuro-immune signaling in peripheral neuropathic pain. As far as I am aware, this is the first study to investigate MHCII expression in DRGs in relation to development of chemotherapy-induced peripheral neuropathy. Thus this study provides an incremental advance in neuroimmune mechanisms contributing to the development of chemotherapy-induced peripheral neuropathy in mice.

      This study would be of interest to basic researchers interested in neuropathic pain, with particularly researchers with a focus on neuroimmunology and chemotherapy-induced peripheral neuropathy models. The sex differences observed in naïve mice would also be of interest to basic researchers within the wider pain field. Given the preliminary nature of the findings, I do not think this would be of interest to broader neuroimmunology or clinical audiences.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Section A:

      The key conclusions of this study are quite robust and compelling.

      While no claims need qualification clarification of some conclusions could improve the impact of this study.

      Additional experiments are not essential to support the claims of this study.

      Sufficient details are provided to allow reproduction of the key findings of this study.

      It is not, yet, possible to conclude that all experiments are adequately powered as N's for some studies are not provided.

      Significance

      Section B:

      • State what audience might be interested in and influenced by the reported findings.

      This study should be of broad interest not only in the field of the neurobiology of pain but in broader issues related to neuroimmunology.<br /> - Define your field of expertise with a few keywords to help the authors contextualize your point of view. Indicate if there are any parts of the paper that you do not have sufficient expertise to evaluate.

      I am a clinician-scientist with clinical responsibilities in immunologic disorders and a basic scientist with expertise in the area of pain, including chemotherapy-induced painful peripheral neuropathies and neuroimmune mechanisms.<br /> - Describe the nature and significance of the advance (e.g. conceptual, technical, clinical) for the field.<br /> - Place the work in the context of the existing literature (provide references, where appropriate).

      The authors provide compelling evidence that MHCII expression of MHCII in primary sensory neurons, is regulated in painful chemotherapy-induced peripheral neuropathy (CIPN) induced by the commonly used taxane class of chemotherapy drugs, paclitaxel (PTX).

      The present studies build on recent literature demonstrating that PTX CD4+ T cells in DRG. This is key to their hypothesis as T cells and anti-inflammatory cytokines protect against CIPN. In the present study these investigators studied how CD4+ T cells are activated role of cytokines released from these cells on CIPN. To key findings of the present study: the expression of functional MHCII protein in DRG neurons and the proximity of the DRG neurons and CD4+ T cells. While the MHCII protein was expressed in small-diameter, nociceptive, DRG neurons, in male mice, in females it was induced by PTX. Compatible with the hypothesis that the anti-inflammatory CD4+ T cells attenuate CIPN. Finally, in support of the contribution of this mechanism to CIPN pain, they demonstrated that attenuation of MHCII protein from nociceptors produced the predicted increase in cold hypersensitivity. Taken together their findings support suppression of CIPN by MHCII

      While the experiments are well designed and executed and the results clearly presented, I have some relatively minor concerns that, if addressed, might improve the ability of a general scientific audience to appreciate the impact of the findings presented (possibly a penultimate paragraph covering caveats and limitations of the present study).

      It is unclear what is meant by "novel" expression, used throughout the manuscript.

      The statement at the end of the abstract, "and that neuronal MHCII may also contribute to many other neurological disorders" seems premature, beyond the scope of the present study.

      While cold allodynia (hypersensitivity) is a clinically important feature of CIPN, especially in CIPN associated with the platinum based chemotherapeutic agents, it is less so taxane CIPN. Do 60% of patients with PTX CIPN express cold allodynia or does that number refer to CIPN in general? Again, the future direction of expanding studies of the role of MHCII in other aspects of the CIPN phenotype might bear mention. Is there any evidence that IL-4 and/or IL-10 influence cold sensitivity? Are these experiments run blinded?

      The term "directly contacts" is unclear. No synaptic structure is identified. It might be more accurate to estimate the actual proximity between the two cells, especially as direct contact would not be necessary for the type of intercellular communication they are studying. This is not an EM study.

      Two abbreviations are used for immunohistochemistry, ICC and IHC.

      In some figure, group sizes are not indicated (e.g., Fig. 4D).

      "small non-nociceptive neurons" - seems to refer to TRPV1+ neurons. There are, however, TRPV1-nociceptors.

      "Therefore, the majority of MHCII+ neurons in the DRG of naïve female mice were not TRPV1-lineage neurons but non-nociceptive C-LTMRs." Could use some clarification here. Are the authors suggesting that being TRPV1- defines a neuron a non-nociceptive?

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We would like to thank all reviewers for their highly valuable comments, reviewing the article, and suggesting changes to improve its overall structure, clarity, and comprehension. Please find below our point-by-point responses to each reviewer’s comments. Lines, figures, and tables we refer to in the responses correspond to the clean copy of the revised manuscript.

      Reviewer #1:

      1) In the introduction the authors list 4 databases of ultra-conserved non-coding elements, and choose to work with the UCNEbase that detects UCNE regions by comparing human and chicken, as they state that it is one of the most comprehensive resources. Can the authors comment on the extent of overlap of UCNE regions identified in this database compared to other databases. It would also be helpful to add an explanation in the Introduction on the advantage of comparing the human genome to the chicken genome, e.g., is chicken the most distant vertebrate with a high quality genome, or another reason? And can the authors comment on the extent of conservation of the UCNEs compared to other species - in the UCNEbase paper, orthologues for the UCNEs are identified in 18 vertebrate species including reptiles, amphibians and fish.

      We have addressed these comments and incorporated them in the introduction (lines 46-47; 49-52). As stated, it is not straightforward to evaluate to which extent UCNE regions overlap with those collected in other databases due to the different scopes and methods of these resources. We clarified why we selected this database, which was precisely based on the comments mentioned by the reviewer, i.e., sufficient evolutionary distance to identify functional regions confidently and high quality genome assemblies. Regarding the extent to which UCNEs are conserved in other species, the UCNEdatabase indeed provides additional information with respect to UCNE orthologues in other vertebrate species, including reptiles, amphibians, and fish. As we consider that this comparison is beyond the scope of the present study, it was not included in the main manuscript. However, to address this interesting point raised by the reviewer, we evaluated the proportion of UCNEs found in different species with respect to those annotated for human-chicken. As show in the figure below, UCNEs are conserved to a larger extent up to Xenopus tropicalis, for which most of the UCNEs annotated for human-chicken have corresponding orthologues in this species. Although to a minor extent, UCNEs are also conserved across more distant species (e.g., fish), for which approximately half of the UCNEs annotated for human-chicken have orthologues.

      2) The authors briefly describe how potential target genes were assigned to UCNEs in the Method section (section begins on page 21, line 407 and on lines 379-381). They note that they used the Genomic Regions Enrichment of Annotations Tool (GREAT). Can the authors provide additional details on what this method does and also provide a high level sentence in the Results section on page 8, lines 144-146, on how target genes were assigned to UCNEs, as well as in the Discussion on page 16, line 289. Based on the Methods description on lines 409-414, a UCNE was associated with any gene within 1Mb of the UNCE that was expressed in retina and whose curated regulatory domains overlapped the UNCE. Is this correct? How were the regulatory domains curated (line 411-412)? Can the authors please clarify this important point.

      Additional details about the GREAT algorithm have been included in the Methods section (lines 410-424) as well as a high-level sentences in the Results (lines 140-141) and Discussion (lines 276-280). It is correct that a UCNE was associated with any gene within 1Mb of the UCNE that was expressed in retina and whose curated regulatory domains overlapped the UCNE. As stated now (lines 420-424), these regulatory domains are supported by experimental evidence demonstrating that a gene is directly regulated by an element located beyond of its putative regulatory domain. We specified these domains for the utilized version of GREAT as well.

      3) There are other approaches for linking putative transcriptionally active genomic regions with target genes in specific tissues or cell types through correlation analysis of ATAC-seq peaks (chromatin accessibility) and gene expression in RNA-seq data. A commonly used peak-to-gene linkage method is implemented in ArchR (Granja et al, 2021, PMID: 33633365). The authors note that they used scATAC-seq gene scores and scRNA-seq gene expression to further characterize the proposed target genes of UCNEs. It is not clear what the authors mean by "scATAC-seq gene scores". Please define "scATAC-seq gene score" and add a reference. Can the authors compare the target gene mapping to UCNEs using GREAT and gene expression filtering to that using peak-to-gene linkage based on retina tissue or single cell ATAC-seq and RNA-seq data?

      We have defined explicitly what scATAC-seq gene scores are in the Methods section (lines 436-437) along with its reference. We have also addressed this important point and compared the overlap between the set of target genes predicted by GREAT and those assigned by the peak-to-gene linkage method implemented by ArchR. Details of this analysis, its results, interpretation are included in the Methods (lines 441-446), Results (lines 158-163; Supplementary Table 4), and Discussion (lines 280-282) sections.

      4) For gene expression filtering (line 419) the authors quantify transcript expression of retina from FASTQ samples using the Kallisto method, and then note that they did the filtering on gene expression levels (TPM<0.5). Please add details on how you went from transcript expression levels to gene expression levels for the filtering, or was the filtering performed at the transcript level?

      We have added details on how transcript-level quantification estimates were summarized at gene level, for which the filtering was performed (lines 429-430).

      5) The authors use the words "active UCNE", first mentioned in the Results on line 144. Can the authors define what they mean by "active UCNE". What information/evidence is used to ascertain that a UCNE is indeed active. Overlap of a UCNE with a chromatin accessibility region from ATAC-seq or DNAase-Seq would only suggest that the UCNE may be active. Intersection with enhancer activity measured with in vivo enhancer reporter assays in transgenic mice from the VISTA enhancer browser provides stronger evidence of transcriptional activity. The authors might want to distinguish between putatively actively and active based on the functional support.

      We thank the reviewer for this relevant comment to address the nuances of defining active UCNEs. The reviewer’s assumptions are correct and hence these terms were clarified throughout the entire text. The term functional is now only used when referring to UCNEs for which there is functional support (e.g., PAX6-associated UCNE in line 193) .

      6) The authors assessed the significance of depletion of common variation (MAF>1%) in the UCNE regions compared to a background of randomly selected genomic regions. In generating the random distribution of regions, did the authors match on the distribution of distances of the UNCEs to the TSS of genes in the randomly selected regions? This may be a confounder. Also, in the legend of Figure 3, lines 191-192, it is stated: "Variant population frequencies within putative retinal UCNEs normalized to a background composed of randomly selected sequences (see Methods).", but we did not find a description of this analysis in the Methods section.

      Evaluating the potential confounding effect of the genomic background was indeed a very important point. We have now incorporated the details showing the suitability of such background well as a detail description of how such background was generated (lines 479-481; Figure S1). Additionally, to further support our analysis demonstrating the depletion of common variation within UCNEs, we have included an evaluation of the distribution of genome-wide residual variation intolerance score (gwRVIS) values (PMID: 33686085) compared to this background of randomly selected genomic regions in a human reference cohort (lines 173-178; 487-495; Fig. 3C).

      7) In regards to intersecting UCNEs with epigenetic marks that detect active or repressed enhancers in retina, the authors used data from Aldiri et al 2017 that measured epigenetic changes during retinal development. Did this dataset contain epigenetic measurements in adult retina? The authors might want to consider using the epigenetic marks/ChIP-seq data from adult human retina in Cherry et al. PNAS 2020 (PMID: 32265282)

      We have incorporated the adult-stage data suggested by the reviewer to provide a more comprehensive characterization. Details about the integration of this dataset as well as the results and their corresponding interpretation have been incorporated in the Methods (lines 372-374), Results (lines 115-117; Supplementary Table 2), and Discussion (lines 271-273) sections accordingly.

      8) With respect to the examination of rare variants that may be associated with rare eye disease in retina active UCNEs, for the interpretation of the results, it would be helpful to get more information on the distribution of rare variants found in UCNEs associated in this study to known IRD genes in all affected individuals in families, if this information is available in the 100,000 Genomes Project.

      Although it is indeed a relevant point, this information cannot be retrieved in the 100,000 Genomes Project. As it is a restricted research environment, we are only allowed to query sequencing data corresponding to participants enrolled within the framework of our specific sub-domain, namely “Hearing and Sight”, and therefore evaluating the distribution of rare variants in all affected individuals is not feasible.

      9) In the Methods section on lines 450-451, the authors mention that they performed variant screening of retinal disease genes, referencing the Genomics England Retinal Disorder panel and Martin et al., 2019. Can the authors add to the Methods and Results sections how many retinal disease genes were initially tested. Also, to get a sense of the specificity of the overlap of rare variants in the 100k Genome Project cohort with UNCE regions, it would be informative to show a distribution of the number of rare variants <0.5% that passed the filtering in gnomAD per eye disease gene before the overlap with UNCEs.

      We specified the number of retinal genes that were tested in the Method section (line 471). In addition, as suggested by the reviewer, we generated allele frequency distributions for all variants retrieved within a selection of 25 disease-gene associated loci and their corresponding UCNEs in order to assess the specificity of the overlap between rare variants and UCNE regions (lines 181-182, 496-501; Figure S2).

      10) The authors found "an ultrarare SNV (chr11:31968001T>C) within a candidate cis-regulatory UCNE located ~150kb upstream of PAX6. This variant was found in four individuals of a family segregating autosomal dominant foveal abnormalities". They tested the functional effect of this element with a reporter assay in zebrafish and found that the UNCE affects expression in the eye, forebrain, and neural tube. It would add further value if the authors were to test the effect of this SNV in the UCNE on the reporter expression pattern, using CRISPR/cas9?

      That is a very relevant point. We have tested the effect of this SNV in the UCNE on the reported expression pattern using the same experimental setup that we used for testing the wild-type construct, namely transgenic enhancer zebrafish assays. However, we could not obtain conclusive results, most likely due to the limitations posed by testing these regions outside their native genomic context. Therefore, additional experimental work (e.g., CRISPR-based) should be performed to address this question. This is, however, beyond the scope of the present study, for which the main focus was the identification and functional annotation of ultraconserved cCREs. We have incorporated the details, results, and interpretation of the assays performed mutant construct in the Methods (lines 525-527; Supplementary Table 12), Results (lines 235-238; Supplementary Table 10), and Discussion (lines 350-353) sections.

      11) The authors found rare variants in UCNEs linked to 45 IRD genes. Can the authors provide additional information on the functional genomic annotations of these UCNEs and distance to the target genes. The UCNEs were characterized with respect to their genic features in the original paper (UCNEbase, Dimitrieva et al., NAR, 2013), e.g., intergenic, intronic and 3'/5' UTR. Also, it would be useful for clinical applications to provide the start and end positions of the UCNEs that contain the rare variants associated with their 45 IRD genes in Supplementary Table 6.

      Additional functional genomic annotations, genic features following those of the original UCNE paper, and the distance to the TSS of these 45 target disease-associated genes have been incorporated in (new) Supplementary Table 5. The start and end positions of the UCNEs that contain the rare variants have also been indicated in new Supplementary Table 7.

      12) A total of 724 target genes were assigned to 1,487 UCNEs that displayed candidate cis-regulatory activity. Given the interest in using UCNEs to help identify potential pathogenic mutations that lead to IRDs, can the authors note in the Results section how many of the 724 target genes are IRDs.

      We thank the reviewer for this important point. From the total of 724, a total of 27 genes are annotated as IRD genes, of which (interestingly) 23 were kept as found to be expressed in the retina. This has been clarified in the Results section (line 166-168).

      13) In the Discussion on page 15 line 259, can the authors clarify if variation found in UCNEs were only associated with rare disease or also with common diseases.

      We have clarified that variation found in UCNEs has only been associated with rare diseases (line 247).

      Minor edits:

      1) In abstract, the authors might consider changing the words "rare eye diseases" on lines 20 and 22 to "rare retina degeneration diseases", and on lines 88-89.

      We thank the reviewer for this comment. However, we consider that rare eye diseases is a more suitable term for our purpose as it includes diseases primarily characterized by stationary and non-progressive phenotypes such as North Carolina Macular Dystrophy and fovea hypoplasia.

      2) In the Introduction on line 49, there seems to be a typo in the number of UCNE regions reported. 4,135 UCNE regions is supposed to be 4,351, based on the original paper (https://academic.oup.com/nar/article/41/D1/D101/1057253).

      We have corrected this typo accordingly.

      3) In the introduction on lines 75-76, these references: Lyu et al., Cell Reports 2021, PMID: 34788628, and Zhang et al., Trends in Genetics 2023, PMID: 37423870, could be added to the following sentence to provide additional: "This cellular complexity is the result of spatiotemporally controlled gene expression programs during retinal development”.

      We have now included these relevant references.

      4) On lines 77 and 84, I would write IRD as plural: IRDs.

      This has been amended in the new version.

      5) In introduction on lines 89-90, it can be further added that you provide experimental support for an ultra rare SNV in a cis regulatory UCNE affecting PAX6.

      We have explicitly stated that we provided functional evidence for this UCNE.

      6) On line 98, the authors refer to Figure 1A when noting that the integration of UCNEs with multi-omics data in human retina allows to evaluate the regulatory capacity of UCNEs across the major developmental stages of human retina. However panel A in figure 1 does not seem to show this point. It shows the comparison of elements across species. Please make appropriate changes to the main text and figure legend.

      We have made the appropriate changes and located the reference to this figure in a more relevant part of the text (line 87).

      7) Please explain what the names appended to the gene symbols in the first column "UCNE ID" in Supplementary Tables 1 and 2 refer to.

      We have clarified what these refer to.

      8) On line 145, can the authors clarify what they mean by "active gene expression in the retina". Is this just another way of referring to genes found to be expressed in retina? If so, it might be clearer just to write: "We annotated the identified active UCNEs to assign them potential target genes and thus assess their association with genes expressed in the retina"

      We indeed meant genes found to be expressed in retina. As this phrasing might not be completely clear, we have now changed to the wording suggested by the reviewer.

      9) One line 156, I would write "regulation of transcription" as listed in the gene ontology terms in Figure 2C, instead of "regulation of gene expression". The authors might want to add this to the Discussion. Can the authors include the full gene set enrichment results from Enrichr in a supplementary table at Padj<0.05 since only the top gene sets are shown in Fig. 2C (at P<1E-13)?

      We changed the term to “regulation of transcription” to keep the nomenclature consistent to that of Figure 2C. We have also provided a full gene set enrichment from Enrichr as well (Supplementary Table 3).

      10) On page 12, line 214, what does "EH38E1530321" Stand for? It seems to specify a distal enhancer-like signatures in bipolar neurons, but I couldn't find this ID in any database.

      This refers to the identifier of ENCODE:

      https://screen-v2.wenglab.org/search/?q=EH38E1530321&assembly=GRCh38

      Additionally, when mentioning a specific UCNE, VISTA enhancer, or ENCODE cCRE (as in this case), we have explicitly included its corresponding identifier.

      11) In the Methods section on lines 391-392, can the authors give some high-level explanation of the unconstrained integration method: "Single-nucleus RNA-seq of the same tissue and timepoints (GSE183684) were integrated using the unconstrained integration method". Also, can they comment on how retinal cell class identities were assigned (line 393). Was it based on known markers or on previous identification of cell classes and highly variable genes between clusters?

      We have included a high-level explanation of the unconstrained method in the Methods section (lines 387-392). We also clarified that the assignment of cell class identities was based on known markers (line 394).

      12) In the integration of UCNEs with bulk and single cell ATAC-seq and Dnase hypersentitivity regions, can the authors note in the Methods section (lines 400-404) what peak width was used to test for overlap with the UCNEs.

      We have specified the peak widths that were used for the overlap with UCNEs (lines 397 and 403).

      13) On line 436, the word 'and' is missing between "(SNVs, and indels < 50bp)" and "large structural variants".

      This has been corrected.

      14) On lines 443-444, please provide references to the computational tools listed. Please note if default settings/parameters were used.

      We have specified that default parameters were used in the analysis (line 464).

      15) In the following sentence in the Methods section on lines 447-449, it is not clear in the Results section how this was used in the flow of the analysis, and how many cases showed such a similarity in phenotype: "For each candidate variant, we compared the similarities between the participant phenotype (HPO terms) and the ones known for its target gene through literature search and clinical assessment by the recruiting clinician when possible." Can the authors add more detail to the Results section.

      As the evaluation of the candidate variants was essentially performed on a case-by-case basis, we opted to include a rather general description of the workflow, which indeed included a comparison of the reported phenotypes with those associated with the putative target gene. An example of such comparison has been included in the Results (lines 186-187) section regarding the cases for which a NCMD-like phenotype was suspected.

      16) It would be helpful to have a table that describes the different omics datasets used in the paper, with some basic annotations (tissue type, sample size, reference).

      This has now been incorporated in Supplementary Table 11.

      17) Can the authors add references to their sentence in the Discussion on page 17 lines 299-301: "As has been shown before, the phenotype caused by a coding mutation of a developmental gene can be different from the phenotype caused by a mutation in a CRE controlling spatiotemporal expression of this gene."

      We clarified that this phrase referred to the case of PRDM13, for which bi-allelic coding pathogenic variants are linked to hypogonadotropic hypogonadism and perinatal brainstem dysfunction in combination with cerebellar hypoplasia (Whittaker et al., 2021), while non-coding variants within its regulatory regions are associated with NCMD.

      Reviewer #2:

      Minor discretionary suggestions for improving the presentation:

      1) Wherever a specific UCNE, Vista enhancer or ENCODE cCRE is mentioned, the element should be identified by name or accession code: For instance (Iine 212): "this variant is located within a UCNE (PAX6_Veronica) that is catalogued as a cCRE in ENCODE (EH38E1530321)". UCNE names are particularly important, because they are systematically used as identifiers in the supplemental Tables and thus would enable the reader to easily find additional information about the element mentioned in the main text.

      We have now explicitly included all corresponding identifiers throughout the text.

      2) I also recommend inclusion of the UCNE, Vista and ENCODE cCRE tracks in all genome browser screen shots. The UCNE track is currently included only in Figure 1. Vista and ENCODE cCRE tracks are missing in all browser views.

      We have now included UCNE, VISTA, and ENCODE cCREs tracks in the main genome browser figures (Figures 1 and 4).

      3) Supplementary Table 6: It would be useful to indicate for each variant, the type of ophthalmological disorder (Table S5, column C) it is associated with.

      We agree this is a relevant point. However, due to limitations in the (bulk) export of clinical information from the protected Research Environment of Genomics England, inclusion of this type of information is not feasible.

      4) Fig S2 and supplementary Table 3 are not referred to in the main Text.

      We have corrected this and updated the figure and table accordingly.

      5) Supplementary Table 8: The Table caption should be expanded.

      The contents of each column should be explained. For instance, column F: what means Homo_sapiens|M01298_1.94d|Zoo_01|2337? Where does this information come from, what data and software resources were used?

      We have expanded the caption of this table to clarify this output, which is derived from the QBiC-Pred tool, a software used for predicting quantitative TF binding changes due to nucleotide variants.

      6) Line 401 probable typo: 103-105 days (103-125?)

      Indeed, this typo has now been corrected.

      Reviewer #3:

      1) Given that UCNE only accounts for a small fraction of gene regulatory elements, this study is likely with low sensitivity in terms of identifying potential regulatory mutations. Although one would expect that variants in UCNE are more likely to be pathogenic, it is hard to extrapolate from the results to assess the contribution of gene regulatory variant to the disease.

      We agree that restricting our analysis to these particular regions is one of the limitations of the study, as stated in the Discussion section (line 304-311). However, one of our main aims was to provide a strategy to reduce the search space for pathogenic variants with a potential regulatory effect. Given the substantial body of literature supporting a regulatory role for these regions and, particularly, the availability of already-existing functional data, we considered that this set of regions could represent a suitable target for such analysis. Indeed, the features evaluated, and the methods presented in this study could be extrapolated and applied in other settings involving other candidate regulatory regions and/or tissues of interest, and their associated disease-phenotypes, for which, in any case, the overall contribution of regulatory pathogenic variation to disease might vary greatly.

      2) I am wondering how many UCNE overlaps with open chromatin regions specific to the fetal retina and how many UCNE overlaps with adult only. Are UCNEs enriched for developmental genes? If so, how many patients are due to developmental defect?

      We have now integrated into our analysis epigenetic measurements in adult retina, in particular the candidate cis-regulatory elements nominated by Cherry et al. PNAS 2020 (PMID: 32265282) based on accessible chromatin and enrichment for active enhancer-related histone modifications in adult human retina. Details about the integration of this dataset as well as the results and their corresponding interpretation have been incorporated in the Methods (lines 372-374), Results (115-117; Supplementary Table 2), and Discussion (lines 271-273) sections accordingly. In particular, out of the 111 UCNEs identified to display the active enhancer mark H3K27ac, 33 were found to maintain this signature at adult stage. Regarding the specific question from the reviewer, the majority of UCNEs overlapping with open chromatin regions are specific to the fetal retina (1,346), with only 7 UCNEs overlapping with open chromatin regions exclusively in adult state. This indeed further supports the major role of the identified candidate cis-regulatory UCNEs in the regulation of developmental gene expression programs, which was already suggested by the Gene Ontology enrichment analysis performed using the set of UCNE target genes as input (Figure 2C; new Supplementary Table 3). As far as the number of patients with development defects that were included in this study, these included: corneal abnormalities (n=62), Leber congenital amaurosis (n=142), ocular coloboma (n=111), developmental foveal and macular dystrophy (n=230), developmental glaucoma (n=94), anophthalmia or microphthalmia (n=120).

      3) I am wondering if the 431 ultrarare variants found in the UCNEs is higher than expected. This can be tested by comparing patients without visual disorders.

      Although it is indeed a relevant point, retrieving sequencing data from patients without visual disorders is not feasible for us. As it is a restricted research environment, we are only allowed to query sequencing data corresponding to participants enrolled within the framework of our specific sub-domain, namely “Hearing and Sight”, and therefore evaluating additional patients from other sub-domains is not doable. Based on previous studies and our observations, common variants are precisely the ones depleted within UCNEs, while ultrarare variation seems to occur at levels comparable to those observed elsewhere in the genome. Therefore, it is reasonable to speculate that this amount of ultrarare variants is not higher than expected as compared to patients without visual disorders. To further demonstrate the high intolerance of UCNEs to common variation, we have included an evaluation of the distribution of genome-wide residual variation intolerance score (gwRVIS) values compared to a set of randomly selected genomic regions in a human reference cohort (lines 173-178; 487-495; Fig. 3C). Additionally, to address this question further, we have also generated allele frequency distributions for all variants retrieved within a selection of 25 disease-gene associated loci and their corresponding UCNEs in order to assess the specificity of the overlap between rare variants and UCNE regions (lines 181-182, 496-501; Figure S2).

      4) It seems that the ultrarare variants listed in sup table 6 are more abundant in a small number of genes. Is this due to the number/size of UCNEs is larger in these genes?

      Indeed, the clustering of UCNEs in genomic regions containing genes coding for transcription factors and developmental regulators (e.g., OTX2, PAX6, ZEB2) seems to be one of their intrinsic properties, hence the observed enrichment for a small number of genes. One reason can be that these neighboring UCNEs cooperate to achieve higher degrees of tissue-specific regulatory accuracy needed for these genes.

      5) The variant in the putative Pax6 gene regulatory element is intriguing. It would be much more informative if the enhancer with and without the variant is tested in parallel in fish.

      That is a very relevant point. We have now tested the effect of this SNV in the UCNE on the reported expression pattern using the same experimental setup that we used for testing the wild-type construct, namely transgenic enhancer zebrafish assays. However, we could not obtain conclusive results, most likely due to the limitations posed by testing these regions outside their native genomic context. We have incorporated the details, results, and interpretation of the assays performed mutant construct in the Methods (lines 525-527; Supplementary Table 12), Results (lines 235-238; Supplementary Table 10), and Discussion (lines 350-353) sections.

      6) (optional) it would be quite interesting to check the phenotype in fish or mice with the element repressed via technique such as CRISPRi.

      Indeed, we fully agree that CRISPR-based techniques would be the ideal experimental approaches to further validate the functionality of the PAX6-associated UCNE and the identified variant in their native genomic context. Conducting these detailed and focused mechanistic studies is, however, beyond the scope of the present work, for which the main focus was the identification and functional annotation of ultraconserved cCREs.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In the report, the authors combined bulk and single cell multi-omics data from the retina to identify ultraconserved noncoding elements (UCNE) that might function as regulatory elements based on chromatin openness, DNAse sensitive regions, and histone marks. The candidate UCNEs are intersected with whole genome sequencing data from 3.220 patients with rare eye disease to identify potential rare variants that might affect the activity of UNCE. The goal of the project is intriguing.

      My comments are listed below:

      1. Given that UCNE only accounts for a small fraction of gene regulatory elements, this study is likely with low sensitivity in terms of identifying potential regulatory mutations. Although one would expect that variants in UCNE are more likely to be pathogenic, it is hard to extrapolate from the results to assess the contribution of gene regulatory variant to the disease.
      2. I am wondering how many UCNE overlaps with open chromatin regions specific to the fetal retina and how many UCNE overlaps with adult only. Are UCNEs enriched for developmental genes? If so, how many patients are due to developmental defect?
      3. I am wondering if the 431 ultrarare variants found in the UCNEs is higher than expected. This can be tested by comparing patients without visual disorders.
      4. It seems that the ultrarare variants listed in sup table 6 are more abundant in a small number of genes. Is this due to the number/size of UCNEs is larger in these genes?
      5. The variant in the putative Pax6 gene regulatory element is intriguing. It would be much more informative if the enhancer with and without the variant is tested in parallel in fish.
      6. (optional) it would be quite interesting to check the phenotype in fish or mice with the element repressed via technique such as CRISPRi.

      Significance

      Given that UCNE only accounts for a small fraction of gene regulatory elements, this study is likely with low sensitivity in terms of identifying potential regulatory mutations. Although one would expect that variants in UCNE are more likely to be pathogenic, it is hard to extrapolate from the results to assess the contribution of gene regulatory variant to the disease.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Starting with a comprehensive analysis of multi-omics data, the authors identify a subset of ultra-conserved non-coding elements (UCNEs) likely to play a role in retinal development. Restricting subsequent analyses to these genomic regions, they identify ultra-rare mutations associated with eye disease, using data from the 100k genome project. They then follow-up on one newly discovered, disease associated UCNE and a presumably causal mutation within this UCNE. The follow-up experiments involve fine mapping of the spatiotemporal expression pattern of a UCNE-driven reporter gene in zebra fish, as well as a re-examination of the disease phenotype in carriers of the mutation.

      The computational pipeline used for prioritization of UCNEs is sound. The evidence supporting the claim that the identified ultra-rare SNV is causal is highly convincing. This study also constitutes proof of concept for a novel methodology to search for causal disease associated mutations in the nowadays still under-investigated non-coding part of the genome.

      The paper is clearly written. Methods are described in enough detail to allow for reproduction of the results. Overall, this study is of high scientific quality, self-contained, and complete. Publication in a peer-reviewed journal should not be delayed by additional, perhaps interesting but non-essential experiments.

      However, if the authors intend to undertake similar studies in the future, I would recommend to carry out the reporter-gene assays in zebrafish with both the wild-type and the mutant version of the UCNE. Comparison of the spatiotemporal expression patterns of the two alleles could provide valuable insights into the mechanism of action of the deleterious mutation under investigation.

      Minor discretionary suggestions for improving the presentation:

      Wherever a specific UCNE, Vista enhancer or ENCODE cCRE is mentioned, the element should be identified by name or accession code: For instance (Iine 212):

      "this variant is located within a UCNE (PAX6_Veronica) that is catalogued as a cCRE in ENCODE (EH38E1530321)"

      UCNE names are particularly important, because they are systematically used as identifiers in the supplemental Tables and thus would enable the reader to easily find additional information about the element mentioned in the main text.

      I also recommend inclusion of the UCNE, Vista and ENCODE cCRE tracks in all genome browser screen shots. The UCNE track is currently included only in Figure 1. Vista and ENCODE cCRE tracks are missing in all browser views.

      Supplementary Table 6: It would be useful to indicate for each variant, the type of ophthalmological disorder (Table S5, column C) it is associated with.

      Fig S2 and supplementary Table 3 are not referred to in the main Text.

      Supplementary Table 8: The Table caption should be expanded. The contents of each column should be explained. For instance, column F: what means Homo_sapiens|M01298_1.94d|Zoo_01|2337? Where does this information come from, what data and software resources were used?

      Line 401 probable typo: 103-105 days (103-125?)

      Significance

      This work is of interest to different research communities: Biomedical researchers working on neural disorders, human geneticists engaged in GWAS studies, computational biologists trying to make sense out of omics data, molecular biologists exploring the "dark matter" of the genome, and finally the small community tackling the enigma of UCNEs. As with many omics papers, the most valuable parts of this study are in the supplemental tables, in particular tables 1,4, and 6. It can be hoped that some prospective readers will follow up on the leads presented in these tables.

      The detailed computational and experimental characterization of a likely causal ultra-rare disease associated mutation may serve as a guiding and motivating example for medical geneticists working on other syndromes.

      Back to UCNEs: They are enigmatic entities, which so far have largely resisted molecular and physiological characterization. It took 10 years to finally uncover a phenotype in ko mice missing one or several UCNEs, after the surprising initial observation that such mice were viable and fertile. The difficulties in studying the function of UCNEs may be due to their conjectured pleiotropic activity in different cell types at different developmental stages, their apparent cooperative interactions with many other control elements (limiting the power of reporter gene assays with single elements), and their putative involvement in morphogenetic processes (minimizing the relevance of epigenetic data collected from cell lines). In view of these considerations, I consider UCNE research starting from human disease phenotypes more promising, than ab initio approaches using reverse genetics in model organisms.

      The impact of this paper is potentially very high. Note the following statement in the paper:

      "For each instance for which only the UCNE variant remained as candidate, we placed a clinical collaboration request with Genomics England."

      We thus can expect more exiting stories from the same team. The strategy and computational pipeline introduced here are of course applicable to other congenital diseases, and it can reasonably be hoped that researchers inspired by this study will apply components of the methodology in other contexts. The prioritization of UCNEs in studying the "dark matter" of the genome and the "missing heredity" would likely lead to new insights into the function of these enigmatic elements and the reasons for their extreme conservation.

      My background: I'm a bioinformatician with first training in molecular genetics. My research focus is on gene regulation: promoters, enhancers, transcription factor binding sites. I also made some contributions to the UCNE field, having co-developed UNCEbase with Slavica Dimitrieva. On the other hand, I don't claim to be an expert in medical genetics, and more specifically, I know very little about eye diseases and retinal development.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      In the manuscript entitled "Multi-omics analysis in human retina uncovers ultraconserved cis-regulatory elements at rare eye disease loci", Soriano et al. explore the role of ultraconserved noncoding elements (UCNEs) as candidate cis-regulators (cCREs) in developing and adult human retina by integrating UCNEs with multi-omic data from fetal and adult human retina. They further examine the potential contribution of UCNEs to rare eye diseases by testing for rare variants that fall in UCNEs that are potentially active in retina in patients with inherited retina degeneration diseases (IRDs), using whole genome sequencing (WGS) data from Genomics England. This work is based on the assumption that genomic regions under strong evolutionary constrain are good predictors of important functionality. The authors use 4,135 UCNEs identified in Dimitrieva and Bucher, 2013, defined as sequences with more than 95% identity between human and chicken with >200bp in length. By integrating bulk tissue RNA-Seq, single cell (sc)RNA-Seq, DNAase-Seq, scATAC-Seq and ChIP-Seq from retinal tissues from different developmental stages and adulthood with the 4,135 UCNEs, they identified one third of UCNEs (1,487) that may be associated with various retinal development stages. Using bioinformatic approaches they identify potential target genes for 724 UCNEs that may be regulated in cis. Based on ATAC-Seq, the authors show that 834 UCNEs fall in open chromatin regions, and of these 111 have active histone markers, supporting an active functional role for the identified UCNEs. The authors demonstrate an application of this approach in identifying potential pathogenic noncoding variants for rare eye diseases. Using WGS from 100,000 Genomes project the authors identify 45 UCNEs that were bioinformatically associated with mendelian IRD genes that contain rare variants, proposing potential solutions for unsolved cases. They demonstrate the utility of their analysis by highlighting an ultra-rare SNP they identified in a UCNE candidate CRE located upstream of PAX6 that belongs to a family of genes with foveal abnormalities. They confirm the effect of the UCNE 150k upstream of PAX6 on gene expression in the eye, forebrain and neuronal tube using an enhancer reporter assay in Zebrafish.

      The authors demonstrate a strategy for narrowing down the genomic space to putative functional noncoding regions involved in development and that may contribute to rare disease. This work that integrates various genomic modalities is of broad interest and can be applied to other diseases and tissues. There are several points that should be addressed to assess the robustness of the results and strengthen the conclusions of the paper, and in some places to better clarify the analyses conducted.

      Major edits:

      1. In the introduction the authors list 4 databases of ultra-conserved non-coding elements, and choose to work with the UCNEbase that detects UCNE regions by comparing human and chicken, as they state that it is one of the most comprehensive resources. Can the authors comment on the extent of overlap of UCNE regions identified in this database compared to other databases. It would also be helpful to add an explanation in the Introduction on the advantage of comparing the human genome to the chicken genome, e.g., is chicken the most distant vertebrate with a high quality genome, or another reason? And can the authors comment on the extent of conservation of the UCNEs compared to other species - in the UCNEbase paper, orthologues for the UCNEs are identified in 18 vertebrate species including reptiles, amphibians and fish.
      2. The authors briefly describe how potential target genes were assigned to UCNEs in the Method section (section begins on page 21, line 407 and on lines 379-381). They note that they used the Genomic Regions Enrichment of Annotations Tool (GREAT). Can the authors provide additional details on what this method does and also provide a high level sentence in the Results section on page 8, lines 144-146, on how target genes were assigned to UCNEs, as well as in the Discussion on page 16, line 289. Based on the Methods description on lines 409-414, a UCNE was associated with any gene within 1Mb of the UNCE that was expressed in retina and whose curated regulatory domains overlapped the UNCE. Is this correct? How were the regulatory domains curated (line 411-412)? Can the authors please clarify this important point.

      There are other approaches for linking putative transcriptionally active genomic regions with target genes in specific tissues or cell types through correlation analysis of ATAC-seq peaks (chromatin accessibility) and gene expression in RNA-seq data. A commonly used peak-to-gene linkage method is implemented in ArchR (Granja et al, 2021, PMID: 33633365). The authors note that they used scATAC-seq gene scores and scRNA-seq gene expression to further characterize the proposed target genes of UCNEs. It is not clear what the authors mean by "scATAC-seq gene scores". Please define "scATAC-seq gene score" and add a reference. Can the authors compare the target gene mapping to UCNEs using GREAT and gene expression filtering to that using peak-to-gene linkage based on retina tissue or single cell ATAC-seq and RNA-seq data?

      For gene expression filtering (line 419) the authors quantify transcript expression of retina from FASTQ samples using the Kallisto method, and then note that they did the filtering on gene expression levels (TPM<0.5). Please add details on how you went from transcript expression levels to gene expression levels for the filtering, or was the filtering performed at the transcript level?<br /> 3. The authors use the words "active UCNE", first mentioned in the Results on line 144. Can the authors define what they mean by "active UCNE". What information/evidence is used to ascertain that a UCNE is indeed active. Overlap of a UCNE with a chromatin accessibility region from ATAC-seq or DNAase-Seq would only suggest that the UCNE may be active. Intersection with enhancer activity measured with in vivo enhancer reporter assays in transgenic mice from the VISTA enhancer browser provides stronger evidence of transcriptional activity. The authors might want to distinguish between putatively actively and active based on the functional support.<br /> 4. The authors assessed the significance of depletion of common variation (MAF>1%) in the UCNE regions compared to a background of randomly selected genomic regions. In generating the random distribution of regions, did the authors match on the distribution of distances of the UNCEs to the TSS of genes in the randomly selected regions? This may be a confounder.

      Also, in the legend of Figure 3, lines 191-192, it is stated: "Variant population frequencies within putative retinal UCNEs normalized to a background composed of randomly selected sequences (see Methods).", but we did not find a description of this analysis in the Methods section.<br /> 5. In regards to intersecting UCNEs with epigenetic marks that detect active or repressed enhancers in retina, the authors used data from Aldiri et al 217 that measured epigenetic changes during retinal development. Did this dataset contain epigenetic measurements in adult retina? The authors might want to consider using the epigenetic marks/ChIP-seq data from adult human retina in Cherry et al. PNAS 2020 (PMID: 32265282)<br /> 6. With respect to the examination of rare variants that may be associated with rare eye disease in retina active UCNEs, for the interpretation of the results, it would be helpful to get more information on the distribution of rare variants found in UCNEs associated in this study to known IRD genes in all affected individuals in families, if this information is available in the 100,000 Genomes Project.<br /> 7. In the Methods section on lines 450-451, the authors mention that they performed variant screening of retinal disease genes, referencing the Genomics England Retinal Disorder panel and Martin et al., 2019. Can the authors add to the Methods and Results sections how many retinal disease genes were initially tested. Also, to get a sense of the specificity of the overlap of rare variants in the 100k Genome Project cohort with UNCE regions, it would be informative to show a distribution of the number of rare variants <0.5% that passed the filtering in gnomAD per eye disease gene before the overlap with UNCEs.<br /> 8. The authors found "an ultrarare SNV (chr11:31968001T>C) within a candidate cis-regulatory UCNE located ~150kb upstream of PAX6. This variant was found in four individuals of a family segregating autosomal dominant foveal abnormalities". They tested the functional effect of this element with a reporter assay in zebrafish and found that the UNCE affects expression in the eye, forebrain, and neural tube. It would add further value if the authors were to test the effect of this SNV in the UCNE on the reporter expression pattern, using CRISPR/cas9?<br /> 9. The authors found rare variants in UCNEs linked to 45 IRD genes. Can the authors provide additional information on the functional genomic annotations of these UCNEs and distance to the target genes. The UCNEs were characterized with respect to their genic features in the original paper (UCNEbase, Dimitrieva et al., NAR, 2013), e.g., intergenic, intronic and 3'/5' UTR. Also, it would be useful for clinical applications to provide the start and end positions of the UCNEs that contain the rare variants associated with their 45 IRD genes in Supplementary Table 6.<br /> 10. A total of 724 target genes were assigned to 1,487 UCNEs that displayed candidate cis-regulatory activity. Given the interest in using UNCEs to help identify potential pathogenic mutations that lead to IRDs, can the authors note in the Results section how many of the 724 target genes are IRDs.<br /> 11. In the Discussion on page 15 line 259, can the authors clarify if variation found in UNCEs were only associated with rare disease or also with common diseases.

      Minor edits:

      1. In abstract, the authors might consider changing the words "rare eye diseases" on lines 20 and 22 to "rare retina degeneration diseases", and on lines 88-89.
      2. In the Introduction on line 49, there seems to be a typo in the number of UCNE regions reported. 4,135 UCNE regions is supposed to be 4,351, based on the original paper (https://academic.oup.com/nar/article/41/D1/D101/1057253).
      3. In the introduction on lines 75-76, these references: Lyu et al., Cell Reports 2021, PMID: 34788628, and Zhang et al., Trends in Genetics 2023, PMID: 37423870, could be added to the following sentence to provide additional: "This cellular complexity is the result of spatiotemporally controlled gene expression programs during retinal development,"
      4. On lines 77 and 84, I would write IRD as plural: IRDs.
      5. In introduction on lines 89-90, it can be further added that you provide experimental support for an ultra rare SNV in a cis regulatory UCNE affecting PAX6.
      6. On line 98, the authors refer to Figure 1A when noting that the integration of UCNEs with multi-omics data in human retina allows to evaluate the regulatory capacity of UCNEs across the major developmental stages of human retina. However panel A in figure 1 does not seem to show this point. It shows the comparison of elements across species. Please make appropriate changes to the main text and figure legend.
      7. Please explain what the names appended to the gene symbols in the first column "UCNE ID" in Supplementary Tables 1 and 2 refer to.
      8. On line 145, can the authors clarify what they mean by "active gene expression in the retina". Is this just another way of referring to genes found to be expressed in retina? If so, it might be clearer just to write: "We annotated the identified active UCNEs to assign them potential target genes and thus assess their association with genes expressed in the retina"
      9. One line 156, I would write "regulation of transcription" as listed in the gene ontology terms in Figure 2C, instead of "regulation of gene expression". The authors might want to add this to the Discussion. Can the authors include the full gene set enrichment results from Enrichr in a supplementary table at Padj<0.05 since only the top gene sets are shown in Fig. 2C (at P<1E-13)?
      10. On page 12, line 214, what does "EH38E1530321" Stand for? It seems to specify a distal enhancer-like signatures in bipolar neurons, but I couldn't find this ID in any database.
      11. In the Methods section on lines 391-392, can the authors give some high-level explanation of the unconstrained integration method: "Single-nucleus RNA-seq of the same tissue and timepoints (GSE183684) were integrated using the unconstrained integration method". Also, can they comment on how retinal cell class identities were assigned (line 393). Was it based on known markers or on previous identification of cell classes and highly variable genes between clusters?
      12. In the integration of UCNEs with bulk and single cell ATAC-seq and DNase hypersentitivity regions, can the authors note in the Methods section (lines 400-404) what peak width was used to test for overlap with the UCNEs.
      13. On line 436, the word 'and' is missing between "(SNVs, and indels < 50bp)" and "large structural variants".
      14. On lines 443-444, please provide references to the computational tools listed. Please note if default settings/parameters were used.
      15. In the following sentence in the Methods section on lines 447-449, it is not clear in the Results section how this was used in the flow of the analysis, and how many cases showed such a similarity in phenotype: "For each candidate variant, we compared the similarities between the participant phenotype (HPO terms) and the ones known for its target gene through literature search and clinical assessment by the recruiting clinician when possible." Can the authors add more detail to the Results section.
      16. It would be helpful to have a table that describes the different omics datasets used in the paper, with some basic annotations (tissue type, sample size, reference)
      17. Can the authors add references to their sentence in the Discussion on page 17 lines 299-301: "As has been shown before, the phenotype caused by a coding mutation of a developmental gene can be different from the phenotype caused by a mutation in a CRE controlling spatiotemporal expression of this gene."

      Significance

      General assessment: This is the first study to our knowledge to integrate ultraconserved noncoding elements (UNCEs) with a range of multi-omic data to identify UNCEs that may be active and their target genes in a specific tissue, in this case human retina. They also experimentally test one of the UNCE predicted to affect the expression of a given gene in retina (and potentially other tissues) in Zebrafish and confirm its transcriptional activity in the eye, to provide some functional support to their strategy. This study also demonstrates the potential value of inspecting UCNEs in prioritizing pathogenic mutations for rare disease. One limitation is the lack of statistical significance assessment of the potential causal effect of a rare variant found in a UCNE on the expression of its predicted target gene, which is a rare eye disease gene, since the linkage of the UCNE to the disease gene was performed based on bioinformatic analysis of multi-omic data. Experimental testing of the effect of some of these mutations on their target gene expression could provide additional support.

      Advance: This study addresses an important unsolved problem in the field of human genetics and rare diseases, namely the challenge of identifying pathogenic mutations that lead to rare Mendelian diseases, in particular, in noncoding regions in unsolved cases. This is the first study to consider UCNEs together with tissue or cell type specific expression, epigenetics and chromatin accessibility in detecting pathogenic mutations for retina degeneration diseases. See for example Ellingford et al., Genome Medicine 2023 (PMID: 35850704). Their demonstration of rare variants in UCNE associated with inherited retinal degeneration diseases in patients with IRD in the 100k Genomics Project suggests that the role of UCNEs in disease should be further investigated and functionally tested. This work could have important clinical implications, and also proposes a strategy for integrating UCNEs with multi-omic and genomic data.

      Audience: This work will be of interest to the human genetics and genomics community, in particular to researchers interested in uncovering the genetic basis and causal mechanisms of rare diseases, and to scientists interested in clinical applications of genetic variation. This work will also be of interest to scientists interested more broadly in understanding the regulatory effects of the noncoding regions in the genome.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1:

      1. If doable, image dynein and dynactin simultaneously in the Halo-DYNC1H1/DCTN4-SNAP iNeurons. Co-movement of dynein and dynactin towards the somatodendritic compartment and their separate movement in the anterograde direction along the axon would provide the most convincing evidence for the key claims of the manuscript.

      Please see the planned revision section for our response

      Reviewer #2:

      Major comment (requires additional experimentation)

      1. While the data presented do certainly suggest that dynein and Lis1 are transported anterogradely on separate vesicular cargoes from dynactin and Ndel1, the study would be much stronger if supported by dual imaging of dynein and dynactin to prove that these proteins do indeed move in association with separate vesicular populations. I would like to see dual-color kymograph traces showing that the proteins move independently. The authors should be able to accomplish this using their dual Halo-DYNC1H1/DCTN4-SNAP hESC line. To acquire and analyze this data might take several months, but it would greatly strengthen this paper. If the authors do this experiment, they may also be able to address the mechanism of reversal of anterograde cargoes which they speculate about in the Discussion, which would add even more interest and insight.

      Please see the planned revision section for our response

      Minor comments (addressable without additional experimentation)

      1. The authors deduce that 1-4 Halo fluorochromes corresponds to 1-2 dynein molecules. This implies that the cells are homozygous for the Halo tag, but I do not see this addressed explicitly. The authors should state explicitly whether the lines generated for their study are heterozygous or homozygous for the tag. If the cells are heterozygous, which would seem most likely, then they may be underestimating the number of dyneins per spot and should take this into account.

      We have added whether lines are homozygous or heterozygous to the manuscript. We also include a new Supplementary Figure panel (Fig S6) showing the genotyping data. In summary, all lines are homozygous except for PAFAH1B1-Halo (hESCs) which is heterozygous.

      1. Why are the moving spots lower in intensity than the NEM-treated static spots. It appears to suggest that they may be associated with different structures. This should be clarified and discussed.

      Our data suggest that the fast-moving spots have fewer dyneins than NEM treated static spots. We suggest this is because the fast-moving cargos are smaller than the average cargo and therefore have fewer dyneins on them. This is also supported by the smaller number of dyneins reported previously on endosomes as compared to the large lysosomes. We have clarified this in the discussion (page 7-8).

      1. The authors state in the Results that most of the dynein spots were diffusing, often along microtubules, but they do not visualize microtubules so how do they know this? They may need to remove the phrase "often along microtubules".

      This has been removed.

      1. At the end of the Introduction the authors state that their data "allow us to understand how the dynein machinery drives long-range transport in the axon". This is an overstatement. The "how" in this sentence is not addressed in this study.

      We have softened the sentence by adding the phrase “better understand”.

      1. The conclusion that dynein binds to cargos stably throughout their transport along the axon is based on measurements of the fastest moving cargoes but the authors do not provide data on the distribution of velocities for the entire population of retrograde cargoes. It is not valid to extrapolate the behavior of a small number of cargoes to the entire population. The average may be much slower than the fastest cargoes. Moreover, even for the fastest organelles the authors cannot say that the dynein is stably bound because they did not track single cargoes and thus do not know that the cargoes moved continuously in one single bout of movement for 500 µm; it is possible that the cargoes moved in multiple consecutive bouts interrupted by brief pauses and dynein motors may have exchanged between bouts.

      We have added a section to the discussion to highlight that other cargos may behave differently from the fastest ones (page 7). We have also clarified the assumptions that lead us to expect a slower arrival time of the first signal (page 5).

      1. The authors say that "it is clear that at least some dyneins remain on cargoes throughout their transport along the axon". As explained above, the data do not prove this so this statement should be removed.

      We have softened this sentence from “it is clear” to “our results suggest” and explained in more detail why we make this conclusion

      1. The authors note that most of the dynein spots were not moving processively and state that this is consistent with prior studies showing that only a subset of dynein is actively involved in transport. However, as they note elsewhere, dynein is both motor and cargo and most axonal dynein is transported at slow average velocities so maybe they should be more explicit about what they mean by "involved in transport".

      We have clarified we mean fast axonal transport and thank the reviewer for highlighting this point.

      1. When the authors note that most of the dynein in axons is transported in the slow component of axonal transport, they should also cite the work of Pfister and colleagues who were the first to show this (PMID 8824315 and 8552592).

      This was an omission on our part. The references have now been added.

      1. The authors propose that dynein and Lis1 are transported together but there were significantly fewer anterogradely transported Lis1 particles than dynein particles. This should be discussed.

      We have added more information to the discussion. Although we cannot rule out this effect being due to the heterozygous tagging of our LIS1 cell line, we do not witness the same decrease in events in the retrograde direction. Therefore, we believe there is a subset of anterogradely moving dynein lacking LIS1. As discussed in the manuscript, this subset may already be bound to dynactin and therefore not require LIS1.

      1. For the statistical analysis, the authors should provide p values in the legends for the comparisons that are judged to be "not significant". The authors should also be consistent in how they label differences that are not significant - they mark them as "ns" in Fig. 1, but in the other figures they do not, leaving some ambiguity about whether particular comparisons were not tested or were found to be not significant. For example, in Fig. 4C the average speed of the dynactin is about 0.5 µm/s greater than for the other proteins and the spread in the data suggest that this could be significant, but no significance is indicated on the plot, implying p>0.05. It is not clear how confident we can be that there is no difference.

      We have now included all p values in the figure legends and have removed the “ns” in Fig 1D. In our revised manuscript, only significant differences are highlighted in the figures.

      Reviewer #3:

      • if I look at the kymographs, trajectories appear rather complex, pausing, standing still, moving and everything mixed. The explanation of how actual trajectories are extracted and on what basis is very short, too short for me. I think the authors should expand this. Furthermore, I think it would be good if the authors would present, in their kymographs examples of the tracked (and also the not included) tracks. Maybe in supplementary info.

      The analysis of this data used the Trackmate Fiji plugin. This tracks spots frame to frame in a movie and then outputs the data of the tracks. No data was extracted from kymographs but they were used as a graphical illustration of the moving spots. To better explain our analysis pipeline, we have expanded our methods section and have added an example of a tracked movie (Video 15) as well as highlighted the tracked spots in one kymograph example (Figure 7S).

      • I found 'velocity' ill defined. I get the impression, judging from the number of points (compared to the other parameters) that the authors determine the average velocity of each individual trajectory. That is an important parameter (but should indeed be called 'trajectory averaged' velocity), but might not be the only one useful to learn from the data, where trajectories do not always appear to have constant speeds (pausing, etc.). Why do the authors not determine point-to-point velocities and plot histograms of those for all the trajectories (simply plot histograms of all the displacements between subsequent data points in trajectories)? This might provide great insight into the actual maximum velocity and the fraction of pausing or moving in opposite direction etc., providing much more molecular detail than currently extracted from the data.

      The reviewer is correct. We have measured the average velocity of the spots from the beginning of the track to the end. We have clarified this in the text. Furthermore, as stated above in the revision plan, we are currently doing the additional analysis and will include it in the final revision

      • I was a bit surprised to read that the authors have gone to the effort to create a dual-color labeled cell line, but did not do actual correlative two-color measurements (or at least show them). It would be so insightful to see dynein and dynactin move separately in the anterograde direction.

      Please see the planned revision section for our response.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Fellows and coauthors present a signle-molecule study toward dynein regulation in axons. They observe that dynein in vivo makes very long runs and that regulators LIS1 and NDEL1 cotransport with dynein all the (retrograde way). Remarkably, different components of the dynein complex appear to be transported in different ways/velocities in the antorograde direction. Overall experiments are well conducted, I only have a couple of important questions regarding data analysis. Some aspects should be explained better, more steps should be shown and here and there I think the authors could, with minimal effort, obtain much more out of their data (see below). Nevertheless, I think this is an important study, on of the first single-molecule efforts to understand axonal transport in the cell (see below). Key findings are important for our understanding of dynein regulation.

      My concerns:

      • if I look at the kymographs, trajectories appear rather complex, pausing, standing still, moving and everything mixed. The explanation of how actual trajectories are extracted and on what basis is very short, too short for me. I think the authors should expand this. Furthermore, I think it would be good if the authors would present, in their kymographs examples of the tracked (and also the not included) tracks. Maybe in supplementary info.
      • I found 'velocity' ill defined. I get the impression, judging from the number of points (compared to the other parameters) that the authors determine the average velocity of each individual trajectory. That is an important parameter (but should indeed be called 'trajectory averaged' velocity), but might not be the only one useful to learn from the data, where trajectories do not always appear to have constant speeds (pausing, etc.). Why do the authors not determine point-to-point velocities and plot histograms of those for all the trajectories (simply plot histograms of all the displacements between subsequent data points in trajectories)? This might provide great insight into the actual maximum velocity and the fraction of pausing or moving in opposite direction etc., providing much more molecular detail than currently extracted from the data.
      • I was a bit surprised to read that the authors have gone to the effort to create a dual-color labeled cell line, but did not do actual correlative two-color measurements (or at least show them). It would be so insightful to see dynein and dynactin move separately in the anterograde direction.

      Referee Cross-Commenting

      I think we agree on the key points:<br /> - in principle, great study<br /> - quantification / tracking could go a bit further and should be explained better<br /> - manuscript / conclusions would be strengthened substantially if the authors could do some 2-color experiments to correlated dynein / dynactin movements in anterograde vs retrograde direction.

      Significance

      I think this is an important and exciting manuscript. As an in vivo single-molecule biophysicist with great interest in intracellular transport, I have been astonished in the lack of people trying to take single-molecule data on the motor involved, in particular neurons. I believe this is the only way to find out how transport actually works and what role motors play. Mutants is not enough, bulk data is not enough, in vitro is not enough. This is what the field needs (and many in the field do not seem to be aware of this...). Great that Fellows and coauthors took on this task and show some really exciting data. I am not an expert on their stem-cell labeling approach so cannot judge on that. The imaging seems to be done well. As discussed above, I think there might be much more in the data than the authors now get out, so I would encourage them to do some additional analysis. But overall, this effort is important and I think the conclusions will stand and provide important new insights in dynein regulation in the cell.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary - The authors use a CRISPR knock-in gene editing strategy to label endogenous dynein, dynactin (p62 or Arp11) and dynein regulators (Ndel1 and Lis1) with Halo or SNAP tags. They do this in human iPSC and ESC cell lines engineered to express doxycycline-inducible NGN2 cloned into a "safe harbor" site of the genome. They induce the cells to differentiate into iNeurons using doxycycline and image the tagged proteins in axons with single molecule sensitivity using HILO illumination. The paper is clearly written, the description of the methods is thorough, and the data and figures (including the videos) are of good quality. The use of gene editing to knock the tags into the endogenous gene loci is a superior strategy to classic overexpression strategies. The authors also make effective use of microfluidic chambers to ensure the axons are uniformly orientated and coaligned over a distance of 500µm.

      Major comment (requires additional experimentation)

      1. While the data presented do certainly suggest that dynein and Lis1 are transported anterogradely on separate vesicular cargoes from dynactin and Ndel1, the study would be much stronger if supported by dual imaging of dynein and dynactin to prove that these proteins do indeed move in association with separate vesicular populations. I would like to see dual-color kymograph traces showing that the proteins move independently. The authors should be able to accomplish this using their dual Halo-DYNC1H1/DCTN4-SNAP hESC line. To acquire and analyze this data might take several months, but it would greatly strengthen this paper. If the authors do this experiment, they may also be able to address the mechanism of reversal of anterograde cargoes which they speculate about in the Discussion, which would add even more interest and insight.

      Minor comments (addressable without additional experimentation)

      1. The authors deduce that 1-4 Halo fluorochromes corresponds to 1-2 dynein molecules. This implies that the cells are homozygous for the Halo tag, but I do not see this addressed explicitly. The authors should state explicitly whether the lines generated for their study are heterozygous or homozygous for the tag. If the cells are heterozygous, which would seem most likely, then they may be underestimating the number of dyneins per spot and should take this into account.
      2. Why are the moving spots lower in intensity than the NEM-treated static spots. It appears to suggest that they may be associated with different structures. This should be clarified and discussed.
      3. The authors state in the Results that most of the dynein spots were diffusing, often along microtubules, but they do not visualize microtubules so how do they know this? They may need to remove the phrase "often along microtubules".
      4. At the end of the Introduction the authors state that their data "allow us to understand how the dynein machinery drives long-range transport in the axon". This is an overstatement. The "how" in this sentence is not addressed in this study.
      5. The conclusion that dynein binds to cargos stably throughout their transport along the axon is based on measurements of the fastest moving cargoes but the authors do not provide data on the distribution of velocities for the entire population of retrograde cargoes. It is not valid to extrapolate the behavior of a small number of cargoes to the entire population. The average may be much slower than the fastest cargoes. Moreover, even for the fastest organelles the authors cannot say that the dynein is stably bound because they did not track single cargoes and thus do not know that the cargoes moved continuously in one single bout of movement for 500 µm; it is possible that the cargoes moved in multiple consecutive bouts interrupted by brief pauses and dynein motors may have exchanged between bouts.
      6. The authors say that "it is clear that at least some dyneins remain on cargoes throughout their transport along the axon". As explained above, the data do not prove this so this statement should be removed.
      7. The authors note that most of the dynein spots were not moving processively and state that this is consistent with prior studies showing that only a subset of dynein is actively involved in transport. However, as they note elsewhere, dynein is both motor and cargo and most axonal dynein is transported at slow average velocities so maybe they should be more explicit about what they mean by "involved in transport".
      8. When the authors note that most of the dynein in axons is transported in the slow component of axonal transport, they should also cite the work of Pfister and colleagues who were the first to show this (PMID 8824315 and 8552592).
      9. The authors propose that dynein and Lis1 are transported together but there were significantly fewer anterogradely transported Lis1 particles than dynein particles. This should be discussed.
      10. For the statistical analysis, the authors should provide p values in the legends for the comparisons that are judged to be "not significant". The authors should also be consistent in how they label differences that are not significant - they mark them as "ns" in Fig. 1, but in the other figures they do not, leaving some ambiguity about whether particular comparisons were not tested or were found to be not significant. For example, in Fig. 4C the average speed of the dynactin is about 0.5 µm/s greater than for the other proteins and the spread in the data suggest that this could be significant, but no significance is indicated on the plot, implying p>0.05. It is not clear how confident we can be that there is no difference.

      Referee Cross-Commenting

      There seems to be agreement among all three reviewers that the authors should perform dual imaging of dynein and dynactin to prove that these proteins do indeed move together in the retrograde direction but separately in the anterograde direction. This would strengthen the study greatly.

      Significance

      General assessment - There are now multiple papers that have analyzed axonal transport of cargoes in iPSC-derived neurons, but this one appears to be the first to do it by tagging dynein motors and with single-molecule sensitivity. The principal conclusions are (1) that dynein is capable of long-range movement in axons and (2) that dynein moves dynein/Lis1 complexes are transported anterogradely in association with distinct cargoes from dynactin/Ndel1 complexes. The former is a modest conclusion and is entirely expected so not very impactful, but the latter is interesting and novel. The difference between the average velocities for the four proteins in the anterograde and retrograde directions is striking. All four move at similar velocities in the retrograde direction but in the anterograde direction, dynein and Lis1 move significantly faster than dynactin and Ndel1. Given these data, it is reasonable to infer that these proteins are being transported in two separate sets of cargoes. As the authors note in their Discussion, this is important because it could provide a mechanism for transporting dynein components anterogradely in a less active form that could then be activated when the components come together in the distal axon. However, I feel that one critical experiment is missing, which is to perform dual labeling of anterogradely transported dynein and dynactin in the same cells (see major comment). Without this experiment, the evidence is indirect.

      Audience - If confirmed by the dual labeling experiment, the authors' conclusions would represent a conceptual and mechanistic insight into the mechanism of bidirectional transport in axons that would be of broad interest to neuronal cell biologists studying neuronal trafficking.

      Expertise - This reviewer has expertise in the neuronal cytoskeleton, live imaging and axonal transport and has some experience working with iPSC-derived neurons.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      To image dynein in the axon at a single-molecule level, Fellows et al. used neuron-inducible human stem cell lines to Halo/SNAP tag endogenous dynein components by gene editing, and visualized fluorescently labeled protein molecules in differentiated neurons in microfluidic chambers by HILO microscopy-based live imaging. Using those cutting edge technologies, the authors demonstrate that in the axon, not only dynein and dynactin but also the dynein regulators LIS1 and NDEL1 can move long distance retrogradely towards the somatodendritic compartment. They also show that dynein /LIS1 move faster than dynactin/NDEL1 in the anterograde direction, suggesting that they are delivered separately to the distal end of the axon. The approach to study subcellular motility of endogenous dynein/dynactin is creative, the data are solid. I would like to suggest one experiment to support more strongly the authors' conclusions:<br /> If doable, image dynein and dynactin simultaneously in the Halo-DYNC1H1/DCTN4-SNAP iNeurons. Comovement of dynein and dynactin towards the somatodendritic compartment and their separate movement in the anterograde direction along the axon would provide the most convincing evidence for the key claims of the manuscript.

      Referee Cross-Commenting

      I agree with Reviewer 2 that the authors should clarify whether the knockin lines for dynein are homozygous. I also agree with both Reviewers 2 and 3 that the authors should do more analysis of the kymographs to obtain more information.

      Significance

      This is an elegant study on dynein motility and transport in vivo. The experimental approaches and findings presented in this manuscript are very valuable contributions to the field of dynein/dynactin and axonal transport. The results showing that dynein/dynactin can move long-range retrogradely in the axon are in good agreement with previous findings that dynein-driven cargo transport is highly processive, and the data suggesting that dynein and dynactin/NDEL1 are trafficked separately to the distal tip of the axon provide new insights into the regulatory mechanisms for the subcellular distribution and activity of molecular motors. Together these findings provide conceptual advances for understanding axonal transport. They will be of great interest to not only scientists in the field of intracellular transport but also those in cellular neurobiology.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity):

      REVIEW COMMENT

      The article titled "The tRNA thiolation-mediated translational control is essential for plant immunity" by Zheng et al. highlights the critical role of tRNA thiolation in Arabidopsis plant immunity through comprehensive analysis, including genetics, transcriptional, translational, and proteomic approaches. Through their investigation, the authors identified a cbp mutant, resulting in the knockout of ROL5, and discovered that ROL5 and CTU2 form a complex responsible for catalyzing the mcm5s2U modification, which plays a pivotal role in immune regulation. The findings from this study unveil a novel regulatory mechanism for plant defense. Undoubtedly, this discovery is innovative and holds significant potential impact. However, before considering publication, it is necessary for the authors to address the various questions raised in the manuscript concerning the experiments and analysis to ensure the reliability of the study's conclusions.

      Response: Thank you very much for your support and suggestions!

      Here is Comments:

      Line 64-65:

      The author mentioned that 'While NPR1 is a positive regulator of SA signaling, NPR3 and NPR4 are negative regulators.' However, several recent discoveries are suggesting that it may not be a definitive fact that NPR3 and NPR4 are negative regulators. Therefore, I recommend the authors to review this section in light of the findings from recent papers and make necessary edits to reflect the most current understanding.

      Response: Thank you for your feedback. Since we mainly focused on NPR1 in this study, we removed this sentence to avoid confusion. We provided additional information about NPR1 in the Introduction section to emphasize the importance of NPR1 (Line 64-68).

      Line 182- & Figure 4:

      The author conducted RNA-seq, Ribo-seq, and proteome analysis. Describing the analysis as "transcriptional and translational" using RNA-seq and proteome data seems not entirely accurate. Proteome data compared with RNA-seq not only reflects translational changes but may also encompass post-translational regulations that contribute to the observed differences. To maintain precision, the title of this section should either be modified to "transcriptional and protein analysis" or, alternatively, compare RNA-seq and Ribo-seq data to demonstrate the transcriptional and translational changes more explicitly.

      Responses: Thank you for your suggestions. We agree with you and thus change the description accordingly throughout the manuscript.

      Line 229-235 and Figure 5C:

      The interpretation of Figure 5C's polysome profiling results is inconclusive. There does not seem to be a noticeable difference in polysomal fractions between the cab mutant and CAM. The observed differences in the overlay of multiple polysome fractions between cab and COM could be primarily influenced by baseline variations rather than a significant decrease in the polynomial fractions in cpg. Therefore, it is necessary to carefully review other relevant papers that discuss polysome fraction data and their analysis. By doing so, the authors can make the appropriate corrections to ensure accurate interpretations.

      Responses: Thank you for your comments. We agree that the difference between cgb and COM was not dramatic visually. This is a common feature of polysome profiling assay (e.g. Extended Data Fig. 1f in Nature 545: 487–490; Fig. 1c in Nature Plants, 9: 289–301). In our case, the difference between polysome fractions was unlikely due to the baseline variation for two reasons. First, baseline variation affects monosome and polysome fractions in the same way. However, our results showed the monosome fraction of cgb is higher than that of COM, whereas the polysome fraction of cgb is lower than that of COM. Second, this result was repeatedly detected. For better visualization, we adjusted the scale of Y axis in the revised manuscript (Figure 5D).

      Line 482 Ion Leakage assay:

      I could not find the ion leakage assay in this manuscript, so I wonder why it is mentioned.

      Response: We are sorry for the mistake. The Ion leakage data were included in previous visions of the manuscript. We removed the data but forgot to remove the corresponding method in the present version.

      Materials and Methods:

      To enhance the reproducibility of the study, the authors should provide a more detailed description of the materials and methods, especially for critical experiments like the Yeast-two-hybrid assays. Clear documentation of specific reagents, strains, and protocols used, along with information on controls, will bolster the validity of the results and facilitate future research in this area.

      Response: Thank you for your suggestions. We provided more details in the methods. For yeast two-hybrid assays, the vector information was included in “Vector constructions” section.

      Minor Point:

      Line 61: There is a space between ')' and '.', which needs to be edited.

      Response: The space was deleted.

      Reviewer #1 (Significance): This study holds significant importance within the field of plant immunity research. The authors have made valuable contributions through their comprehensive analysis, encompassing genetics, transcriptional, translational, and proteomic approaches, to elucidate the critical role of tRNA thiolation in plant immunity. One of the major strengths of this study lies in its ability to shed light on a previously unknown regulatory mechanism for plant defense. By identifying the cbp mutant and investigating the role of ROL5 and CTU2 in catalyzing the mcm5s2U modification, the authors have unveiled a novel aspect of plant immune regulation. This innovative discovery provides a deeper understanding of the intricate molecular processes governing immunity in plants.

      Moreover, the study's findings are not limited to the immediate field of plant immunity but also have broader implications for the scientific community. By employing diverse methodologies, the authors have demonstrated how tRNA thiolation exerts control over both transcriptional and translational reprogramming, revealing intricate links between these processes. This integrative approach sets a precedent for future research in the field of plant molecular biology and opens up new avenues for investigating other aspects of immune regulation.

      In terms of its relevance, the study's findings have the potential to captivate researchers across various disciplines, such as plant biology, molecular genetics, and translational research. The insights gained from this study may inspire researchers to explore further the role of tRNA in other regulation.

      Response: Thank you very much for your positive comments and support!

      Reviewer #2 (Evidence, reproducibility and clarity): The authors presented an intriguing and previously unknown mechanism that the tRNA mcm5s2U modification regulates plant immunity through the SA signaling pathway, specifically by controlling NPR1 translation. The manuscript was well-written and logically structured, allowing for a clear understanding of the research. The authors provided strong and persuasive data to support their key claims. However, further improvement is required to strengthen the conclusion that mcm5s2U regulates plant immunity by controlling NPR1 translation.

      Response: Thank you very much for your positive comments and support!

      Major comments:

      1. NPR1 translation should be examined to verify the Mass Spec (Figure 5B) and polysome profiling data (Figure 5D) by checking the NPR1 protein and mRNA level using antibodies and qPCR, respectively, in the cgb mutant background to establish a concrete confirmation of CGB regulation in NPR1 translation.

      Response: This is a very constructive suggestion. We performed these experiments and found that the transcription levels of NPR1 were similar between COM and cgb both before and after PsmES4326 infection (Figure S2), which is consistent with RNA-Seq data. Consistent with the Mass Spec and polysome profiling data, the NPR1 protein level was much higher in COM than that in cgb(Figure 5C) after Psm ES4326 infection. Together, these data further supported our conclusion that translation of NPR1 is impaired in cgb.

      1. Analyzing the genetic epistasis of CGB and NPR1 to check if CGB regulates plant immunity through the NPR1-dependent SA signal pathway. If the authors' claim is valid, I would expect no addictive effect on bacterial growth in the cgb/npr1 double mutant compared to the single mutants. Due to the broad impact of CGB on plant signaling (Figures 4E and 4F), the SA protection assay, which concentrates on the SA signal pathway, needs to be tested in WT, cgb and npr1 plants as an alternative assay to the genetic epistasis analysis. I expect that the SA-mediated protection is also compromised in cgb mutant background.

      Response: Thank you for your suggestions. We did examine the growth of Psm ES4326 in the cgb npr1_double mutant and found that _cgb npr1 was significantly more susceptible than npr1 and cgb (Figure below). Although the additive effects were observed, this result was not against our conclusion for the following reasons. First, the translation of NPR1 was reduced rather than completely blocked in cgb. In other words, NPR1 still has some function in cgb. But in the cgb npr1 double mutant, the function of NPR1 is completely abolished, which explains why cgb npr1 was more susceptible than cgb. Second, in addition to NPR1, some other immune regulators (such as PAD4, EDS5, and SAG101) were also compromised in cgb(Figure 5B), which explained why cgb npr1 was more susceptible than npr1. Since the result of the genetic analysis was not intuitive, we decided not to include it in the manuscript.

      SA signaling is known to regulate both basal resistance and systemic acquired resistance (SA-mediated protection). We have shown that cgb is defective in the defect of basal resistance, which cgb is sufficient to support our conclusion that the tRNA thiolation is essential for plant immunity. We agree that it is expected that the SA-mediated protection is also compromised in cgb. We will test this in the future study.

      1. Could the authors comment on why using COM instead of WT as a control to perform the majority of the experiments?

      Response: Thank you for your comments. In addition to ROL5, the cgb mutant may have other mutations compared with WT.COM is a complementation line in the cgb background. Therefore, the genetic background between COM and cgb may be more similar than that of WT and cgb.

      1. In Figure 5E, why does ACTIN2 have an enhanced translation while NPR1 shows a compromised one in cgb mutant? How does the mcm5s2U distinguish NPR1 and ACTIN2 codons? Does mcm5s2U modification have both positive and negative roles in regulating protein translation?

      Response: Thank you for raising this question. As previously reported, loss of the mcm5s2U modification causes ribosome pausing at AAA and CAA codons. Therefore, the translation of the mRNAs with more GAA/CAA/AAA codons (called s2 codon) is likely to be affected more dramatically in cgb. We have analyzed the percentage of s2 codon at whole-genome level (Figure below). The average percentage is 8.5%, while NPR1 contains 10.1% s2 codon and actin contains only 4.5% s2 codon. When fewer ribosomes are used for translation of the mRNAs with high s2 codon percentage, more ribosomes are available for translation of the mRNAs with low s2 codon percentage, which may account for the enhanced translation efficiency. To focus on NPR1 and to avoid confusion, we removed the ACTIN data in the revised manuscript.

      1. Specify the protein amount used for the in vitro pull-down assay and agrobacteria concentration used for the tobacco Co-IP assay in the protocol section.

      Response: We added this information in Method section in the revised manuscript.

      4. Delete the SA quantification and Ion leakage assay in the protocol, which are not used in the study.

      Response: We are sorry for the mistake. The SA quantification and ion leakage data were included in previous visions of the manuscript. We removed the data but forgot to remove the corresponding method in the present version. We deleted them in the revised manuscript.

      1. The strain Pst DC3000 avrRPT2 was not used in this study. Please remove it.

      Response: We are sorry for the mistake. The strain Pst DC3000 avrRPT2 was used for ion leakage assay in previous visions of the manuscript. We deleted it in the revised manuscript.

      1. In Figure 5F, did the 59 genes tested overlap with the 366 attenuated proteins in the cgb mutant? Were the 59 genes translationally regulated?

      Response: Thank you for your suggestion. Venn diagram analysis revealed that 12 genes (about 20%) are also attenuated proteins, suggesting that the mcm5s2U modification regulates the translation of some SA-responsive genes.

      Reviewer #2 (Significance): The authors' study is significant as it establishes the first connection between tRNA mcm5s2U modification and plant immunity, specifically by regulating NPR1 protein translation. This research expands our understanding of the biological role of tRNA mcm5s2U modification and highlights the importance of translational control in plant immunity. It is likely to captivate scientists working in this field.

      Response: Thank you very much for your positive comments and support!

      Reviewer #3 (Evidence, reproducibility and clarity):

      In this manuscript, the authors identified a cgb mutant that carries a mutation in the ROL5 gene Both the cgb mutant and the newly created rol5-c mutant are susceptible to the bacterial pathogen Psm. The authors showed that ROL5 interacts with CTU2, the Arabidopsis homologous protein of the yeast tRNA thiolation enzyme NCS2. A ctu2-1 mutant is also susceptible to Psm, suggesting the tRNA thiolation may play a role in plant immunity. Indeed, tRNA mcm5S2U levels are undetectable in rol5-c and ctu2-1 mutants. The authors found that the cgb mutation significantly attenuated basal and Psm-induced transcriptome and proteome changes. Furthermore, it was found that the translation efficiency of a group of SA signaling-related proteins including NPR1 is compromised.

      The manuscript provides solid evidence for the involvement of ROL5 and CTU2 in plant immunity using the rol5 and ctu2 mutants. The authors may consider the following suggestions and comments to improve the manuscript.

      Response: Thank you very much for your support and suggestions!

      1. The function of the Elongator complex in tRNA modification/thiolation has been extensively studied. In Arabidopsis Elongator mutants, mcm5S2U levels are very low, similar to the levels in the rol5 and ctu2 mutants (Mehlgarten et al., 2010, Mol Microbiology, 76, 1082-1094; Leitner et al., 2015 Cell Rep). In elp mutants, the PIN protein levels are reduced without reduced mRNA levels (Leitner et al., 2015), indicating that Elongator-mediated tRNA modification is involved in translation regulation. The Elongator complex plays an important role in plant immunity, though the reduced mcm5S2U levels in elp mutants were not proposed as the exclusive cause of the immune phenotypes. In fact, it would be difficult to establish a cause-effect relationship between tRNA modification and immunity. These results should be discussed in the manuscript.

      Response: Thank you very much for your insightful comment on the role of the ELP complex in tRNA modification and plant immunity. We added a paragraph discussing the ELP complex in the revised manuscript (Line 280-295).

      In addition to tRNA modification, the ELP complex has several other distinct activities including histone acetylation, α-tubulin acetylation, and DNA demethylation. Therefore, it is difficult to dissect which activity of the ELP complex contributes to plant immunity. However, the only known activity of ROL5 and CTU2 is to catalyze tRNA thiolation. Considering that the elp, rol5, and ctu2 mutants are all defective in tRNA thiolation, it is likely the tRNA modification activity of the ELP complex underlies its function in plant immunity.

      1. The interaction between CTU2 and ROL5 in Y2H has previously been reported (Philipp et al., 2014). The same report also showed reduced tRNA thiolation in the ctu2-2 mutant using polyacrylamide gel. These results should be mentioned/discussed in the manuscript.

      Response: Thank you for pointing them out. We added this information in the revised version (Line 146-147).

      1. tRNA modification unlikely plays a unique role in plant immunity. It can be inferred that mutations affecting tRNA modification (rol5, ctu2, elp, etc.) would delay both internal and external stimulus-induced signaling including immune signaling.

      Response: We agree with you that tRNA modification has other roles in addition to plant immunity. In the Discussion section, we have mentioned that “it was found that tRNA thiolation is required for heat stress tolerance (Xu et al., 2020). ……It will also be interesting to test whether tRNA thiolation is required for responses to other stresses such as drought, salinity, and cold.” (Line276-279).

      1. It would be interesting to conduct statistical analyses on the genetic codons used in the CDSs whose translation was attenuated as described in the manuscript. Do these genes including NPR1 use more than average levels of AAA, CAA, and GAA codons? If not, why their translation is impaired?

      Response: Thank you for your suggestion. We called GAA/CAA/AAA codons s2 codon. We have analyzed the percentage of s2 codon at whole-genome level (Figure below). NPR1 does contain more s2 codon (10.1%) than the average level (8.5%). We are preparing another manuscript, which will report the relationship between s2 codon and translation.

      Referees cross-commenting

      It is important to put current research in the context of available knowledge in the field. The digram in Figure 3C shows that the Elongator complex functions upstream of ROL5 & CTU2 in modifying tRNA. The function of Elongator in plant immunity has been well established. The similarities and differences should be discussed. Additionally, it may no be a good idea to claim that the results are novel.

      Response: Thank you for your comments. We added a paragraph discussing the ELP complex in the revised manuscript (Line 280-295). The ELP complex catalyzes the cm5U modification, which is the precursor of mcm5s2U catalyzed by ROL5 and CTU2. In addition to tRNA modification, the ELP complex has several other distinct activities including histone acetylation, α-tubulin acetylation, and DNA demethylation. Therefore, it is difficult to dissect which activity of the ELP complex contributes to plant immunity. However, the only known activity of ROL5 and CTU2 is to catalyze tRNA thiolation. Considering that the elp, rol5, and ctu2 mutants are all defective in tRNA thiolation, it is likely the tRNA modification activity of the ELP complex underlies its function in plant immunity. Therefore, our study improved our understanding of the ELP complex in plant immunity. We have deleted the words “new” and “novel” throughout the manuscript.

      Reviewer #3 (Significance): The manuscript provides solid evidence for the involvement of ROL5 and CTU2 in plant immunity. However, the authors did not acknowledge the existing results about the Elongator complex that functions in the same pathway in modifying tRNA. The involvement of Elongator in plant immunity has been well established. The cause-effect relationship between tRNA modification and plant immunity is difficult to demonstrate.

      Response: We think that the cause-effect relationship between the activities of the ELP complex and plant immunity is difficult to demonstrate because the ELP complex has several distinct activities other than tRNA modification. However, since the only known activity of ROL5 and CTU2 is to catalyze tRNA thiolation, the cause-effect relationship between tRNA thiolation and plant immunity is clear, which indicated that the tRNA modification activity of the ELP complex contributes to plant immunity.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In this manuscript, the authors identified a cgb mutant that carries a mutation in the ROL5 gene Both the cgb mutant and the newly created rol5-c mutant are susceptible to the bacterial pathogen Psm. The authors showed that ROL5 interacts with CTU2, the Arabidopsis homologous protein of the yeast tRNA thiolation enzyme NCS2. A ctu2-1 mutant is also susceptible to Psm, suggesting the tRNA thiolation may play a role in plant immunity. Indeed, tRNA mcm5S2U levels are undetectable in rol5-c and ctu2-1 mutants. The authors found that the cgb mutation significantly attenuated basal and Psm-induced transcriptome and proteome changes. Furthermore, it was found that the translation efficiency of a group of SA signaling-related proteins including NPR1 is compromised.

      The manuscript provides solid evidence for the involvement of ROL5 and CTU2 in plant immunity using the rol5 and ctu2 mutants. The authors may consider the following suggestions and comments to improve the manuscript.

      1. The function of the Elongator complex in tRNA modification/thiolation has been extensively studied. In Arabidopsis Elongator mutants, mcm5S2U levels are very low, similar to the levels in the rol5 and ctu2 mutants (Mehlgarten et al., 2010, Mol Microbiology, 76, 1082-1094; Leitner et al., 2015 Cell Rep). In elp mutants, the PIN protein levels are reduced without reduced mRNA levels (Leitner et al., 2015), indicating that Elongator-mediated tRNA modification is involved in translation regulation. The Elongator complex plays an important role in plant immunity, though the reduced mcm5S2U levels in elp mutants were not proposed as the exclusive cause of the immune phenotypes. In fact, it would be difficult to establish a cause-effect relationship between tRNA modification and immunity. These results should be discussed in the manuscript.
      2. The interaction between CTU2 and ROL5 in Y2H has previously been reported (Philipp et al., 2014). The same report also showed reduced tRNA thiolation in the ctu2-2 mutant using polyacrylamide gel. These results should be mentioned/discussed in the manuscript.
      3. tRNA modification unlikely plays a unique role in plant immunity. It can be inferred that mutations affecting tRNA modification (rol5, ctu2, elp, etc.) would delay both internal and external stimulus-induced signaling including immune signaling.
      4. It would be interesting to conduct statistical analyses on the genetic codons used in the CDSs whose translation was attenuated as described in the manuscript. Do these genes including NPR1 use more than average levels of AAA, CAA, and GAA codons? If not, why their translation is impaired?

      Referees cross-commenting

      It is important to put current research in the context of available knowledge in the field. The digram in Figure 3C shows that the Elongator complex functions upstream of ROL5 & CTU2 in modifying tRNA. The function of Elongator in plant immunity has been well established. The similarities and differences should be discussed. Additionally, it may no be a good idea to claim that the results are novel.

      Significance

      The manuscript provides solid evidence for the involvement of ROL5 and CTU2 in plant immunity. However, the authors did not acknowledge the existing results about the Elongator complex that functions in the same pathway in modifying tRNA. The involvement of Elongator in plant immunity has been well established. The cause-effect relationship between tRNA modification and plant immunity is difficult to demonstrate.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      The authors presented an intriguing and previously unknown mechanism that the tRNA mcm5s2U modification regulates plant immunity through the SA signaling pathway, specifically by controlling NPR1 translation. The manuscript was well-written and logically structured, allowing for a clear understanding of the research. The authors provided strong and persuasive data to support their key claims. However, further improvement is required to strengthen the conclusion that mcm5s2U regulates plant immunity by controlling NPR1 translation.

      Major comments:

      1. NPR1 translation should be examined to verify the Mass Spec (Figure 5B) and polysome profiling data (Figure 5D) by checking the NPR1 protein and mRNA level using antibodies and qPCR, respectively, in the cgb mutant background to establish a concrete confirmation of CGB regulation in NPR1 translation.
      2. Analyzing the genetic epistasis of CGB and NPR1 to check if CGB regulates plant immunity through the NPR1-dependent SA signal pathway. If the authors' claim is valid, I would expect no addictive effect on bacterial growth in the cgb/npr1 double mutant compared to the single mutants. Due to the broad impact of CGB on plant signaling (Figures 4E and 4F), the SA protection assay, which concentrates on the SA signal pathway, needs to be tested in WT, cgb and npr1 plants as an alternative assay to the genetic epistasis analysis. I expect that the SA-mediated protection is also compromised in cgb mutant background.

      Minor comments:

      1. Could the authors comment on why using COM instead of WT as a control to perform the majority of the experiments?
      2. In Figure 5E, why does ACTIN2 have an enhanced translation while NPR1 shows a compromised one in cgb mutant? How does the mcm5s2U distinguish NPR1 and ACTIN2 codons? Does mcm5s2U modification have both positive and negative roles in regulating protein translation?
      3. Specify the protein amount used for the in vitro pull-down assay and agobacterial concentration used for the tobacco Co-IP assay in the protocol section.
      4. Delete the SA quantification and Ion leakage assay in the protocol, which are not used in the study.
      5. The strain Pst DC3000 avrRPT2 was not used in this study. Please remove it.
      6. In Figure 5F, did the 59 genes tested overlap with the 366 attenuated proteins in the cgb mutant? Were the 59 genes translationally regulated?

      Significance

      The authors' study is significant as it establishes the first connection between tRNA mcm5s2U modification and plant immunity, specifically by regulating NPR1 protein translation. This research expands our understanding of the biological role of tRNA mcm5s2U modification and highlights the importance of translational control in plant immunity. It is likely to captivate scientists working in this field.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      The article titled "The tRNA thiolation-mediated translational control is essential for plant immunity" by Zheng et al. highlights the critical role of tRNA thiolation in Arabidopsis plant immunity through comprehensive analysis, including genetics, transcriptional, translational, and proteomic approaches. Through their investigation, the authors identified a cbp mutant, resulting in the knockout of ROL5, and discovered that ROL5 and CTU2 form a complex responsible for catalyzing the mcm5s2U modification, which plays a pivotal role in immune regulation. The findings from this study unveil a novel regulatory mechanism for plant defense. Undoubtedly, this discovery is innovative and holds significant potential impact. However, before considering publication, it is necessary for the authors to address the various questions raised in the manuscript concerning the experiments and analysis to ensure the reliability of the study's conclusions.

      Here is Comments:

      Line 64-65:<br /> The author mentioned that 'While NPR1 is a positive regulator of SA signaling, NPR3 and NPR4 are negative regulators.' However, several recent discoveries are suggesting that it may not be a definitive fact that NPR3 and NPR4 are negative regulators. Therefore, I recommend the authors to review this section in light of the findings from recent papers and make necessary edits to reflect the most current understanding.

      Line 182- & Figure 4:<br /> The author conducted RNA-seq, Ribo-seq, and proteome analysis. Describing the analysis as "transcriptional and translational" using RNA-seq and proteome data seems not entirely accurate. Proteome data compared with RNA-seq not only reflects translational changes but may also encompass post-translational regulations that contribute to the observed differences. To maintain precision, the title of this section should either be modified to "transcriptional and protein analysis" or, alternatively, compare RNA-seq and Ribo-seq data to demonstrate the transcriptional and translational changes more explicitly.

      Line 229-235 and Figure 5C:<br /> The interpretation of Figure 5C's polysome profiling results is inconclusive. There does not seem to be a noticeable difference in polysomal fractions between the cab mutant and CAM. The observed differences in the overlay of multiple polysome fractions between cab and COM could be primarily influenced by baseline variations rather than a significant decrease in the polynomial fractions in cpg. Therefore, it is necessary to carefully review other relevant papers that discuss polysome fraction data and their analysis. By doing so, the authors can make the appropriate corrections to ensure accurate interpretations.

      Line 482 Ion Leakage assay:

      I could not find the ion leakage assay in this manuscript, so I wonder why it is mentioned.

      Materials and Methods:

      To enhance the reproducibility of the study, the authors should provide a more detailed description of the materials and methods, especially for critical experiments like the Yeast-two-hybrid assays. Clear documentation of specific reagents, strains, and protocols used, along with information on controls, will bolster the validity of the results and facilitate future research in this area.

      Minor Point:

      Line 61: There is a space between ')' and '.', which needs to be edited.

      Significance

      This study holds significant importance within the field of plant immunity research. The authors have made valuable contributions through their comprehensive analysis, encompassing genetics, transcriptional, translational, and proteomic approaches, to elucidate the critical role of tRNA thiolation in plant immunity. One of the major strengths of this study lies in its ability to shed light on a previously unknown regulatory mechanism for plant defense. By identifying the cbp mutant and investigating the role of ROL5 and CTU2 in catalyzing the mcm5s2U modification, the authors have unveiled a novel aspect of plant immune regulation. This innovative discovery provides a deeper understanding of the intricate molecular processes governing immunity in plants.

      Moreover, the study's findings are not limited to the immediate field of plant immunity but also have broader implications for the scientific community. By employing diverse methodologies, the authors have demonstrated how tRNA thiolation exerts control over both transcriptional and translational reprogramming, revealing intricate links between these processes. This integrative approach sets a precedent for future research in the field of plant molecular biology and opens up new avenues for investigating other aspects of immune regulation.

      In terms of its relevance, the study's findings have the potential to captivate researchers across various disciplines, such as plant biology, molecular genetics, and translational research. The insights gained from this study may inspire researchers to explore further the role of tRNA in other regulation.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      General Statements

      In this manuscript, we describe a LINC complex-dependent centrosome positioning mechanism that takes place during the early stages of mitotic spindle assembly. We are grateful to the reviewers for their comments and suggestions and hope the proposed revision plan addresses all concerns raised. We are pleased that reviewers recognize the excellent technical quality of the experiments and the significance of the work presented in this manuscript.

      Description of the planned revisions

      Reviewer 1

      • “Moreover, we demonstrate this mechanism is altered in cancer cells, leading to increased chromosome segregation errors. » Here the authors infer that the identified mechanism is absent in cancer cells and that its absence contributes to chromosome segregation errors. Both conclusions are not supported by the presented data. First, the authors did not test whether any members of the LINC complex or dynactin is present at lower levels on the nuclear membranes of the cancer cells. Such a direct validation would be essential to make such a strong statement. Second, the authors conclude that this mechanism prevents chromosome segregation errors, based on the fact that depletion or impairment of the LINC complex (shSUN1, shSUN2, DN-KASH) results in chromosome segregation errors. These perturbations lead, however, as noted by the authors themselves to pleiotropic effects, including insufficient retraction of nuclear membrane, which can all contribute to chromosome segregation errors. It is therefore impossible to estimate the contribution of the centrosome positioning mechanism to these segregation errors using this type of perturbations. One could even argue that this mechanism might not be that important, since depletion of SUN2, which also impairs centrosome positioning has no significant effect on chromosome segregation.

      We agree with the reviewer that an analysis of the levels of LINC complex components and dynactin in cancer cells is lacking. For this reason, we propose to analyze the levels of SUN1, SUN2, dynactin and Nesprins by immunofluorescence in all cell lines. In addition, we have now re-written the manuscript regarding the chromosome segregation phenotype, to clarify that the observed phenotypes are not necessarily due to centrosome positioning defects.

      Reviewer 2

      “The authors need some other NE protein as a control to show that the reduction of dynein by DN-KASH is a specific defect and not a broad impact on the NE. The dynein data in Figs. 5J-L need to be extended to SUN1/2”.

      We thank the reviewer for these suggestions. To clarify this point, we will analyze the levels of lamin B following expression of DN-KASH or DPPPL-KASH. This will allow us to determine whether expression of the DN-KASH construct only affects dynein and not other NE proteins. In addition, we will analyze dynactin levels following SUN1 and SUN2 depletion.

      Reviewer 3:

      “Fig. 3: I suggest to quantify the lamin B1 and LBR overexpression levels”.

      According to the reviewer´s suggestion, we will perform a WB analysis of the cells overexpressing lamin B1 and LBR and quantify its levels.

      Description of the revisions that have already been incorporated in the transferred manuscript.

      Reviewer 1

      • “The authors conclude based on three cell lines that the centrosome positioning mechanisms is present in non-transformed cells and not in cancerous cells. The authors have, however, only analysed 1 non-cancerous cell line, and they compare cells originating from vastly different tissues (retina, bones and breast) and origins (epithelial vs. mesenchymal cartilage cells). Such a general statement is not possible, without a systematic comparison of several healthy cells vs cancerous cells from the same tissue”.

      We agree with this reviewer´s comment, which is also shared by the other reviewers. Accordingly, we have now extensively rewritten the manuscript to tone down this statement and focus on the role of the LINC complex in determining centrosome positioning.

      • “While the data showing that centrosome positioning depends on the LINC complex is solid and robust, some of the "negative" examples identified by the authors are less convincing. One the process the authors study is cell rounding. Based on the fact that Rap1 transfection or treatment with Calyculin A does not lead to differences that are statistically different, the authors conclude that cell rounding is not involved. However, absence of statistical difference does not mean that there is no difference. Indeed, when comparing the raw data in Figure 2L and 2Q to the positive hit shSun2 in Figure 4J, one could conclude that cell rounding does make a difference, and that this statistical difference would emerge if the authors would count a high number of cells. Therefore the authors should interpret these results in a more differentiated manner, and also instead of just stating nonsignificant, state also the real p-values for the different experiment”.

      According to the reviewer´s suggestion, we have now added all p values to the respective graphs and interpreted these results in a more step-by-step manner. Moreover, while we understand the reviewer`s comment regarding our sample size, it should be noted that this is a single-cell, high-resolution imaging approach which, in combination with certain treatments makes it very challenging to obtain data for a high number of cells. In this regard, we point out that interfering with cell rounding was extremely difficult to achieve. When highly overexpressed, Rap1* completely impairs mitotic cell de-adhesion, and this blocks mitotic entry (Marchesi et al., 2014). Furthermore, CalA treatment induces a fast and drastic rounding, which makes it very challenging to accurately track centrosome and nuclear positions. Nevertheless, we filmed additional cells treated with CalA and added the data to the figures. Our results still confirm that interfering with cell rounding does not significantly change centrosome positioning during this stage. It should be noted that the sample size in all conditions is within the range normally used when performing single-cell high resolution imaging.

      • The second major concerns emerges when looking at the data in Figure 5, when the authors test for the abundance of the dynein complex on the nuclear envelope in cells treated with DPPPL-KASH or DN-KASH. Yes, there is a statistical difference, but the absolute difference is tiny (I estimated a normalized intensity of 1.44 vs 1.35). This is a difference of less than 10%. How do the authors think that such a small change in dynein could have such a strong effect on centrosome positioning? Would a partial dynactin depletion by 10% give an equivalent result? Does the depletion of other proteins involved in the late recruitment of dynein at the NE also affect centrosome positioning?

      We thank the reviewer for this important point. Originally, we quantified dynactin intensity by selecting three unbiased random regions of the NE. However, this approach might underestimate the overall fluorescence intensity across the entire structure. For this reason, we have now measured dynactin fluorescence intensity over the entire NE using the same dataset. We have replaced Fig. 5K and L with this data and a description of the method has been added to the Materials and Methods section. As can be seen from the new graph, there is a reduction of approximately 50% in dynactin NE fluorescence intensity.

      The reviewer also asks whether depletion of other proteins involved in the late recruitment of dynein at the NE would also affect centrosome positioning. However, extensive previous work done by us and others, has shown that depletion of either BicD2 or NudE/NudEL, which are the main adaptors for dynein loading during the G2/M transition, significantly affect prophase centrosome positioning, since they detach centrosomes from the NE (Splinter et al., 2010; Bolhy et al., 2011; Hu et al., 2013; Baffet et al., 2015; Nunes et al., 2020). Once detached, centrosomes are no longer able to orient according to nuclear cues. Therefore, we do not believe such an approach would provide additional information regarding the role of the LINC complex in this process.

      Reviewer 2:

      • “Figure 1 is insufficiently explained. The authors have to describe in an understandable way how they measured centrosome-centrosome angle and centrosome-nucleus angle. They should show a cartoon in which these angles are clearly shown. The small cartoons in Fig. 1C are not helpful at all; they are also not explained. The authors should explain the meaning of the black dots (are these centrosomes?) and the even smaller dots. The short nuclear axis should be indicated, e.g., by a red line”.

      We apologize for the lack of sufficient explanation in Figure 1. We have now re-written the text. We have also added a scheme explaining how centrosome-nucleus and centrosome-centrosome angles are quantified, according to the reviewer´s suggestion. We have added this to Fig. S1. We believe this makes our data more understandable and easier to follow.

      “On the first page of the manuscript: "Consequently, at the NEP, centrosomes are positioned on the shortest nuclear axis (Fig. 1C) as can be seen in Fig. 1A. This means that the centrosome-nucleus angle relative to the shortest nuclear axis should be 0. However, in Fig. 1C, this angle is between 45 and 90 degrees. This is also the case for Fig. 1D. Please clarify”.

      We thank the reviewer for noticing this error. In fact, the graphs reflect positioning of centrosomes relative to the longest nuclear axis. Therefore, when the values are close to 90º, this means they are oriented on the shortest nuclear axis. We understand this could be confusing to the readers. We have now clarified this information throughout the text.

      • “I find it confusing that in Fig. 1, depending on the subfigure, the short or longest nuclear axis is used as a reference point: Fig. 1C: shortest; D: shortest; F: shortest; G: longest; I: shortest; J: longest. Thus, even within the same cell line, the reference point is changing. What is the rational for this variation”?

      Again, we refer to the point above. The reference point is always the shortest nuclear axis. However, we apologize for the lack of clarity. This has all been changed, according to the explanation provided in the previous point.

      • Fig. 4K, L, M: in figure, y-axis: "shortest nuclear axis". In legend: "relative to the longest nuclear axis". I guess the longest nuclear axis is correct. Same in Fig. 5D and E. Fig. 5C lacks the WT control.

      This information has been clarified in the text and panels have been corrected accordingly. Regarding Fig. 5C, we believe the correct control is the expression of PPPL-KASH, since it has been shown extensively that Nesprins localize to the NE in control, unmanipulated cells. Nevertheless, we have added a WT control to Supplementary Figure 5, showing localization of Nesprins in unmanipulated prophase cells.

      “The cells in Fig. 5J are not comparable: one has a monopolar spindle, the other a bipolar. The authors need some other NE protein as a control to show that the reduction of dynein by DN-KASH is a specific defect and not a broad impact on the NE. The dynein data in Figs. 5J-L need to be extended to SUN1/2”.

      We agree with the reviewer´s comment that the cell in the top panel might appear as a monopolar. However, it is not. In fact, this cell has centrosomes on the top and bottom of the nucleus, in a vertical configuration (check Magidson et al., Cell, 2011). To clarify this, we have now added lateral projections of all cells, highlighting the centrosomes to clearly show they are positioned on opposite sides of the nucleus. The other points related to the effects of DN-KASH on other NE proteins and dynactin levels following shSUN1 and shSUN2 are being addressed (please see comments above in the section “description of planned reviews”).

      “The title of the paper is misleading: the authors do not provide any indication for a nuclear signal in prophase that determines centrosome positioning”.

      We have changed the title of the manuscript according to the reviewer´s suggestion.

      “It would make sense to use the same time scale in Figs. 1A and B (either min.sec. or sec.) to allow direct comparison”.

      We have now changed the time scale to seconds in all figures to allow direct comparison.

      “2nd section: Mitotic cell rounding "The authors state: Given that cancer cells failed... I would be careful with this generalization; only one cancer cell was used in this study”.

      Given the limited number of cells that we used, and following the concern raised by all reviewers, we have now re-written the text to avoid generalizations. Instead, we now focus on the role of the LINC complex in determining centrosome positioning.

      “The authors say: "However, they did not place the centrosomes at the shortest nuclear axis (Figure 4K-M)." Centrosomes are still on the shortest nuclear axis but not as frequent as in control”.

      This has been corrected.

      “The white color in Fig. 6B cannot be seen and needs to be changed to something else”.

      We apologize for this oversight. During the upload and pdf conversion process, we did not realize the color of this bar, corresponding to the DN-KASH group had changed to white. This has now been corrected.

      The paper has neither line nor page numbers.

      This has been added.

      Reviewer 3

      “it would make sense to indicate the test used for each p-value in all the figure legends”.

      We have now added the statistical test used and the p-value in the figure legends.

      “Figure legends are quite repetitive and could be shortened. E.g. in Fig. 1 the description for E, F, H and I repeats what has been explained for B and C. Same applies between figure legends. The authors might refer to previous legends if the analysis was done in a similar way”.

      The legends have been simplified.

      “How is nuclear solidity defined and analyzed in Fig S3D”?

      Nuclear solidity was analyzed using Fiji. In short, nuclei are outlined using the polygon tool and nuclear area is measured. To calculate nuclear solidity, the nuclear area is then divided by the corresponding nuclear convex hull area. Irregular nuclei will typically show a lower nuclear solidity value. This information was added to the text.

      “The references to Fig S3 in figure legend 3 ("see Fig S3") do not enlighten the message and could be removed. The same applies to Fig5 - here it is not clear why the author refer to Fig S4”.

      We agree with this reviewer´s comment. We have now removed these references from the legends.

      “Fig. 5: Consider reordering the panel: Start with the current panel C (as in the text) as it is the necessary control prior to the experimental data”.

      We have now changed the order of the panel according to the reviewer´s suggestion.

      “Fig 5 I: what means "before"? Can the authors give a time window they use for analysis”.

      We have now replaced the term “before” with a defined time.

      “Page 20: "... shortest nuclear axis (Fig. 1C, 5D-G; n.s. - not significant). However, DN-KASH-expressing cells showed compromised separation and positioning of centrosome (Fig. 5D-G, * p=0.0155 and * p=0.0237, respectively). - rather point to the specific panels, i.e. Fig. 1C, 5D and F as well as and Fig. 5E and G”.

      We have now clarified these points in the text.

      “Fig 6B. The DN- KASH bars are on my pdf not visible - use a darker grey”.

      As mentioned above, we apologize for this oversight. We did not realize that during the pdf conversion process the bar corresponding to the DN-KASH group had changed to white. We have now corrected this.

      “Fig S6, albeit mentioned in the text, is not included in the supplementary info”.

      We apologize for this error. In fact, where it reads Fig. S6, should be Fig. S5. We have now corrected this.

      “a. GlutaMAX instead of GlutaMAXE (page 29)

      b. What means "as described previously"? No reference is given. Do you refer to the upper part of the method section? (page 30)

      c. 20 nM HEPES should most probably read 20 mM (page 32)

      d. "1:50 protease inhibitor; 1:100 Phenylmethylsulfonul fluoride" - which protease inhibitor (mixture)? Rather phenylmethylsulfonyl fluoride.

      e. exact composition of the cytoskeleton buffer used to prepare 4% paraformaldehyde could be given”.

      All these suggestions/corrections have been introduced in the text.

      Description of analyses that authors prefer not to carry out.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary: Centrosomes separate early in mitosis to allow faithful spindle assembly and chromatin segregation. In the current study the author show that in RPE-1 cells the separated centrosomes typically position each other along the shorter axis of the nucleus while in cancer derived U2OS and MDA-MB-486 this is rather random. Mitotic cell rounding is not causal for this effect. Rather, the LINC (linker of nucleoskeleton and cytoskeleton) complex, a protein complex spanning both membranes of the nuclear envelope, is required for this. The data indicate that this is dynactin1 recruitment to the nuclear envelope. The work suggest that proper arrangement of the centrosomes along the short nuclear axis via the LINC complex contributes to chromatin segregation fidelity in RPE-1 cells.

      Major comments: The data, derived mostly by life cell imaging of cell culture lines, are of very high quality, carefully controlled and analyzed. They fully support the claims of the study and are well presented, both in text and figures. Statistical analysis seems adequate, but since the authors show different kinds of data sets including time series and use several kinds of statistical tests, it would make sense to indicate the test used for each p-value in all the figure legends. I have no major criticism or experiments to suggest.

      Minor comments:

      1. Figure legends are quite repetitive and could be shortened. E.g. in Fig. 1 the description for E, F, H and I repeats what has been explained for B and C. Same applies between figure legends. The authors might refer to previous legends if the analysis was done in a similar way.
      2. How is nuclear solidity defined and analyzed in Fig S3D?
      3. The references to Fig S3 in figure legend 3 ("see Fig S3") do not enlighten the message and could be removed. The same applies to Fig5 - here it is not clear why the author refer to Fig S4.
      4. Fig. 3: I suggest to quantify the lamin B1 and LBR overexpression levels.
      5. Fig. 5: Consider reordering the panel: Start with the current panel C (as in the text) as it is the necessary control prior to the experimental data.
      6. Fig 5 I: what means "before"? Can the authors give a time window they use for analysis.
      7. Page 20: "... shortest nuclear axis (Fig. 1C, 5D-G; n.s. - not significant). However, DN-KASH-expressing cells showed compromised separation and positioning of centrosome (Fig. 5D-G, * p=0.0155 and * p=0.0237, respectively). - rather point to the specific panels, i.e. Fig. 1C, 5D and F as well as and Fig. 5E and G.
      8. Fig 6B. The DN- KASH bars are on my pdf not visible - use a darker grey
      9. Fig S6, albeit mentioned in the text, is not included in the supplementary info.
      10. Material and Methods: in general very clear and carefully written
      11. a. GlutaMAX instead of GlutaMAXE (page 29)
      12. b. What means "as described previously"? No reference is given. Do you refer to the upper part of the method section? (page 30)
      13. c. 20 nM HEPES should most probably read 20 mM (page 32)
      14. d. "1:50 protease inhibitor; 1:100 Phenylmethylsulfonul fluoride" - which protease inhibitor (mixture)? Rather phenylmethylsulfonyl fluoride.
      15. e. exact composition of the cytoskeleton buffer used to prepare 4% paraformaldehyde could be given

      Referees cross-commenting

      I also mentioned in teh significance section the two weak points (only one non-cancer cell line (RPE-1); the precise role of the LINC complex). I thus think all three reviewers come to a similar conclusion: technically well done albeit some improvements are possible (reviewer 2). Manuscript is interesting but whether the findings can be generalized remains open and the overall impact is limited. Personally, I think a good strategy for the authors might be to stay with the three cell lines and avoid too general statements.

      Significance

      General assessment: This is a very elaborate analysis of centrosome positioning at the entry of mitosis. The experiments are carefully controlled and the findings supported by multiplied experiments, e.g. the aspect of mitotic cell rounding by analysis of unperturbed cells but also by manipulation accelerating and inhibiting cell rounding. Contribution of the LINC complex is evaluated by shRNA against SUN1/2, i.e. main LINC components, but also by the KASH-DN fragment, which acts as dominant negative. On the downside the study is limited to one untransformed cell line. Given that the treatments interfering with LINC complex function most likely affect all aspects of LINC-centromere interplay, it remains open what precise function of the LINC-complex contributes to chromatin segregation fidelity

      Advance: The work clearly shows that at least in RPE-1 cells the separated centrosomes arrange each other along the shorter axis of the nucleus and that the LINC complex is required for this.

      Audience: The work is certainly interesting for researches interested in mitosis, most precisely in spindle assembly. It enlightens a very specific aspect of spindle assembly but this very convincing. The work is basic research.

      Our experience is basic research of mitosis, nuclear structure and function both using biochemical assays and life cell imaging.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      A nuclear signal in prophase determines centrosome positioning and ensures efficient mitotic spindle assembly.<br /> Lima and Ferreira investigate in this manuscript the regulation of centrosome positioning in early mitosis. The authors first analyze the position of the two centrosomes either relative to the cell length axis or the shortest or longest axis of the nucleus and describe differences between RPE1, U2OS, and MDA-MB cells. Next, they analyze whether mitotic cell rounding determines the position of centrosomes; however, delayed cortical retraction (Rho-kinase inhibition), adhesion disassembly inhibition (Rap1Q63E), and inducing premature rounding (CalA) did not impact centrosome positioning in RPE1, U2OS, and MDM-MB cells. In addition, the nuclear lamina and LBR were also not required for centrosome positioning on the shortest nuclear axis. In contrast, depletion of SUN1 or SUN2 and overexpression of a dominant-negative DN-KASH affected the nuclear positioning of centrosomes in RPE1 cells. Finally, the authors analyze whether the LINC complex impacts mitotic fidelity. This is indeed the case when SUN1 is depleted, but it is not the case for SUN2 depletion or DN-KASH overexpression. This difference between LINC complex components is not discussed in the manuscript. Since SUN1, SUN2, and DN-KASH affect centrosome positioning in a similar way (Figs. 4 and 5), the chromosome segregation defect in SUN1-depleted cells is most likely not caused by a centrosome position defect but probably by another defect caused by SUN1 depletion.

      Major comments

      1. Figure 1 is insufficiently explained. The authors have to describe in an understandable way how they measured centrosome-centrosome angle and centrosome-nucleus angle. They should show a cartoon in which these angles are clearly shown. The small cartoons in Fig. 1C are not helpful at all; they are also not explained. The authors should explain the meaning of the black dots (are these centrosomes?) and the even smaller dots. The short nuclear axis should be indicated, e.g., by a red line.
      2. On the first page of the manuscript: "Consequently, at the NEP, centrosomes are positioned on the shortest nuclear axis (Fig. 1C) as can be seen in Fig. 1A. This means that the centrosome-nucleus angle relative to the shortest nuclear axis should be 0. However, in Fig. 1C, this angle is between 45 and 90 degrees. This is also the case for Fig. 1D. Please clarify.
      3. I find it confusing that in Fig. 1, depending on the subfigure, the short or longest nuclear axis is used as a reference point: Fig. 1C: shortest; D: shortest; F: shortest; G: longest; I: shortest; J: longest. Thus, even within the same cell line, the reference point is changing. What is the rational for this variation?
      4. Fig. 4K, L, M: in figure, y-axis: "shortest nuclear axis". In legend: "relative to the longest nuclear axis". I guess the longest nuclear axis is correct. Same in Fig. 5D and E. Fig. 5C lacks the WT control.
      5. The cells in Fig. 5J are not comparable: one has a monopolar spindle, the other a bipolar. The authors need some other NE protein as a control to show that the reduction of dynein by DN-KASH is a specific defect and not a broad impact on the NE. The dynein data in Figs. 5J-L need to be extended to SUN1/2.
      6. The title of the paper is misleading: the authors do not provide any indication for a nuclear signal in prophase that determines centrosome positioning.

      Minor comment

      1. It would make sense to use the same time scale in Figs. 1A and B (either min.sec. or sec.) to allow direct comparison.
      2. 2nd section: Mitotic cell rounding "The authors state: Given that cancer cells failed... I would be careful with this generalization; only one cancer cell was used in this study.
      3. The authors say: "However, they did not place the centrosomes at the shortest nuclear axis (Figure 4K-M)." Centrosomes are still on the shortest nuclear axis but not as frequent as in control.
      4. The white color in Fig. 6B cannot be seen and needs to be changed to something else.
      5. The paper has neither line nor page numbers.

      Referees cross-commenting

      My comments are more or less reflected by the comments and concerns of reviewer 1 (only one cancer cell line; the role of the LINC complex). This reduced the impact of this manuscript that is certainly intresting and has novel aspects.

      Significance

      The manuscript analysis an early step in spindle assembly: the positioning of the two centrosomes on the NE. As such, the paper is interesting and important. They exclude cell rounding and lamin disassembly as mechanisms for centrosome positioning. The SUN1/2 and KASH data on centrosome positioning are convincing, and they provide a novel finding on the function of the LINC complex in centrosome positioning, probably via dynein recruitment to the NE. It remains unclear whether LINC recruits dynein directly or functions via one of the two known dynein/NE recruitment pathways. LINC-dynein at the NE binds centrosome microtubules and dynein pulls them towards the NE. However, how LINC-dynein spatially positions centrosomes relative to the short axis of the nucleus remains unclear (dynein uniformly decorates the NE (Fig. 5J)). The data on chromosome missegregation are not so clear because the defect only occurs in SUN1-depleted cells. Thus, this phenotype indicates most likly a function of SUN1 but not the LINC complex and is probably not related to centrosome positioning since all LINC components affect centrosome positioning. The paper falls short in explaining how parameters were measured and contains mistakes in the figures, as outlined above. The paper lacks a coherent story (a little bit on cancer, some negative data, LINC-dynein, but it stops on the surface).

      It will be relatively easy to improve some aspects of the manuscript (explaining the angles, correcting the figures: one week). Measuring dynein at the NE in SUN1/2-depleted cells is also easy to do (1-2 months). To get more mechanistic insides into how LINC-dynein positions centrosomes probably will not be possible during revision time.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary: in this study, Lima and colleagues, investigate the mechanisms controlling the position of the two centrosomes at nuclear envelope breakdown. The authors show that in the non-cancerous human epithelial RPE1-cell line, the centrosomes are generally positioned in the short axis of the nucleus; in contrast in two cancer cell lines, they did not find an equivalent pattern. When the authors set out to identify potential molecular players required for this positioning, they find that the LINC complex is required , possibly by recruiting dynein to the nuclear membrane. Finally, the authors show that disruption of the LINC complex is associated with chromosome segregation errors.

      Major Comments:

      In general, the presented experiments are of excellent technical quality. The main conclusions of the manuscript, are however, not always well supported by the experimental data. They should be either interpreted more cautiously or supported by additional experimental evidence. I highlight these here, using the main conclusions of the abstract.

      1. "We show that in untransformed cells, centrosome positioning is regulated by a nuclear signal, independently of external cues. »

      The authors conclude based on three cell lines that the centrosome positioning mechanisms is present in non-transformed cells and not in cancerous cells. The authors have, however, only analysed 1 non-cancerous cell line, and they compare cells originating from vastly different tissues (retina, bones and breast) and origins (epithelial vs. mesenchymal cartilage cells). Such a general statement is not possible, without a systematic comparison of several healthy cells vs cancerous cells from the same tissue.<br /> 2. "This nuclear mechanism relies on the linker of nucleoskeleton and cytoskeleton (LINC) complex that controls the loading of dynein on the nuclear envelope (NE), providing spatial cues for robust centrosome positioning on the shortest nuclear axis, prior to nuclear envelope permeabilization (NEP). »

      While the data showing that centrosome positioning depends on the LINC complex is solid and robust, some of the "negative" examples identified by the authors are less convincing. One the process the authors study is cell rounding. Based on the fact that Rap1 transfection or treatment with Calyculin A does not lead to differences that are statistically different, the authors conclude that cell rounding is not involved. However, absence of statistical difference does not mean that there is no difference. Indeed, when comparing the raw data in Figure 2L and 2Q to the positive hit shSun2 in Figure 4J, one could conclude that cell rounding does make a difference, and that this statistical difference would emerge if the authors would count a high number of cells. Therefore the authors should interpret these results in a more differentiated manner, and also instead of just stating non-significant, state also the real p-values for the different experiment.<br /> The second major concerns emerges when looking at the data in Figure 5, when the authors test for the abundance of the dynein complex on the nuclear envelope in cells treated with DPPPL-KASH or DN-KASH. Yes, there is a statistical difference, but the absolute difference is tiny (I estimated a normalized intensity of 1.44 vs 1.35). This is a difference of less than 10%. How do the authors think that such a small change in dynein could have such a strong effect on centrosome positioning? Would a partial dynactin depletion by 10% give an equivalent result? Does the depletion of other proteins involved in the late recruitment of dynein at the NE also affect centrosome positioning?<br /> 3. « Moreover, we demonstrate this mechanism is altered in cancer cells, leading to increased chromosome segregation errors. »

      Here the authors infer that the identified mechanism is absent in cancer cells and that its absence contributes to chromosome segregation errors. Both conclusions are not supported by the presented data. First, the authors did not test whether any members of the LINC complex or dynactin is present at lower levels on the nuclear membranes of the cancer cells. Such a direct validation would be essential to make such a strong statement. Second, the authors conclude that this mechanism prevents chromosome segregation errors, based on the fact that depletion or impairment of the LINC complex (shSUN1, shSUN2, DN-KASH) results in chromosome segregation errors. These perturbations lead ,however, as noted by the authors themselves to pleiotropic effects, including insufficient retraction of nuclear membrane, which will can all contribute to chromosome segregation errors. It is therefore impossible to estimate the contribution of the centrosome positioning mechanism to these segregation errors using this type of pertubrations. One could even argue that this mechanism might not be that important, since depletion of SUN2, which also impairs centrosome positioning has no significant effect on chromosome segregation.

      Minor comments:

      The author state in the Material and methods that all the figure legends contain the number of replicates. This is, however, not the case, the authors only indicate the total number of analyzed cells.

      Referees cross-commenting

      I agree that all three reviewers come to similar conclusions - strong technical quality, novel results and concepts, but some limitations due to lack of precise tools or the limited number of model cell lines investigated.<br /> I recommend that the authors prioritize which are the suggested experiments that could be done within a few months, and otherwise rephrase their conclusions in less general terms.

      Significance

      This study establishes for the first time that some cell lines set up the mitotic spindle at predefined positions of the nucleus and they identify a first molecular complex controlling this complex.

      The strength of this study is the high technical quality of the data - a limitation is the over-interpretation of the current data (see major comments), and the fact that the authors do not have a tool that specifically only disrupts centrosome positioning, which would allow them to probe the importance of this mechanism.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Manuscript number: RC-2023-02111

      Corresponding author(s): Moira O’Bryan

      1. General Statements

      We thank the Review Commons editor and the three reviewers for their overall positive responses in assessing this manuscript. Further, we appreciate and would like to reiterate the similarities across our three reviewers’ comments regarding the significance of this work, where our examination of epsilon tubulin (TUBE1) during mammalian spermatogenesis will be valuable for both microtubule/cytoskeletal and developmental/ reproductive fields. Below, we have made point-by-point responses to the reviewers’ comments, and outlined by the revisions we plan to make, or have made. All line numbers refer to the transferred manuscript file with tracked changes.

      2. Description of the planned revisions

      Reviewer 1:* The authors claim that because the TUBE1 knockout mouse have abnormal centrosome numbers during meiosis, there is a role for TUBE1 in suppressing supernumerary centriole formation. While this is one possibility, it's also possible that abnormal centrosome numbers arose as a result of cell division defects, especially because binucleate cells are present in mutants. The authors should edit the text to state that abnormal centrosome numbers may arise from either supernumerary centriole formation (by the templated or de novo pathways) or from failure to complete cell division. *

      *OPTIONAL: to test these possibilities, the authors may choose to 1) count the number of centrioles in meiosis with two different centriole markers 2) stain for markers of mature centrioles, such as Cep164, to determine the number of parental centrioles. *

      Response: This is a good point. Published data indicates that the Stra8-cre is active within a subset of undifferentiated spermatogonia, and in differentiated spermatogonia through to pre-leptotene spermatocytes (Sadate-Ngatchou et al., 2008). This raises the possibility that the increase in centriole numbers could be due to a failure to complete cell division if cre is active in mitotically active spermatogonia populations. The text has been appropriately modified in lines 207-209 and 352 to reflect these insights. We appreciate the Reviewer’s optional suggestion to perform additional immunolabeling experiments and intend to examine the number of parental centrioles in spermatocytes during meiotic division using a marker of the distal or subdistal appendages. This data will be included in the final revised document.

      Reviewer 2:* Considering the suggested non-canonical function of Epsilon tubulin outside the centriole in mice sperm, it is critical to know the localization of the protein in spermatocytes during meiosis and spermatids during differentiation. *

      Response: We agree with Reviewer 2 that determining the localization of TUBE1 in spermatocytes and spermatids would be desirable. However, we are yet to find an appropriate available antibody for this. We have previously assessed the specificity of a TUBE1 antibody (PA5-56917, Invitrogen), however, this antibody was not suitable for use in our mouse model. This aside, we have recently acquired a new TUBE1 antibody which we plan to evaluate its specificity during this revision period. If it appears to bind specifically to TUBE1, we will perform the requested localization experiments.

      For clarification we have previously defined the location of TUBE1 in spermatids to the manchette and basal body in elongating spermatids (lines 72-74) (Dunleavy et al., 2017). Unfortunately, the antibody used in this study is now discontinued. The phenotypes observed as a consequence of TUBE1 loss of function in this study are, however, consistent with these patterns of localization.

      Reviewer 2:* Localization of Epsilon tubulin is needed to distinguish between mutant sperm cells and those that are not Epsilon tubulin mutants in the Tube1GCKO/GCKO mice. E.g., are the 28.07% of Tube1GCKO/GCKO tubules that showed a Sertoli cell only (SCO) phenotype the one where all the cells are mutants? *

      Response: As per our response to Reviewer 2’s comment above, we plan to test a new TUBE1 antibody to determine TUBE1 localization in this model. Outlined in our response to Reviewer 2 below, we also plan to sequence DNA from mature epididymal sperm from our mutant mice to further confirm the deletion of Tube1 exon 3.

      Reviewer 2:* The generated conditional germ cell-specific mutants are demonstrated by mRNA expression spermatocytes. It would help if DNA sequencing, western, and Immunohistochemical staining were used to show the gene and protein are affected. *

      Response: We thank Reviewer 2 for their suggestions. Should we successfully validate an appropriate TUBE1 antibody for use in our model, we will perform immunohistochemical staining during the revision process. Our qPCR results from purified spermatocytes however, strongly suggest that the Tube1 gene is deleted in our model, noting that such purifications are on average 81% pure with the major contaminants being Sertoli cells and spermatids (Dunleavy et al., 2019). To further confirm the deletion of Tube1 exon 3, we plan to sequence DNA from mature epididymal sperm from our mutant mice.

      Reviewer 2:* "Suggesting a core TUBE1 function that can be supplemented by either z-tubulin or TUBD1." Can you test what happens to mice Z and D tubulin isoforms in the mutant? Did their level increase in the centrioles? This is informative since there is no clear centriolar phenotype (other than centriole number that may be due to cell division failure) in mice spermatogenesis and the paper's central hypothesis in the introduction. *

      Response: We appreciate this question by Reviewer 2. Zeta tubulin is not present in the mouse genome as outlined in our introduction (lines 38-39). We do acknowledge that exploring Tubd1 will be informative in our mutant and thereby plan to examine its expression in round spermatids.

      Reviewer 2: The authors looked at the Metaphase stage cells to assess meiosis. It would be more interesting to look at the meiosis prophase I. Since the Stra8 acts very early leptotene stage, it would be interesting to see if meiosis is defective from the very beginning. Also, some suggest that the manchette is nucleated at the pachytene stage. Is the manchette defective from the very early stage of nucleation?

      Response: We thank Reviewer 2 for this suggestion. To this end, we plan to examine juvenile mouse testes at days 10 and 17 post-partum where leptotene and pachytene spermatocytes are the most mature germ cells respectively.

      In regard to the Reviewer’s comment of the manchette being nucleated in pachytene stage spermatocytes, we acknowledge that the precise mechanism of manchette nucleation has not been confirmed. We are aware of the alternative hypothesis introduced by Moreno and Schatten (2000), which postulates manchette microtubules may be nucleated prior to pachytene period, through their examination of bovine male germ cells. This hasn’t, however, been supported by evidence and with more recent data, others have suggested that the manchette is nucleated at the centrosomal adjunct (Lehti and Sironen, 2016). Indeed, our unpublished data suggests this is the case (another study). Regardless, the origin of the microtubule seeds that ultimately extend to form the manchette is not relevant to the hypothesis we have proposed. As we note that in our manuscript and mouse model, manchettes appear to assemble normally in step 8 spermatids. Rather, their movement and disassembly is abnormal i.e. TUBE1 serves critical roles more manchette movement and disassembly rather than manchette formation.

      Reviewer 2:* Is the acetylation of manchette microtubules affected in the absence of TUBE1? *

      Response: Reviewer 2 raises an interesting question, which we plan to answer through immunolabeling of testis sections for acetylated tubulin in our control and mutant groups.

      Reviewer 3: *Minor points, a substantial percentage of sperm produced had a normal head shape in the KO (Figure 1I), which undermine the function of tube1 in nuclear shaping, the author should address this point in their manuscript. It is also curious whether there are phenotype in other tissues, can the authors comment on that? *

      Response: We thank Reviewer 3 for highlighting this point. As reported in Fig. 1I, 28.5% of sperm from Tube1GCKO/GCKO epididymides have abnormal nuclear shape. This is a 4.4-fold increase over that seen in wild type sperm. These data clearly highlight the role of TUBE1 in defining nuclear morphology. Variations between cells does not undermine this conclusion. It appears that prior to sperm release from the testis, the majority of TUBE1 null spermatids heads are abnormally shaped. However, in the epididymis there appears to be an increase in the proportion of normally shaped heads. We thus hypothesize that the high rates of spermiation failure in the TUBE1 null mice reflect the preferential removal of abnormally shaped sperm by Sertoli cells, thus enriching for normally shaped heads that are released. During the revision process, we will quantify the percentage of spermatids with normal versus abnormally shaped heads prior to spermiation in testis sections. All Tube1 null mice were sterile.

      To Reviewer 3’s second point - we have not examined other tissues in this conditional male germ cell knockout mouse model, as the cre used in this manuscript is only expressed in the testis (Sadate-Ngatchou et al., 2008). Consistent with the specificity of the deletion, null male mice are overtly healthy, with the exception of male fertility, and exhibit normal body weight as detailed on line 123 and in Fig S1D.

      3. Description of the revisions that have already been incorporated in the transferred manuscript

      Reviewer 1:* In figure 5, based on quantification of fluorescence intensity, the authors conclude that loss of epsilon-tubulin results in an increase in the levels of KATNAL1, KATNAL2, and KATNB1. Given the inherent variability in immunofluorescence staining, the authors should at a minimum normalize their intensity measurements to those of an unrelated control protein stained in the same cell (ex: alpha-tubulin). It would be more convincing to quantify the levels of these proteins by Western blot (again, normalized to a control protein or to total cellular protein), which should be feasible given that the authors can isolate elongating spermatids. *

      Response: We thank Reviewer 1 for this suggestion to better account for any potential variability between immunofluorescence staining in cells. In this instance, alpha-tubulin would be a related protein in our model, making it unsuitable for normalization - the longer manchette phenotypes in our mutant spermatids indicate more tubulin present in mutant cells. We have therefore normalized the fluorescence intensity in our cells to DNA content (DAPI staining). This has provided comparable results to our initial analysis, and we have edited our text accordingly at lines 303, 307-310, 563-564, 845, 850 and Fig. 5. We respectfully disagree that western blotting would be informative, as the point is that katanin proteins are accumulating abnormally on the elongating sperm manchette. This does not necessarily mean that overall katanin levels will be increased. This aside, given the low numbers of elongating spermatids in the Tube1GCKO/GCKO mice, obtaining sufficient materials of western blotting is prohibitive. With the severity of germ cell loss indicated by our daily sperm production calculations, we predict the isolated spermatids of up to 5 Tube1GCKO/GCKO animals would be required to make up one biological replicate. It would not be feasible to collect the large number of animals required for at least three biological replicates in the revision timeframe.

      Reviewer 1:* A major claim of the paper is that epsilon-tubulin plays a different role within mammalian germ cells (abstract, line 22; p9, lines 167-168; p15 lines 315-316), because the Tube1GCKO/GCKO mice can form some sperm with relatively normal ciliary ultrastructure, whereas ciliates lacking epsilon-tubulin fail to form cilia. However, it's unclear whether the centrioles that templated these normal cilia were formed before or after epsilon-tubulin loss. Given that centrioles are inherited from one generation to the next, it's possible that the few normal cilia may be templated by relatively normal parental centrioles. These parental centrioles would have been present in spermatogonia prior to Cre expression/epsilon-tubulin deletion, and inherited by a fraction of sperm after the mitotic and meiotic divisions, resulting in sperm with normal ciliary ultrastructure. Other spermatocytes may have inherited centrioles formed in the absence of epsilon-tubulin, resulting in aberrant centrioles similar to those reported in human somatic cells, but these would not form any sperm flagella due to a loss of cell viability, as has been reported for acentriolar cells in a p53+ background. Underscoring this point, Chlamydomonas and human somatic mutant cells constitutively lack epsilon-tubulin. In these systems, the parental centrioles were diluted from the population over many cell divisions, and phenotypic analysis would only include the centrioles that formed in the absence of epsilon-tubulin. To make their major claim, the authors need to demonstrate that the basal bodies of sperm flagella with normal ultrastructure were formed in the absence of epsilon-tubulin, and were not normal parental centrioles. Given the difficulty of this experiment, the authors may instead choose to remove their claim that epsilon-tubulin plays a different role within mammalian germ cells. *

      Response: The authors thank Reviewer 1 for their detailed input regarding TUBE1’s centriolar importance across species. From their feedback, we recognize the need to modulate our interpretation of this result. We have also added a line to our manuscript highlighting that the normal axonemal structure observed may be due to the inheritance of normal centrioles (lines 328-329). We note however, that sperm produced within the null animals were immotile and that motility could not be recovered by the addition of exogenous ATP thus revealing that TUBE1 is required to form functional sperm tails.

      Reviewer 2:* It will help if the introduction summarizes the knowledge on Epsilon tubulin in spermatogenesis with emesis on its localization and the method used to find the localization. *

      Response: We have modified the introduction accordingly in lines 72-73.

      Reviewer 2:* How many independent mutant animals were studied, and what was the elfishness of generating mutants with a complete mutant testis? From Fig s1c, it appears all mutants generated were total mutations in almost all cells - is this correct? *

      Response: We have updated the number of animals studied as per the comment below. Regarding the mutant status of our mouse model, we used Stra8-Cre which is active between early (postnatal day 3) spermatogonia to pre-leptotene spermatocytes (Sadate-Ngatchou et al., 2008) thus all spermatocytes, spermatids, and sperm will carry the deletion. As shown in Fig. S1C we measured a 90.1% reduction in Tube1 mRNA expression from purified spermatocytes. As mentioned above, we note that the purified germ cells always contain a low percentage of contaminating cells. Using our optimized Staput method we obtain isolated germ cell populations of high purity, where in spermatocyte populations we calculate 19% contamination with other testicular cell types (e.g. somatic Sertoli/interstitial cells, spermatogonia, spermatids) (Dunleavy et al., 2019). We therefore believe the 9.9% Tube1 mRNA expression detected in our Tube1GCKO/GCKO group are the origin of that residual mRNA. We have included this information in the materials and methods section (lines 491-493).

      Reviewer 2:* Add a definition to "ZED-tubulins." *

      Response: A definition to the ZED-tubulins can be found on line 32.

      Reviewer 2:* From the paper, it is unclear if Epsilon tubulin is dispensable for centriole function only in sperm cells or if the same is true in mice somatic cells in vivo. *

      Response: In this study we have used a conditional male germ cell knockout mouse model to examine TUBE1’s function specifically in male germ cells. As mentioned in our introduction, the function of TUBE1 has not been examined in murine somatic cells in vivo (lines 68-70). To avoid confusion, we have reiterated this point in lines 356-358 of our discussion.

      Reviewer 2:* Fig. S1 and other figures: "n {greater than or equal to} 3 samples/genotype" - this is unclear - please indicate the number of independent animals tested. *

      Response: We have modified the figure legends accordingly in lines 11-13 and 33-35 of the transferred supplementary information file and lines 787-788 and 810-811 of the transferred manuscript file.

      Reviewer 2:* "suppressing supernumerary centriole formation" is this due to access centriole formation or failed mitosis? *

      Response: We acknowledge Reviewer 2’s comment is similar to the comment made by Reviewer 1 above and note we have modified the associated text in lines 207-209 in response to the above comment.

      Reviewer 2:* The KATNAL1, KATNAL2, and KATNB1 staining in Fig 5 show multiple foci in the nucleus. Are these foci-specific staining or nonspecific? It is surprising to see such a large complex. *

      Response: As outlined in the materials and methods and the Fig. 5 legend, Fig. 5 displays three-dimensional (3D) z-stack images of whole elongating spermatids presented as 2D maximum intensity projections. The katanin subunit staining is around the nucleus rather than inside of it, however the flattening of the image from 3D to 2D make the foci appear inside the nucleus. To clarify this, we have modified the Fig. 5 legend in lines 845 and 848.

      Reviewer 2:* How the staging of spermatids was performed needs to be explained in the method. *

      Response: We have included additional explanation the materials and methods section (lines 513-514).

      Reviewer 3: The experimental part is of the highest quality and the manuscript is very well written. My only reservation with the manuscript is concerning the model proposed for manchette migration in the Discussion section (Figure 6). I find the proposed model highly speculative and pre-mature, not supported enough by data, as even admitted by the authors (lines 415-427). Having it as a figure and concluding remark gives it too match weight, my suggestion would be to remove figure 6 and tone down the discussion.

      Response: The authors thank Reviewer 3 for their complimentary overview of our manuscript. We agree that some unanswered questions remain in our proposed model of manchette migration. This study has however, added several critical missing pieces. With respect, we prefer to keep Figure 6 in the manuscript as explaining manchette function to non-experts is very difficult without a visual aide. To ensure transparency with the audience that our model is indeed hypothetical, we have edited our discussion and Figure 6 legend to reflect this (lines 406, 417, 428, 435, 463, 860, 863, 869).

      4. Description of analyses that authors prefer not to carry out

      None

      References

      DUNLEAVY, J. E., GRAFFEO, M., WOZNIAK, K., O’CONNOR, A. E., MERRINER, D. J., NGUYEN, J., SCHITTENHELM, R. B., HOUSTON, B. J. & O’BRYAN, M. K. 2022. Male mammalian meiosis and spermiogenesis is critically dependent on the shared functions of the katanins KATNA1 and KATNAL1. bioRxiv, 2022.11.11.516072.

      DUNLEAVY, J. E. M., O’CONNOR, A. E. & O’BRYAN, M. K. 2019. An optimised STAPUT method for the purification of mouse spermatocyte and spermatid populations. Molecular Human Reproduction.

      DUNLEAVY, J. E. M., OKUDA, H., O’CONNOR, A. E., MERRINER, D. J., O’DONNELL, L., JAMSAI, D., BERGMANN, M. & O’BRYAN, M. K. 2017. Katanin-like 2 (KATNAL2) functions in multiple aspects of haploid male germ cell development in the mouse. PLOS Genetics, 13.

      LEHTI, M. S. & SIRONEN, A. 2016. Formation and function of the manchette and flagellum during spermatogenesis. Reproduction, 151__,__ R43-54.

      MORENO, R. D. & SCHATTEN, G. 2000. Microtubule configurations and post-translational alpha-tubulin modifications during mammalian spermatogenesis. Cell Motil Cytoskeleton, 46__,__ 235-46.

      SADATE-NGATCHOU, P. I., PAYNE, C. J., DEARTH, A. T. & BRAUN, R. E. 2008. Cre recombinase activity specific to postnatal, premeiotic male germ cells in transgenic mice. Genesis, 46__,__ 738-42.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In this study Stathatos et al looked at the function of epsilon tubulin (tube1), specifically in male germ cells. Previous work showed that tube1 is an important member of the tubulin family but its function is more enigmatic compared to alpha, beta and gamma tubulin. The authors produced a mouse KO line of tube1 and the data presented in this manuscript concerns the effects on spermatogenesis. They found that tube1 is essential for multiple microtubule dependent functions, including meiosis, nuclear shaping and sperm motility.

      The experimental part is of the highest quality and the manuscript is very well written. My only reservation with the manuscript is concerning the model proposed for manchette migration in the Discussion section (Figure 6). I find the proposed model highly speculative and pre-mature, not supported enough by data, as even admitted by the authors (lines 415-427). Having it as a figure and concluding remark gives it too match weight, my suggestion would be to remove figure 6 and tone down the discussion. Minor points, a substantial percentage of sperm produced had a normal head shape in the KO (Figure 1I), which undermine the function of tube1 in nuclear shaping, the author should address this point in their manuscript. It is also curious whether there are phenotype in other tissues, can the authors comment on that?

      Significance

      The observations reported are novel and will be highly valuable specifically for the sperm biology field but also very interesting to the microtubule field in general.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      The paper "Epsilon tubulin is an essential determinant of microtubule-based structures in male germ cells" provides the first insight into the essential function of Epsilon tubulin. TUBE1 (epsilon tubulin) is a non-canonical tubulin localized at the pericentriolar material of somatic and germ cell centrosome. TUBE1 has been primarily studied in unicellular organisms and cell lines, and multiple studies have shown its role in ciliogenesis and flagellum formation. However, its role in mammals, specifically in fertility, is unknown. Here, Stathatos et al address the critical question of whether TUBE1 plays a role in mammalian spermatogenesis and fertility. The authors show by germline inactivation of TUBE1 that the mice lacking TUBE1 are sterile, defective in meiosis, form abnormal manchette, and sperms are nonmotile. The authors further correlate that the TUBE1 functions together with KATNAL-1, KATNAL-1, and KATNB1, the microtubule severing protein. As little is known about the role of non-canonical tubulin like TUBE1 in fertility, this manuscript addresses a significant knowledge gap and generates an exciting hypothesis that TUBE1 regulates the KATNAL1-KATNB1 and KATNAL2-KATNB1 dynamic at manchette microtubules and perinuclear ring to control the manchette microtubule severing and migration.

      Overall, the paper suggests that Epsilon tubulin is essential for multiple complex microtubule arrays, including the meiotic spindle, axoneme, and manchette; however, in the absence of Epsilon tubulin localization data, it is unclear which microtubule array is affected directly and which indirectly (e.g., is the axoneme defect is due to Epsilon tubulin in the axoneme or centriole?). In particular, it is interesting that in mice sperm, Epsilon tubulin is dispensable for centriole-mediated axoneme formation, its primary function in single-cell organisms (can this be due to compensation by the other tubulin isoforms?). Once the concerns below are resolved, the paper will be significant for the cytoskeleton and reproductive research fields.

      Major comment

      • Considering the suggested non-canonical function of Epsilon tubulin outside the centriole in mice sperm, it is critical to know the localization of the protein in spermatocytes during meiosis and spermatids during differentiation.
      • Localization of Epsilon tubulin is needed to distinguish between mutant sperm cells and those that are not Epsilon tubulin mutants in the Tube1GCKO/GCKO mice. E.g., are the 28.07% of Tube1GCKO/GCKO tubules that showed a Sertoli cell only (SCO) phenotype the one where all the cells are mutants?

      Minor comment

      • It will help if the introduction summarizes the knowledge on Epsilon tubulin in spermatogenesis with emesis on its localization and the method used to find the localization.
      • The generated conditional germ cell-specific mutants are demonstrated by mRNA expression spermatocytes. It would help if DNA sequencing, western, and Immunohistochemical staining were used to show the gene and protein are affected.
      • How many independent mutant animals were studied, and what was the elfishness of generating mutants with a complete mutant testis? From Fig s1c, it appears all mutants generated were total mutations in almost all cells - is this correct?
      • Add a definition to "ZED-tubulins."
      • "Suggesting a core TUBE1 function that can be supplemented by either z-tubulin or TUBD1." Can you test what happens to mice Z and D tubulin isoforms in the mutant? Did their level increase in the centrioles? This is informative since there is no clear centriolar phenotype (other than centriole number that may be due to cell division failure) in mice spermatogenesis and the paper's central hypothesis in the introduction.
      • From the paper, it is unclear if Epsilon tubulin is dispensable for centriole function only in sperm cells or if the same is true in mice somatic cells in vivo.
      • Fig. S1 and other figures: "n {greater than or equal to} 3 samples/genotype" - this is unclear - please indicate the number of independent animals tested.
      • "suppressing supernumerary centriole formation" is this due to access centriole formation or failed mitosis?
      • The KATNAL1, KATNAL2, and KATNB1 staining in Fig 5 show multiple foci in the nucleus. Are these foci-specific staining or nonspecific? It is surprising to see such a large complex.
      • How the staging of spermatids was performed needs to be explained in the method.
      • The authors looked at the Metaphase stage cells to assess meiosis. It would be more interesting to look at the meiosis prophase I. Since the Stra8 acts very early leptotene stage, it would be interesting to see if meiosis is defective from the very beginning. Also, some suggest that the manchette is nucleated at the pachytene stage. Is the manchette defective from the very early stage of nucleation?
      • Is the acetylation of manchette microtubules affected in the absence of TUBE1?

      Significance

      Overall, the paper suggests that Epsilon tubulin is essential for multiple complex microtubule arrays, including the meiotic spindle, axoneme, and manchette; however, in the absence of Epsilon tubulin localization data, it is unclear which microtubule array is affected directly and which indirectly (e.g., is the axoneme defect is due to Epsilon tubulin in the axoneme or centriole?). In particular, it is interesting that in mice sperm, Epsilon tubulin is dispensable for centriole-mediated axoneme formation, its primary function in single-cell organisms (can this be due to compensation by the other tubulin isoforms?). Once the concerns are resolved, the paper will be significant for the cytoskeleton and reproductive research fields.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      The ZED (zeta-, epsilon-, and delta-) tubulins are important, yet understudied, members of the tubulin superfamily. Here, Stathatos et al. build upon previously published work and leverage their expertise to uncover the roles of epsilon-tubulin in mouse male germ cells. The authors create a germ cell-specific Tube1 knockout mouse, using Stra8-Cre, which is active in spermatogonia before the meiotic divisions. The authors report that knockout of Tube1 results in a range of defects during spermatogenesis, including: 1) a loss of male germ cells 2) sperm motility defects 3) abnormally shaped sperm heads 4) abnormal meiotic spindle morphology and abnormal centrosome numbers 5) some defects in sperm axoneme ultrastructure, 6) disrupted manchette migration 7) increased levels of katanin subunits at the manchette. Most of the experiments are convincing and well done, and based on this work, the authors propose a novel model for regulation of the manchette. I believe this work is of interest and should be published with revisions addressing the following major and minor comments.

      Major comment:

      1. A major claim of the paper is that epsilon-tubulin plays a different role within mammalian germ cells (abstract, line 22; p9, lines 167-168; p15 lines 315-316), because the Tube1GCKO/GCKO mice can form some sperm with relatively normal ciliary ultrastructure, whereas ciliates lacking epsilon-tubulin fail to form cilia. However, it's unclear whether the centrioles that templated these normal cilia were formed before or after epsilon-tubulin loss. Given that centrioles are inherited from one generation to the next, it's possible that the few normal cilia may be templated by relatively normal parental centrioles. These parental centrioles would have been present in spermatogonia prior to Cre expression/epsilon-tubulin deletion, and inherited by a fraction of sperm after the mitotic and meiotic divisions, resulting in sperm with normal ciliary ultrastructure. Other spermatocytes may have inherited centrioles formed in the absence of epsilon-tubulin, resulting in aberrant centrioles similar to those reported in human somatic cells, but these would not form any sperm flagella due to a loss of cell viability, as has been reported for acentriolar cells in a p53+ background. Underscoring this point, Chlamydomonas and human somatic mutant cells constitutively lack epsilon-tubulin. In these systems, the parental centrioles were diluted from the population over many cell divisions, and phenotypic analysis would only include the centrioles that formed in the absence of epsilon-tubulin. To make their major claim, the authors need to demonstrate that the basal bodies of sperm flagella with normal ultrastructure were formed in the absence of epsilon-tubulin, and were not normal parental centrioles. Given the difficulty of this experiment, the authors may instead choose to remove their claim that epsilon-tubulin plays a different role within mammalian germ cells.

      Minor comments:

      1. The authors claim that because the TUBE1 knockout mouse have abnormal centrosome numbers during meiosis, there is a role for TUBE1 in suppressing supernumerary centriole formation. While this is one possibility, it's also possible that abnormal centrosome numbers arose as a result of cell division defects, especially because binucleate cells are present in mutants. The authors should edit the text to state that abnormal centrosome numbers may arise from either supernumerary centriole formation (by the templated or de novo pathways) or from failure to complete cell division.

      OPTIONAL: to test these possibilities, the authors may choose to 1) count the number of centrioles in meiosis with two different centriole markers 2) stain for markers of mature centrioles, such as Cep164, to determine the number of parental centrioles. 2. In figure 5, based on quantification of fluorescence intensity, the authors conclude that loss of epsilon-tubulin results in an increase in the levels of KATNAL1, KATNAL2, and KATNB1. Given the inherent variability in immunofluorescence staining, the authors should at a minimum normalize their intensity measurements to those of an unrelated control protein stained in the same cell (ex: alpha-tubulin). It would be more convincing to quantify the levels of these proteins by Western blot (again, normalized to a control protein or to total cellular protein), which should be feasible given that the authors can isolate elongating spermatids.

      Significance

      The strengths of this study lie in the careful phenotypic analysis of loss of epsilon-tubulin, which is well-done and very thorough. The limitations of the study are in interpretation of the results, specifically as relates to centriole formation, but can be addressed as indicated above. This work will be of interest to cell and developmental biologists, especially those interested in centrosomes, cilia, and spermatogenesis.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer 1 major comments:

      The authors show one configuration of the E1-E2 heterodimer in Figure 4d. As shown, the E1 protein is exterior to the E2 protein and would suggest E1 is on the surface on the spike complex and virus surface. However, another configuration of the glycoproteins has E2 on the exterior of E1 and also on the exterior of the virus. The latter conformation is what has been observed in cryoEM studies of alphaviruses. The first configuration represents the E1-E2 between the three heterodimers which are important for spike assembly. The reason the orientation of the E2-E1 dimer is important is the authors speculate on the importance of the 6 CHIK residues not found in ONNV based on the structure, but the structural interpretation is, in my opinion, not correct.

      We thank reviewer 1 for pointing out the correct E2-E1 heterodimer configuration. To address this, we corrected the position of E2 and E1 in Figure 4 based on previous cryoEM study1, keeping E2 always on the exterior in the E2-E1 heterodimer. We also replaced the Indian Ocean Lineage (IOL) E2-E1 structure1 in the original Figure 4 with the CHIKV 181/clone 25 structure which was recently analyzed by Katherine Basore et al.2. In a single E2-E1 heterodimer, all six unique CHIKV positive selection sites are located on the outside of the structure after correcting the configuration. In addition, we investigated two of the unique CHIKV positively selected sites that are important for virion production, E2-V135 (V460 in the original manuscript version) and E1-V220 (V1029 in the original manuscript version), in trimerized structure of E2-E1 heterodimers. We found that the E2-V135 and E1-V220 residues in one heterodimer are facing E2 of the neighboring heterodimer on either side. Interestingly, while V135 is embedded between the E2 proteins of two different heterodimers, E1-V220 is partially embedded by E1 and the neighboring E2 and partially exposed to the outside. This suggests that even though both E2-V135 and E1-V220 might be crucial for CHIKV E2-E1 trimerization, E1-V220 provides an additional docking site for host factor interactions. We thank review 1 again for this important comment leading to these new findings. We have updated Figure 4F-4G and the corresponding result section (lines 201-209) in this partially revised manuscript.

      1. Validation of E1 interaction with SPSC3 and eIF3k needs to be stronger. Some concerns/questions are listed below. A myc tag was inserted between E3 and E2. How efficiently does furin cleave E3 from E2 in this virus and how are viral titers of the myc-tagged virus compared to the non-tagged virus? I ask because is the IP looking at what is being pulled down by E2 or E3-myc-E2 that could be part of the spike polyprotein? The authors found E2 interacts with E3, E1 and a list of other host proteins. These results suggest several interactions including E2-host factor, E2-E1, E2-E3, E2-E1-host factor, E2-E3-E1, E2-E3-host factor. In figure 6d, and the subsequent conclusions, the authors suggest E1 is interacting with the host factor and do not see E2 alone and very low amounts of E3-E2-6K-E1. based on how the IP was performed I am not sure how an interaction between E1 and SPCS3 alone, without E2, would be detected. I would also like to see a reciprocal pull down using E1 and also E2 to see if these host factors are pulled down.

      We thank the reviewer for these concerns. Given the low viral protein expression in macrophages (Figure 1A), we need an efficient system to enrich for large amounts of CHIKV glycoproteins for identifying host interactors through mass spectrometry. Adding tag/reporter proteins, such as mCherry, between E3 and E2 have been used to label alphavirus glycoproteins in previous study2, which is why we chose to use this myc tag labeling strategy coupled with myc Ab-conjugated agarose beads for AP-MS. However, like reviewer 1 speculated, inserting myc tag between E3 and E2 does attenuate CHIKV infectivity according to the reduced supernatant viral titers of 293T cells transfected with CHIKV/myc-E2 genomic RNA in comparison to those of cells transfected with unmodified CHIKV vaccine strain 181/clone 25 genomic RNA (shown in revision plan). Despite the attenuation, CHIKV/myc-E2 harvested from transfected 293T cells still reaches a titer over 108 pfu/ml, which allowed us to identify interactors by AP-MS.

      We further analyzed the cleavage efficiency of glycoproteins by comparing the expression levels of E3-E2-6K -E1, E3-E2 (p62), E2, and E3 in 293T cells transfected with unmodified CHIKV or CHIKV/myc-E2 genomic RNA (result shown in revision plan). We didn’t detect any uncleaved forms of glycoproteins in cells transfected with either unmodified CHIKV or CHIKV/myc-E2 RNA when we probed with E2 antibody. However, probing with E3 antibody prior to longer exposure of the immunoblot showed higher E3-E2-6k-E1 and E3-E2 (p62) levels in cells transfected with CHIKV/myc-E2 RNA, suggesting that both mature E2 and E2-containing precursor polyproteins are available to be pulled down. Overall, the expression levels of mature E2 detected by E2 antibody are similar.

      We thank reviewer 1 for providing a thorough dissection of all the possible interactions between the identified host factors and cleaved/uncleaved glycoproteins. This is a very interesting question. As reviewer 1 mentioned that E1 usually appears with E2 or E3-E2 in heterodimer forms, we were also surprised to find that E2 does not interact with either of the two host factors. To address this, we plan to conjugate E2 and E1 to protein A/G beads, respectively, for a reciprocal pulldown to validate CHIKV glycoprotein interactions with SPCS3 and eIF3k. Results from this experiment will be included in the fully revised manuscript.

      1. If CHIK E1 is interacting with the host factors and that is antagonizing the antiviral response of SPSC3 (as one example), then what do pull downs using ONNV structural proteins look like? One would expect reduced interactions because the different amino acid causes a different E2-E1 dimer or attenuates the E1-host factor binding site.

      We thank Reviewer 1 for this insightful suggestion. We agree that it would be informative to examine the interactions between ONNV glycoproteins and identified host factors (SPCS3 and eIF3k). Unfortunately, there is no commercial ONNV glycoprotein antibody available making this experiment unfeasible. Interestingly, we did observe reduced interactions between the host factors SPCS3 and eIF3k and the CHIKV E1-V220I mutant (V1029I in original manuscript version) where the positively selected site in E1 was mutated to the homologous ONNV residue (please refer to our response to Reviewer 3’s major comment #1). This result suggests that the ONNV glycoproteins likely have an attenuated E1-host factor binding site as the reviewer speculated.We have included this as Figure 7A in partially revised manuscript.

      1. E1 and E2 are thought to interact during polyprotein translation and the initial dimer forms in the ER. If E1 is interacting with SPSC3 in the ER, is E2 also present? Or is a population of E1 not interacting with E2 in order to inhibit SPSC3? I would love a model of how the authors see all these factors coming together for this new role of E1.

      We thank Reviewer 1 for proposing this interesting hypothesis. Given the unexpected absence of E2 in our validation of host factor-E1 pulldown, we speculate that a group of free E1 proteins with distinct function is interfering with host factors in the ER, which is a model worth further investigation and discussion. A great example of this is the alphavirus nonstructural protein 3 (nsP3) that plays essential roles in RNA replication, although depending on the alphavirus not all of the nsP3 in the cell colocalizes with dsRNA, suggesting there is a separate distinct pool of nsP3 outside of active viral replication complex that interacts with host factors in these observed larger cytoplasmic aggregates3. To address this, we plan to use laser confocal microscopy to observe the interactions between host factors (SPCS3, eIF3k), and CHIKV E2 and E1. We will include this result as well as our proposed model in the fully revised manuscript.

      Reviewer 1 minor comments:

      1. In Figure 1c, (-) RNA is shown but in the rest of the figures (+) RNA is shown. Show both or select one. I do find it interesting the (-) RNA levels are similar over time, even at 4 hours post transfection (early time). Related to this, ONNV has higher levels of (-) RNA but what is known about structural protein levels in ONNV and CHIK in macrophages? Are there comparable levels of CP and GP being produced?

      We thank Reviewer 1 for this comment. The (-) RNA is synthesized before the synthesis of subgenomic mRNA and therefore can reflect more accurately early viral replication and nonstructural protein functions. This is the reason why we consider the (-) RNA levels evaluated by specific nsP1 TaqMan probes to be more appropriate for determining early stage differences between ONNV and CHIKV replication in Figure 1 as the goal of that figure is to define the steps in CHIKV life cycle that are more efficient than those of ONNV in THP-1 derived macrophages. On the other hand, the (+) RNA evaluated by E1 primers that we used in the later figures monitors viral RNA synthesis over time in the reflection of genomic (+) RNA and subgenomic mRNA transcribed from (-) RNA templates. Similar levels of (+) RNA and contrasting virion titers really point the difference to the later stages of subgenomic mRNA translation, viral glycoprotein secretion, and assembly.

      We have generated ONNV/myc-E2 reporter virus and assessed viral glycoprotein expression through flow cytometry using a FITC -conjugated anti-myc antibody in the THP-1 derived macrophages transfected with CHIKV/myc-E2 and ONNV/myc-E2 (shown in revision plan). The results show that the expression of ONNV glycoproteins is more inhibited than that of CHIKV glycoproteins, though both of their expression levels in macrophages seem to be suppressed. Since there is no commercial ONNV antibody available, we were unable to compare capsid expression levels between the two viruses. Overall, differences in the myc-tagged glycoprotein expression levels of the two viruses reveals ONNV defect in either structural protein translation or glycoprotein maturation .

      1. Figure 2e and figure 3 have ONNV has the first bar followed by CHIK. In figure 1 and 2b, CHIK is first and then ONNV. helps the reader to have the controls in the same order.

      We thank Reviewer 1 for this suggestion. We have changed the order of ONNV and CHIKV bars in figure 2E and figure3 so the CHIKV bar consistently comes first in all the figures.

      1. Line 143-145 the authors discuss that when ONNV is the backbone and CHIK proteins are inserted the infection is more attenuated because of the E2 and E1 are from CHIK and ONNV, not the same virus (could also be E2-CP interactions are disrupted). However the chimeras made with the CHIK backbone (in Figure 2) have a mismatch between E2 and E1 as well.

      We thank Reviewer 1 for this informative comment. We agree that the incompatible E2-E1 heterodimer formation may not be the only reason that causes attenuation of ONNV/CHIKV E1 and ONNV/CHIKV E2. There may be multiple factors contributing to the fitness of the chimeras, which requires more in-depth mechanistic investigations and is out of the scope of this study. We have now removed the explanation “potentially due to incompatible heterodimer formation between ONNV E2 and CHIKV E1” in line 144.

      1. When discussing the residues that were found in the FEL and MEME analysis, the authors start the amino acid numbering from CP and continue along the polyprotein. Usually when discussing amino acids in the structural proteins, each protein starts at amino acid 1. So V460 would be E2-V135. It would also be useful to know what the residues in ONNV were at these positions to see if amino acids changed in charge, size, bond forming potential, etc. Showing these residues in the E2-E1 conformation found in the virion would also allow one to find adjacent residues that could explain differences in spike assembly and potentially where/how E1 is binding to a host protein.

      We thank Reviewer 1 for this comment. We revised the amino acid numbers in the manuscript to start from the beginning of each structural protein. To look more into these residues in ONNV, we aligned CHIKV and ONNV from different lineages and compared the 6 positively selected sites (refer to our response to Reviewer 1’s minor comment #5). We found that E2-135 and E1-220 which are essential for CHIKV production are valines in all the aligned CHIKV strains. For the aligned ONNV strains, E2-135 are all leucines and E1-220 are all isoleucines. While valine, leucine and isoleucine are all amino acids with hydrophobic side chains, valine has the shortest side chain. The length of the side chains may lead to different hydrophobic properties that affect protein folding, which warrants further structural analysis.

      1. How effective is a non-attenuated CHIK strain in infecting macrophages? Could you make a SINV-La Reunion chimeric virus (which is BSL2) to see if a higher percentage of macrophages are infected and is this potentially contributing to the increased pathogenesis of La Reunion? Also how different is 181/25 with a pathogenic strain in the E2 and E1 residues? and compared to ONNV?

      We thank Reviewer 1 for this question, which is also raised by Reviewer 2. In order to address this question, we plan to use the virulent CHIKV La Reunion strain to study the infection of THP-1 derived macrophages with non-attenuated CHIKV in BSL-3. We are getting trained in the BSL-3 facility and will soon be certified.

      We thank Reviewer 1 for this insightful suggestion on investigating the conservation of these positively selected sites in different strains. We have aligned the sequences of ONNV and CHIKV strains from different lineages, including CHIKV vaccine strain 181/clone 25 and Thai strain AF15561 (the parental strain of CHIKV 181/clone 25) (alignment shown in revision plan). We found that the two positively selected sites with negative effects on virion production, E2-135 and E1-220 (sites 460 and 1029 in original manuscript version), are very conserved in either CHIKV or ONNV strains. CHIKV E2-135 is always valine (V) regardless of the lineages, while ONNV E2-135 is always leucine (L). CHIKV E1-220 is always V, while ONNV E1-220 is always isoleucine (I).

      We also analyzed the amino acid heterogeneity of E2-135 and E1-220 in 397 CHIKV patient sequences from NCBI Virus database. Most of the amino acids at these 2 sites are V. The counts of each amino acid at E2-135 and E1-220 is summarized in table below. This result suggests that valine residues at E2-135 and E1-220 are crucial for CHIKV fitness and strongly selected during viral evolution. The sequence alignment and table will be included and discussed in the fully revised manuscript .

      E2-135

      E1-220

      Valine (V)

      394

      392

      Alanine (A)

      1

      3

      Methionine (M)

      1

      0

      Glutamic acid (E)

      0

      1

      Glycine (G)

      1

      0

      Isoleucine (I)

      0

      1

      1. When describing the last results section, "CHIKV E1 binding proteins exhibit potent anit-CHIV activities" the authors use macrophages. In the rest of the text they consistently use THP-1 macrophages or human primary monocyte derived macrophages. The details of the cell type are extremely useful to the reader and having those in the last results section would be great.

      We thank Reviewer 1 for pointing out the importance of cell type clarification in the last results section. We now consistently use “THP-1 derived macrophages” instead of “macrophages” in this section.

      1. The paper is well-written. There is a slight disconnect as the authors go from discussing results in Figure 4 to Figure 5.

      We thank Reviewer 1 for the comment regarding the disconnection of the last two figures in this paper which is also shared by the other reviewers. We have taken 3 approaches to address this comment: 1) We performed a pulldown of the host factors (SPCS3, eIF3k) identified in Figure 5 with CHIKV positively selected mutants examined in Figure 4 with deficient virion production. The result is presented in our response to Reviewer 3’ s major comment #1, suggesting that the positively selected site in E1 is essential for CHIKV glycoprotein interaction with host factors. 2) To complement our first experiment, we will also determine structural protein expression and processing of parental and E1 mutant CHIKV in eIF3k CRISPR knockout 293T cells. 3) Finally, we plan to perform CORUM analysis to identify high confidence functional protein complexes using our 14 hits found in both mass spec experiments, which will provide mechanistic insights into how these identified cellular complexes and processes might modulate CHIKV infection.

      Reviewer 2’s major comments

      The authors elegantly demonstrate that CHIKV structural proteins confer an advantage over ONNV structural proteins in a step in the replication cycle downstream of virus RNA synthesis, possibly virion assembly. This point would be strengthened determining the particle-to-PFU ratio of the parental viruses and the chimeras . Presumably, the ratio would increase in the chimeras containing CHIKV structural proteins.

      We thank Reviewer 2 for this comment. We agree that determining particle-to-PFU ratios of parental and chimeric viruses will strengthen this study. To obtain the particle-to-PFU ratio, we infected THP-1 derived macrophages with CHIKV, ONNV and chimeras containing CHIKV glycoproteins (Chimera I, and ONNV/CHIKV E2+E1) for 24 h. To quantify the secreted viral particles, we extracted viral RNA in the supernatant and detected (+) viral RNA through TaqMan assay with specific nsp1 probes. The released infectious virions were evaluated through plaque assay. The particle-to-PFU ratios are summarized in the table below. The results show that ONNV has the highest particle-to-PFU ratio (41398), suggesting defective ONNV genome encapsidated in particles leading to defective virion production. On the other hand, the particle-to-PFU ratio of CHIKV (747) is 55-fold lower than that of ONNV. Replacing E3-E2-6K-E1 of ONNV with CHIKV homologous proteins reduces the particle-to-PFU ratio by 8 fold to 4875. Replacing E2 and E1 of ONNV with the ones from CHIKV (ONNV/CHIKV E2+E1) reduces the particle-to-pfu ratio by 20 fold to 2017, suggesting that CHIKV glycoproteins enhance the infectivity of viral progenies produced by THP-1 derived macrophages. We have included the results in Figure 3D-3E in our partially revised manuscript and described in lines 149-158.

      1. Additionally, the authors should consider performing virion assembly blocking assays with a small molecule inhibitor to determine if this abrogates the virus production advantage of CHIKV structural proteins within the ONNV backbone.

      We thank Reviewer 2 for this insightful comment. As the secretory pathway is commonly important for alphavirus glycoprotein maturation and assembly, it will be informative to interrogate CHIKV glycoprotein trafficking and assembly through this pathway using specific inhibitors, such as dihydropyridine FLI-06 and golgicide A . Golgicide A is a reversible inhibitor of the cis-Golgi GBF1, which leads to rapid disassembly of the Golgi and trans-Golgi network (TGN)4. FLI-06 is a new inhibitor that interferes with cargo recruitment to ER-exit sites and disrupts Golgi without depolymerizing microtubules or interfering GBF15. We pretreated THP-1 derived macrophages with 10 uM FLI-06 or golgicide A for 30 mins prior to infection with CHIKV, ONNV, Chimera I, or ONNV/ CHIKV E2+E1. After 1 hour of virus adsorption in PBS with 1% FBS in the absence of the inhibitors, the cells were treated with the inhibitors at the same concentration (10uM) in complete medium for 24 h. The plaque assay result shows that all the viruses are sensitive to secretory pathway inhibition, however, the production of viruses containing CHIKV glycoproteins is significantly more attenuated by FLI-06 and golgicide A. This suggests that CHIKV glycoproteins-mediated trafficking and assembly is more heavily dependent on the host secretory pathway . We will include this result in the fully revised manuscript.

      1. Finally, the authors should perform competition experiments with the chimeric viruses and ONNV in macrophages to determine if the chimeras can outcompete the parental ONNV strain. Based on their data, the chimeric viruses should outcompete.

      We thank Reviewer 2 for this inspiring suggestion. The competition experiment is an innovative and informative way to evaluate whether CHIKV glycoproteins confer a selective advantage on virion production in THP-1 derived macrophages. We plan to infect THP-1 derived macrophages with ONNV and ONNV/CHIKV E2+E1 and detect the viral glycoproteins secreted in the supernatant by western blot, although there is a possibility that this experiment might not work due to superinfection exclusion. Given that there is no commercial antibody of ONNV available, we need to use tagged viruses for this competition experiment. We constructed ONNV/CHIKV myc-E2+E1 that has a myc tag at the N-terminus of CHIKV E2, and ONNV/HA-E2 that has a HA tag at the N-terminus of ONNV E2. Our first attempt at concentrating the viral progenies released by THP-1 derived macrophages infected with the two tagged viruses has not been successful. We performed sucrose gradient ultracentrifugation of the supernatant viral particles but the myc and HA tags were not detected in the expected sucrose layer. Next, we plan to use myc-Ab and HA-Ab conjugated beads to pull down the supernatant viral particles to detect the ratio of ONNV/CHIKV myc-E2+E1 and ONNV/HA-E2 secreted by THP-1 derived macrophages. This will determine whether ONNV containing CHIKV glycoproteins can outcompete ONNV in co-infected cells due to increased viral fitness.

      1. The authors use both primary macrophages and macrophage cell lines as their in vitro model system and make one of their major points (listed in the title) that the determinants they identified in the CHIKV structural proteins convert macrophages into dissemination vessels; however, they do not show: 1) an in vivo model that the CHIKV-ONNV chimeras disseminate more efficiently than the parental ONNV; and 2) that these chimeras generate virus more efficiently specifically in macrophages. It would be useful to show that ONNV and CHIKV have equivalent virion production in other cell lines and that the advantage conferred by CHIKV structural proteins in the ONNV backbone is specific to macrophages. The authors should also change their title to reflect that dissemination is not directly being addressed in their study; the implications of their in vitro experimentation in a mammalian host would be more appropriate for the discussion.

      We acknowledge the limitations of the study, which include a lack of direct demonstration of in vivo dissemination. To address these concerns, we will include further discussion of our in vitro findings in the context of viral dissemination in mammalian hosts in the fully revised manuscript. We are also testing ONNV, CHIKV, Chimera I and ONNV/CHIKV E2+E1 infections in 293T cells to investigate whether the advantage conferred by CHIKV glycoproteins are macrophage specific.

      We have also updated the title to accurately reflect the significance of this research: “Chikungunya virus glycoprotein targeting of host factors increases viral fitness in human macrophage”.

      Reviewer 2’s optional comments

      1. The authors use CHIKV-ONNV chimeras but it would be interesting to test other chimeras to determine if CHIKV structural proteins confer the same advantage in the backbone of other arthritogenic alphaviruses. The study would also be strengthened by using a pathogenic strain of CHIKV instead of the vaccine strain, as this is significantly attenuated in vivo.

      We thank Reviewer 2 for this suggestion which is also suggested by Reviewer 1 in their minor comment #5. We plan to use virulent CHIKV La reunion strain and carry out infection experiments in BSL-3 to strengthen this study. We are getting trained in the BSL-3 facility and will be certified soon.

      1. In Figure 4, the authors identify residues in the CHIKV structural proteins that appear to be under positive selection in human subjects and generate point mutants in these residues with the corresponding ONNV residues. They find that one mutation, V1029I located in E1, completely abolishes virion production in THP-1 macrophage cell lines. However, in their previous chimeric experiments, they find that neither CHIKV E1 or E2 was sufficient to increase virus production in the ONNV backbone. The authors should address this discrepancy, otherwise they should consider moving the data in their point mutation experiments to a supplementary figure. While worthy of reporting, especially given the patient data, these experiments do not buttress the points made in the previous figures.

      We thank Reviewer 2 for this insightful comment. According to previous studies, E2 and E1 always interact with each other from the step of the formation of single heterodimer in the ER to heterodimer trimerization before viral particle assembly. Although the E1-V220 site (previously called V1029) on the exterior of a single E2-E1 heterodimer appears to not be engaged in the E2-E1 interaction E1-V220 is partially exposed and protruding into the groove formed by E1 and the E2 of neighboring heterodimer, accessible to host factors. As such, mutating CHIKV E1-V220 to the ONNV residue (E1-V220I) may not only disrupt E2-E1 trimerization but also interfere viral glycoprotein interaction with host factors(presented in our response to Reviewer 1’s major comment #1). Similarly, solely swapping E2 or E1 with CHIKV substitute in the ONNV backbone would also affect the interaction between neighboring E2 and E1 in trimerized spike, which may explain why neither ONNV/CHIKV E2 or ONNV/CHIKV E1 rescues virion production in THP-1 derived macrophages . We have included this in the partially revised discussion section lines __ __296-313.

      1. The authors conclude their manuscript with an assessment of several host proteins, namely SPCS3 and eIF3k, that were identified by mass spectrometry and whose knockdown results in increased virion production. The authors speculate about the role of these proteins but do not provide any mechanistic detail on how they might be playing a role. It is unclear that the putative antiviral role of these proteins involves steps downstream of virus replication, especially given that the authors speculate translation might be affected by eIF3k which, if the case, RNA synthesis should also be expected to be affected.

      We thank Reviewer 2 for this comment. We acknowledge that we have yet a full mechanistic understanding of how SPCS3 and eIF3k impact virion production. We plan to investigate their antiviral roles in our follow-up studies. For our partial revision, we have constructed several single eIF3k knockout (KO) clones of 293T cells. The eIF3k sgRNA we designed targets exon 3 which would eliminate expression of all 3 splice isoforms of eIF3k (KO schematic and sequence verification of CRISPR KO shown in revision plan). Unfortunately, we failed to obtain single clones of 293T cells with SPCS3 complete KO, consistent with a previous study by Rong Zhang et al6 that were unable to recover SPCS3 KO clones likely due to the importance of SPCS3 in cell survival. We infected an eIF3k KO clone (clone 9) with CHIKV vaccine strain 181/clone 25, ONNV SG650, and SINV Toto1101. Interestingly, we found that the antiviral activity of eIF3k is specific to CHIKV as CRISPR KO of eIF3k increases CHIKV production by 2.5 fold but not ONNV or SINV production (shown in revision plan). We have included this in the partially revised manuscript in__ line 272-282 (Figure 7B-7D).__

      We presume that Reviewer 2’s inference of eIF3k’s potential effects on viral RNA synthesis is based on our speculation of its antiviral role in viral translation, which may affect viral nonstructural gene expression. We would like to clarify that eIF3k is not an initiation factor traditionally needed for cap-dependent translation. It is also not clear what translation process (nonstructural polyprotein translation from viral genomic RNA or structural polyprotein translation from viral subgenomic mRNA) involves eIF3k if it indeed affects viral protein expression. Notably, previous SINV studies imply that alphavirus structural polyprotein translation may employ unique mechanisms without the requirement of several crucial initiation factors4,5. It will be interesting to see whether eIF3k participates in viral subgenomic mRNA translation as that would affect viral glycoprotein expression leading to reduced virion production. We have now included additional discussion on eIF3k antiviral mechanisms in the partially revised manuscript in lines 345-353.

      1. Overall, while the initial chimeric virus and domain swap approach is strong, the manuscript would benefit with a more thorough examination of virion assembly steps and a mechanistic link to virion production. Otherwise, the authors should revise the structure of their manuscript by de-emphasizing points about virion assembly and leave room for other mechanistic explanations of their chimeric data that more clearly link the host antiviral factor/E1 binding studies.

      We thank the reviewer for these positive comments and suggestions. We have addressed this by further interrogating the production kinetics of CHIKV, ONNV, and the chimeras containing CHIKV glycoproteins through determining their particle-to-PFU ratios as well as treating infected cells with secretory pathway inhibitors (refer to our responses to Reviewer 2 major comments #1 and #2). We have also included additional discussion on eIF3k antiviral mechanisms specifically on how it may affect other steps of the viral life cycle in the partially revised manuscript in lines 345-353 (refer to our response to Reviewer 2 optional comment #3).

      Reviewer 3’s critique comments

      1. Overall, the manuscript is well written but in its current state it is more like two different stories because the effects of envelope proteins and list of interactors are not brought together in one story. A possible fix to this problem would be inclusion of ONNV and CHIKV containing env mutations that do and do not restore viral release from macrophages into the pulldown/association experiments shown in Figure 6.

      We thank Reviewer 3 for the insightful suggestions to better connect the first (CHIKV determinants) and second (CHIKV glycoprotein interactors) parts of the manuscript. In response to the Reviewer’s comment, we tested the binding of SPCS3 and eIF3k to CHIKV E1 with E1-V220I (V1029I in original manuscript version) mutation (shown in revision plan) which was shown to abrogate virion production in THP-1 derived macrophages in Figure 4E. We transfected plasmids expressing 3XFLAG-tagged SPCS3/eIF3k or empty vector for 24 h followed by transfection with plasmids expressing either the parental CHIKV vaccine strain 181/clone 25 poly-glycoproteins (E3-myc-E2-6K-E1) or poly-glycoproteins with the E1-V220I mutation. Interestingly, we found that mutating CHIKV E1-V220 to the homologous ONNV residue reduces the binding to either SPCS3 or eIF3k. This result strongly suggests that the positively selected E1-V220 is located in the interaction interface between E1 and SPCS3/eIF3k, confirming the genetic conflict between E1 and these host factors to be one of the major drivers of CHIKV evolution observed at site E1-V220. We have included this result in partially revised manuscript in Figure 7A and in lines 265-271.

      1. The other major issue is the lack of protein data for the viral mutants relative to WT ONNV and CHIKV and assessment of viral RNA in the supernatants to determine whether the block is release or an earlier event since viral RNA levels in the cell seems to be the same or at least normalized.

      We thank Reviewer 3 for pointing out the insufficient clarification of the block leading to defective CHIKV mutant virion production. We previously detected E2 expression from 293T cells transfected with poly-glycoproteins (E3-myc-E2-6K-E1) containing E2-V135L (V460L in original manuscript version), E2-A164T (A489T in original manuscript version), E2-A246S (A571S in original manuscript version) and E1-V220I (V1029I in original manuscript version). We found that only E2-V135L mutation can lead to unexpected E2 cleavage (shown in revision plan) as we mentioned but not shown in the original manuscript. This explains why E2-V135L mutation attenuates infectious CHIKV production.

      The E2 expression of E1-V220I appears to be not affected in 293T cells transfected with poly-glycoproteins with E1-V220I (shown in revision plan ). In addition, the E1-host factor binding result in our response to Reviewer 3’s major comment #1 showed that E1 with the positively selected site mutation V220I can also be successfully expressed in 293T cells after transfection with poly-glycoprotein. Based on these current data, E1-V220I mutation likely abrogates virion production without affecting glycoprotein expression.

      Our previous result of the ONNV particle-to-PFU ratio reveals that ONNV RNA is released but encapsidated in defective particles causing its attenuation in infected macrophages. Thus, even though the glycoproteins of E1-V220I can be expressed, the diminished virion production of CHIKV E1-V220I can still be ascribed to 1) blocked viral particle release and 2) production of defective particles like ONNV. Given that it is not feasible to obtain particle-to-PFU ratio of E1-V220I mutant which fails to form plaques, Reviewer 3’s suggestion to assess the supernatant viral RNA will be a nice approach to address this question. To further address this concern, we plan to transfect THP-1 derived macrophages with CHIKV E1-V220I mutant RNA to detect the intracellular viral glycoprotein expression and supernatant viral RNA levels through western blot and TaqMan assay, respectively.

      1. Lastly, knockdown experiments indicate an effect of things like OAS3 or other innate immune modulators. There are no controls to demonstrate that these are specific to CHIKV infection or if knockdown would assist growth of ONNV as well.

      We also thank Reviewer 3 for the suggestion to check whether the identified host factors specifically target CHIKV or inhibit the infection of ONNV as well. We previously tried but were facing some issues. Since only a small fraction of macrophages can be infected with CHIKV and even a smaller fraction can be infected with ONNV (Figure 1A), it is hard to elucidate the roles of these identified host factors in ONNV infection by siRNA knockdown. We decided to take a more rigorous approach to investigate the antiviral specificity of identified host factors, especially understudied SPCS3 and eIF3k, to different alphaviruses by generating complete knockout 293T single cell clones. Despite the fact that we did not successfully generate SPCS3 complete KO, we obtained an eIF3k KO single cell clone and infected it with CHIKV, ONNV and SINV (refer to our response to Reviewer 2 optional comment #3). We found that eIF3k only has antiviral activity against CHIKV with almost no effects on ONNV or SINV infection. We have included this in our partially revised manuscript in line 272-282 (Figure 7B-7D).

      Reviewer 3's minor comments:

      Other points to consider:

      1. The title does not fit the manuscript findings and should be modified.

      We thank Reviewer 3 for this important comment, which was also brought up by Reviewer 2. We have now changed our title to “Chikungunya virus glycoprotein targeting of host factors increases viral fitness in human macrophage”, which more accurately reflects the significance of our research.

      1. It is unclear why the authors show results for SINV and RRV in Figure 1. Either these should be removed or the viruses should be carried throughout the experiments described in the Figure. Better yet would be to add additional alphaviruses to this analysis to determine if there are additional viruses that act similarly to CHIKV.

      We apologize for the confusion caused by including SINV and RRV results in Figure 1. We intended to show the superiority of CHIKV in infecting primary monocyte derived macrophages among arthritogenic alphaviruses, which we speculate may provide the molecular basis for macrophage-mediated CHIKV dissemination and disease. We would like to keep the SINV and RRV infection results in Figure 1 to highlight the relative susceptibility of macrophages to CHIKV. To echo the additional alphaviruses tested in Figure 1 and bring the story full circle, we included the result of SINV infection of eIF3k CRISPR KO 293T cells in Figure 7B-7D. These results uncover inhibitory activities of eIF3k that are specific to CHIKV.

      1. Is the data presented in Figure 1A significant?

      We thank Reviewer 3 for this question. We infected both THP-1 derived macrophages and primary monocyte derived macrophages with EGFP-expressing alphaviruses each in duplicates for two independent times. The general low expression of EGFP in all virus-infected groups refrains us from drawing conclusions based on statistically significant differences observed with MFI, hence we chose to show representative scatter plots in the original manuscript. To address Reviewers 3's question, we plotted the infected cell (EGFP+) based on the percentages of the experimental duplicates (shown in revision plan), and found CHIKV infection to be the most significantly different from that of the other alphaviruses in primary monocyte derived macrophage . The numbers above the bar charts are the mean percentages of EGFP+ cells.

      1. The justification for inclusion of Figure 4A is lacking. It is unclear what this panel is supposed to be demonstrating.

      This is an excellent suggestion as the host factors identified by AP-MS not only contain interactors of CHIKV mature E2 but also those of uncleaved E2-containing precursor polyproteins. We modified Figure 4A to reflect all E2/E2-containing poly-glycoproteins present in CHIKV-infected cells (shown in revision plan).

      1. There is little justification for the candidates assessed in

      We understand Reviewer 3’s concern. Due to the nature of mass spectrometry studies which predict protein-protein interactions rather than direct functional validation, we acknowledge that we may miss some host candidates that have anti- or pro-CHIKV activities. Although justification of hit selection from mass spectrometry datasets is more difficult than that from CRISPR KO screen datasets, we set up specific criteria to identify host protein candidates with the greatest potential to functionally interact with CHIKV glycoproteins. Most of the proteins we chose to validate (Figure 6a) were identified in both of our independent AP-MS experiments, which both pass through a P-value threshold of 0.05 and log2 fold change of 0.

      1. Extended data Figure 3 is very difficult to read due to the small font size.

      We apologize for the small font in Extended data Figure 3. We plan to replace Figure EV3 ( Extended data 3 in unrevised version) with a CORUM protein-protein interaction network that centers on the significant hits identified by both AP-MS experiments, but includes hits from either one of the two experiments in these functional protein complexes. The figure will be more concise and centralized, and the font will be bigger.

      1. Just to be clear, the blots shown in Figure 6D are different from those depicted in Extended data Figure 4b, because some of them look very similar.

      We thank Reviewer 3 for this question. In Figure 6D, we expressed CHIKV glycoproteins through transfecting CHIKV genomic RNA into 293T cells, while, in Figure 4B, we expressed CHIKV glycoproteins through transfecting poly-glycoprotein plasmid (pcDNA3.1-E3-myc-E2-6K-E1) into 293T cells, which are complementary approaches to express CHIKV glycoproteins to validate their interactions with identified host factors. We have now added schematics to illustrate the different experimental strategies above the figures in this partially revised manuscript (shown in revision plan).

      References:

      Voss, J. E. et al. Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography. Nature 468, 709–712 (2010). Jose, J., Tang, J., Taylor, A. B., Baker, T. S. & Kuhn, R. J. Fluorescent Protein-Tagged Sindbis Virus E2 Glycoprotein Allows Single Particle Analysis of Virus Budding from Live Cells. Viruses 7, 6182–6199 (2015). Götte, B., Liu, L. & McInerney, G. M. The Enigmatic Alphavirus Non-Structural Protein 3 (nsP3) Revealing Its Secrets at Last. Viruses 10, 105 (2018). Saenz, J. B. et al. Golgicide A reveals essential roles for GBF1 in Golgi assembly and function. Nat. Chem. Biol. 5, 157–165 (2009). Krämer, A. et al. Small molecules intercept Notch signaling and the early secretory pathway. Nat. Chem. Biol.9, 731–738 (2013). Zhang, R. et al. A CRISPR screen defines a signal peptide processing pathway required by flaviviruses. Nature 535, 164–168 (2016).

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Review: In this manuscript the authors generated macrophages derived from the THP-1 cell line or human peripheral blood mononuclear cells stimulated with MCSF and infected them with alphaviruses some containing GFP expression cassettes. In Figure 1, they demonstrate that CHIKV infected these cells more robustly than RRV, SINV or the related ONNV. The authors generated an extensive array of CHIKV/ONNV chimeras to identify the viral proteins that dictate release from infected macrophages and narrowed it down to the envelop proteins E1 and E2. Fine mapping identified a couple of single mutations that affected macrophage infection outcomes. The authors then shifted their approach to identifying env protein interactors using a myc-tag pulldown methods followed by mass spectrometry. The assay identified a number of proteins including those involved in vesicular transport and interferon pathways. siRNA knockdown experiments were performed to identify interactors and many of them were shown to improve virus output.

      Critique: Overall, the manuscript is well written but in its current state it is more like two different stories because the effects of envelop proteins and list of interactors are not brought together in on one story. A possible fix to this problem would be inclusion of ONNV and CHIKV containing env mutations that do and do not restore viral release from macrophages into the pulldown/association experiments shown in Figure 6. The other major issue is the lack of protein data for the viral mutants relative to WT ONNV and CHIKV and assessment of viral RNA in the supernatants to determine whether the block is release or an earlier event since viral RNA levels in the cell seems to be the same or at least normalized. Lastly, knockdown experiments indicate an effect of things like OAS3 or other innate immune modulators. There are no controls to demonstrate that these are specific to CHIKV infection or if knockdown would assist growth of ONNV as well.

      Other points to consider:

      1. The title does not fit the manuscript findings and should be modified.
      2. It is unclear why the authors show results for SINV and RRV in Figure 1. Either these should be removed or the viruses should be carried throughout the experiments described in the Figure. Better yet would be to add additional alphaviruses to this analysis to determine if there are additional viruses that act similarly to CHIKV.
      3. Is the data presented in Figure 1A significant?
      4. The justification for inclusion of Figure 4A is lacking. It is unclear what this panel is supposed to be demonstrating.
      5. There is little justification for the candiates assessed in
      6. Extended data Figure 3 is very difficult to read due to the small font size.
      7. Just to be clear, the blots shown in Figure 6D are different from those depicted in Extended data Figure 4b, because some of them look very similar.

      Significance

      The study provides a fresh look at Alphavirus replication in macrophages. There are a number of issues that should be worked out that would enhance impact and interpretation of this study.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary: The authors utilize: 1) chimeric arthritogenic alphaviruses; evolution selection analyses with virus sequences isolated from human patients; and 3) mass spectrometry and proteomics to interrogate determinants of chikungunya virus (CHIKV) permissiveness in primary human macrophages and the human macrophage cell line, THP-1. The authors find that the vaccine strain, CHIKV 181/clone 25 replicates the most efficiently in primary monocyte-derived macrophages compared to other arthritogenic alphaviruses. Using o'nyong o'nyong (ONNV) as a comparison, the authors generate several chimeric viruses with CHIKV structural proteins and ONNV non-structural proteins (and vice versa) and perform a series of E1 and E2 domain swap experiments. They determine that both CHIKV structural proteins, E2 and E1, are necessary to confer efficient virus production over ONNV in the absence of a difference in viral RNA production. The authors also identify a specific residue in E1 that appears to be important for efficient virus production in THP-1 macrophage cell lines. Finally, using mass spectrometry, the authors identify two host proteins, SPCS3 and eIF3k, that bind to CHIKV E1 structural protein and appear to act as antiviral host factors.

      Major comments: The authors elegantly demonstrate that CHIKV structural proteins confer an advantage over ONNV structural proteins in a step in the replication cycle downstream of virus RNA synthesis, possibly virion assembly. This point would be strengthened determining the particle-to-PFU ratio of the parental viruses and the chimeras. Presumably, the ratio would increase in the chimeras containing CHIKV structural proteins. Additionally, the authors should consider performing virion assembly blocking assays with a small molecule inhibitor to determine if this abrogates the virus production advantage of CHIKV structural proteins within the ONNV backbone. Finally, the authors should perform competition experiments with the chimeric viruses and ONNV in macrophages to determine if the chimeras can outcompete the parental ONNV strain. Based on their data, the chimeric viruses should outcompete. These experiments would likely take 3-4 weeks to complete.

      The authors use both primary macrophages and macrophage cell lines as their in vitro model system and make one of their major points (listed in the title) that the determinants they identified in the CHIKV structural proteins convert macrophages into dissemination vessels; however, they do not show: 1) an in vivo model that the CHIKV-ONNV chimeras disseminate more efficiently than the parental ONNV; and 2) that these chimeras generate virus more efficiently specifically in macrophages. It would be useful to show that ONNV and CHIKV have equivalent virion production in other cell lines and that the advantage conferred by CHIKV structural proteins in the ONNV backbone is specific to macrophages. The authors should also change their title to reflect that dissemination is not directly being addressed in their study; the implications of their in vitro experimentation in a mammalian host would be more appropriate for the discussion.

      OPTIONAL: The authors use CHIKV-ONNV chimeras but it would be interesting to test other chimeras to determine if CHIKV structural proteins confer the same advantage in the backbone of other arthritogenic alphaviruses. The study would also be strengthened by using a pathogenic strain of CHIKV instead of the vaccine strain, as this is significantly attenuated in vivo. In Figure 4, the authors identify residues in the CHIKV structural proteins that appear to be under positive selection in human subjects and generate point mutants in these residues with the corresponding ONNV residues. They find that one mutation, V1029I located in E1, completely abolishes virion production in THP-1 macrophage cell lines. However, in their previous chimeric experiments, they find that neither CHIKV E1 or E2 was sufficient to increase virus production in the ONNV backbone. The authors should address this discrepancy, otherwise they should consider moving the data in their point mutation experiments to a supplementary figure. While worthy of reporting, especially given the patient data, these experiments do not buttress the points made in the previous figures.

      The authors conclude their manuscript with an assessment of several host proteins, namely SPCS3 and eIF3k, that were identified by mass spectrometry and whose knockdown results in increased virion production. The authors speculate about the role of these proteins but do not provide any mechanistic detail on how they might be playing a role. It is unclear that the putative antiviral role of these proteins involves steps downstream of virus replication, especially given that the authors speculate translation might be affected by eIF3k which, if the case, RNA synthesis should also be expected to be affected.

      Overall, while the initial chimeric virus and domain swap approach is strong, the manuscript would benefit with a more thorough examination of virion assembly steps and a mechanistic link to virion production. Otherwise, the authors should revise the structure of their manuscript by de-emphasizing points about virion assembly and leave room for other mechanistic explanations of their chimeric data that more clearly link the host antiviral factor/E1 binding studies.

      Minor comments: In Figure 3e, the line under "with CHIKV E1" should be moved over to include the E2-II+E1 virus.

      Figure 5a, 5b, and 6a should be replaced with higher resolution images.

      Significance

      Strengths of the study include the initial chimeric virus and domain swap approach to determine factors that allow for the productive replication of chikungunya virus in macrophages compared to other arthritogenic alphaviruses. This approach yielded useful insights and could be adapted to other viruses. The study is limited, however, by the lack of mechanistic detail linking the antiviral host factors identified which bind to the E1 structural protein, and the advantage conferred by CHIKV structural proteins in the ONNV backbone. The study would be greatly improved by structural studies of the chimeric viruses that directly demonstrate more efficient virion production and that knockdown of the identified factors specifically affects virion production. This point could be addressed either through additional experimentation or tempering of the authors' conclusions about the mechanism by which CHIKV structural proteins provide an advantage over those of ONNV.

      The study advances knowledge in the field on what might advantage different pathogenic alphaviruses and explain differences in disease pathology. Additionally, the authors devise a simple and clever strategy that could be applied across different alphaviruses and would be useful to test in vivo in future studies. This study would be useful to a virology-specific audience.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary:

      In this work Yao et al. show CHIK is able to infect macrophages in contrast to other arthritogenic alphaviruses RRV, ONNV, and SINV. They use a series to chimeric viruses made with ONNV, the closest species to CHIK, and determine the E2-E1 proteins are important viral determinants which allow CHIK to replicate in machophages compared to ONNV. By comparing 397 CHIK sequences from infected patients, they identified 14 residues under pervasive and positive selection. Of these, 3 residues in E2 and 3 residues in E1 (amino acids) were different between CHIK and ONNV suggesting these residues contributed to the difference in macrophage tropism of CHIK compared to ONNV. The authors go on to determine what host factors the CHIK E2 protein is interacting with to presumably connect the viral and host determinants for CHIK infection in macrophages.

      Major concerns:

      1. The authors show one configuration of the E1-E2 heterodimer in Figure 4d. As shown, the E1 protein is exterior to the E2 protein and would suggest E1 is on the surface on the spike complex and virus surface. However, another configuration of the glycoproteins has E2 on the exterior of E1 and also on the exterior of the virus. The latter conformation is what has been observed in cryoEM studies of alphaviruses. The first configuation represents the E1-E2 between the three heterodimers which are important for spike assembly. The reason the orientation of the E2-E1 dimer is important is the authors speculate on the importance of the 6 CHIK residues not found in ONNV based on the structure, but the structural interpretation is, in my opinion, not correct.
      2. Validation of E1 interaction with SPSC3 and eIF3k needs to be stronger. Some concerns/questions are listed below. A myc tag was inserted between E3 and E2. How efficeintly does furin cleave E3 from E2 in this virus and how are viral titers of the myc-tagged virus compared to the non-tagged virus? I ask because is the IP looking at what is being pulled down by E2 or E3-myc-E2 that could be part of the spike polyprotein? The authors found E2 interacts with E3, E1 and a list of other host proteins. These results suggest several interactions including E2-host factor, E2-E1, E2-E3, E2-E1-host factor, E2-E3-E1, E2-E3-host factor. In figure 6d, and the subsequent conclusions, the authors suggest E1 is interacting with the host facor and do not see E2 alone and very low amounts of E3-E2-6K-E1. based on how the IP was performed I am not sure how an interaction between E1 and SPCS3 alone, without E2, would be detected. I would also like to see a reciprocal pull down using E1 and also E2 to see if these host factors are pulled down.
      3. If CHIK E1 is interacting with the host factors and that is antagonizing the antiviral response of SPSC3 (as one example), then what do pull downs using ONNV structural proteins look like? One would expect reduced interactions because the different amino acid causes a different E2-E1 dimer or attenuates the E1-host factor binding site.
      4. E1 and E2 are thought to interact during polyprotein translation and the initial dimer forms in the ER. If E1 is interacting wht SPSC3 in the ER, is E2 also present? Or is a population of E1 not interacting with E2 in order to inhibit SPSC3? I would love a model of how the authors see all these factors coming together for this new role of E1.

      Minor concerns:

      1. In Figure 1c, (-) RNA is shown but in the rest of the figures (+) RNA is shown. Show both or select one. I do find it interesting the (-) RNA levels are similar over time, even at 4 hours post transfection (early time). Related to this, ONNV has higher levels of (-) RNA but what is known about structural protein levels in ONNV and CHIK in macrophages? Are there comparable levels of CP and GP being produced?
      2. Figure 2e and figure 3 have ONNV has the first bar followed by CHIK. In figure 1 and 2b, CHIK is first and then ONNV. helps the reader to have the controls in the same order.
      3. Line 143-145 the authors discuss that when ONNV is the backbone and CHIK proteins are inserted the infection is more attenuated because of the E2 and E1 are from CHIK and ONNV, not the same virus (could also be E2-CP interactions are disrupted). However the chimeras made witht he CHIK backbone (in Figure 2) have a mismatch between E2 and E1 as well.
      4. When discussing the residues that were found in the FEL and MEME analysis, the authors start the amino acid numbering from CP and continue along the polyprotein. Usually when discussing amino acids in the structural proteins, each protein starts at amino acid 1. So V460 would be E2-V135. It would also be useful to know what the residues in ONNV were at these positions to see if amino acids changed in charge, size, bond forming potential, etc. Showing these residues in the E2-E1 conformation found in the virion would also allow one to find adjeacent residues that could explain differences in spike assembly and potentially where/how E1 is binding to a host protein.
      5. How effective is a non-attenuated CHIK strain in infecting macrophages? Could you make a SINV-La Reunion chimeric virus (which is BSL2) to see if a higher percentage of macrophages are infected and is this potentially contributing to the increased pathogenesis of La Reunion? Also how different is 181/25 with a pathogenic strain in the E2 and E1 resdiues? and compared to ONNV?
      6. When describing the last results section, "CHIK E1 binding proteins exhibit potent anit-CHIV activities" the authors use macrophages. In the rest of the text they consistently use THP-1 macrophages or human primary monocyte derived macrophages. The details of the cell type are extremely useful to the reader and having those in the last results section would be great.
      7. The paper is well-written. There is a slight disconnect as the authors go from discussing results in Figure 4 to Figure 5.

      Referees cross-commenting

      I agree with R#2 that having some Particle:PFU data would add some data to determine why such differences in titers/infectivity.

      I also see how this m/s could be split into two different m/s. One that focuses on the chimeric viruses and another that identifies the host factors important and goes in more depth with mechanism

      Significance

      Strengths:

      The authors have tackeled an intriguing question: why do some alphaviruses infect macrophages and others do not. They have used a chimeric approached to very systematically identify the viral determinants E2 and E1 as being important in macrophage infection. Using AP-MS they identify host factors that interact with E2 (possibly E2 and E1, see comments above) but if their findings that E1 has a role in attenuating a host antiviral factor, this would be fantastic.

      More and more examples of viral proteins having multiple roles during infection are in the literature. The idea that structural proteins also attenutate host antivirals is a developing field and vastly understudied. By fleshing out the results some more the authors might be onto something ery important in alphavirus virology.

      Limitations:

      The study has it is presented is limited in the validation of host factors and their interacting partners. I have many questions about the methodology, validation, and model from this last section.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We thank the reviewers for their careful reading of the document and feedback which will help us to improve our manuscript. We will go through their comments one by one.

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      This study would be much convincing if additional line of eukaryotic cells can be used to demonstrate the GEF-GAP synergy tis important for cell physiology. In addition, it would be best to demonstrate the spatiotemporal interaction of GEF-GAP using high-resolution live cell imaging.

      Response from the authors:

      The reviewer requests additional in vivo data to support our in vitro findings:

      (1) The reviewer requests in vivo data showing that GEF-GAP synergy is important for cell physiology. We believe that in order to show GEF-GAP synergy in vivo, Cdc42 cycling rates would need to be measured in vivo. For that single-molecule resolution is required – to track a single Cdc42 molecule and measure its GTPase cycling. We agree that such data would indeed be interesting, but are unaware of established techniques that would facilitate measurements of Cdc42 cycling rates in vivo.

      (2) The reviewer requests in vivo data showing the spatiotemporal interaction of GEF-GAP. Cdc24 and Rga2 are shown to interact (direct or mediated by another protein) (McCusker et al. 2007, Breitkreutz et al. 2010, Chollet et al. 2020). Cdc24 and Rga2 share 11 binding partners (https://thebiogrid.org/31724/table/saccharomyces-cerevisiae-s288c/cdc24.html, https://thebiogrid.org/32438/table/saccharomyces-cerevisiae-s288c/rga2.html) and have been found at the polarity spot (Gao et al. 2011). Live cell imaging of fluorescently tagged Cdc24 and Rga2 will show that they exhibit some interaction, but not specify the role of the interaction nor if the interaction is direct or mediated by one of the shared binding partners. In order to show a direct interaction between Cdc24 and Rga2, one could consider (A) super-resolution imaging or (B) FRET experiments: For both fluorescently tagged Cdc24 and Rga2 cell lines would need to be constructed.

      (A) Super-resolution imaging could show direct interaction between Cdc24 and Rga2, but even with the techniques available this would be on the limit. Further, it is usually done in fixed cells, and not in live cells (as requested from the reviewer).

      (B) To show a direct interaction of Cdc24 and Rga2 using FRET, suitable protein constructs would need to be engineered. We believe that the main obstacle in showing direct binding of Cdc24 and Rga2 using FRET is to design the fluorophore linker. The linker would need to be designed in such a way that it is flexible enough to give a FRET signal even if the two large proteins bind on the opposite sites of the fluorophore, but also is stiff/short enough to not show binding if both proteins are in close proximity through binding to a common binding partner.

      __We believe that an investigation of GEF GAP binding in vivo is beyond the scope of this study. Instead, we will further explore one possible mechanism underlying GEF GAP synergy - Cdc24 Rga2 binding - through conducting Size-Exclusion Chromatography Multi-Angle Light Scattering experiments with purified Cdc24 and Rga2 (alone and in combination). __

      Reviewer #1 (Significance (Required)):

      The revised study would provide first line evidence that GEF-GAP synergy to be general regulatory property in eukaryotic kingdom.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      The study entitled, "The GEF Cdc24 and GAP Rga2 synergistically regulate Cdc42 GTPase cycling" by Tschirpke et al., uses an in vitro GTPase assay to examine the GTPase cycle of Cdc42 in combination with its GEF and GAP effectors. The authors find that the Cdc24 GEF activity scales non-linearly with its concentration and the GAP Rga2 has substantially weaker effect on stimulating Cdc42 GTPase activity. Not surprisingly, the combined addition of Cdc24 and Rga2 lead to a substantial increase in Cdc42 GTPase activity.

      **Referees cross-commenting**

      In Zheng, Y., Cerione, R., and Bender, A. (1994) J. Biol. Chem. 269: 2369-2372 (Fig. 3C), the authors show that Cdc24 combined with the GAP Bem3 lead to a large synergy in boosting Cdc42 GTPase activity.

      Reviewer #2 (Significance (Required)):

      There is very little new information in this manuscript. Previous studies (Rapali et al. 2017) have shown that the scaffold protein Bem1 enhances the GEF activity of Cdc24. It is expected that the reconstitution of a GEF and GAP protein promote the GTPase cycle and indeed Zheng et al. (1994) showed that that Cdc24 combined with the GAP Bem3 lead to a large synergy in boosting Cdc42 GTPase activity. Hence the only potentially interesting finding in this work is that, in solution Cdc24 activity scales non-linearly with its concentration. However as this GEF and Cdc42 are associated with the membrane, the relevance of solution studies are less clear and furthermore the mechanistic basis for the non-linearity is not explored in detail. Given the limited new information from this work, the findings are, in their current form, too preliminary.

      Response from the authors:

      __We appreciate the reviewer recognizing our work on the non-linear concentration-dependence of Cdc24’s activity. We disagree that this is the only new finding in our study: __

      We explore the effect of Cdc24 and Rga2 on Cdc42’s entire GTPase cycle and show that Cdc24 and Rga2 synergistically upregulate Cdc42 cycling. So-far Cdc42 effectors were only characterized in isolation (with the exception of Cdc24-Bem1 (Rapali et al. 2017)) and through how they affect a specific GTPase cycle step. The regulation of single GTPase cycle steps through an effector yields mechanistic insight into this specific GTPase cycle step. However, it does not show how the effector affects overall GTPase cycling of Cdc42 – a process Cdc42 constantly undergoes in vivo. Our approach allows us to study synergistic effects between proteins affecting different GTPase cycle steps. Synergies are another regulatory layer of the polarity system, adding further complexity: Which polarity proteins exhibit synergy, to which extend? The assay employed here, which studies the entire GTPase cycle, enables studying the effect of any GTPase cycle regulator, alone and in combination with another regulator.

      The reviewer states that the GEF GAP synergy is to be expected, as it was already shown in Zheng et al. 1994. In Fig. 3C Zheng et al. shows the time course of the GTPase activity of Cdc42 in presence of Cdc24, Bem3, and Cdc24 plus Bem3. Fig. 3C is the only data in which the combined effect of a GEF (Cdc24) and a GAP (Bem3) is investigated. The data indicates synergy, but is neither discussed as such in the text of the publication, nor analyzed quantitatively. Further, only one concentration of each effector (GEF/GAP) is used and the study uses a Bem3 peptide containing codons 751-1128 (30%) of the full-length BEM3 gene. Zheng et al. 1994 gives an early indication of GEF GAP synergy, but does not claim, discuss, or further investigate the synergy as such. In contrast, we use full-length Rga2 (not Bem3) as GAP, conduct several concentration-dependent assays, and analyze them quantitatively. We thank the reviewer for pointing out the pioneering character of Zheng et al.‘s study and will mention it more prominently in our report. However, we disagree that Zheng et al. sufficiently studied the GEF GAP interaction. To our awareness no theoretical studies include a GEF GAP synergy term, which we would expect if GEF GAP synergy is well-established in the field.

      The reviewer criticizes the relevance of bulk in vitro studies (lacking membranes) of proteins that bind to membranes in vivo. We agree that the presence of a membrane can affect the protein’s property, and we can not exclude that membrane-binding could alter the magnitude of a GEF GAP synergy. However, we believe that membrane-binding does not impede the GEF GAP synergy altogether. If membrane binding would influence GTPase properties that strongly, other studies on Cdc42’s GTPase activity and GEF and GAP activity, that do not include a membrane, would be inconclusive as well (e.g. Zheng et al. 1993, Zheng et al. 1994, Zheng et al. 1995, Zhang et al. 1997, Zhang et al. 1998, Zhang et al. 1999, Zhang et al. 2000, Zhang et al. 2001, Smith et al. 2002, Rapali et al. 2017). Both studies mentioned by the reviewer (Zheng et al. 1994, Rapali et al. 2017) were also conducted without membranes present.

      We believe that an inclusion of membrane-binding into reconstituted Cdc42 systems will enhance our understanding of Cdc42 and recognize it as a next step, which could be enabled by the assay used in our study.

      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      This work reports a biochemical analysis of the effects of a recombinant yeast GEF (Cdc24) and GAP (Rga2) on Cdc42 GTPase cycling in vitro. The central conclusion is that the GEF and GAP act "synergistically", which occurs "due to proteins enhancing each other's effects". By this they appear to mean that the GEF enhances the GAP's activity and vice versa. I was not persuaded that this is correct, and was confused by many aspects of the approach and interpretation, as outlined below.

      1. GEF and GAP are expected to accelerate GTPase cycle synergistically even with no effect on each other's activity:

      The Cdc42 GTPase cycle is understood to occur via distinct steps (GDP release, GTP binding, and GTP hydrolysis): GDP release and GTP hydrolysis are intrinsically slow steps that are accelerated by GEFs (GDP release) and GAPs (GTP hydrolysis). This fundamental biochemistry was established in the 1990s using biochemical assays that measure each step independently. Here instead the authors use an assay that measures [GTP] decline in a mix with 5 uM starting GTP, 1 uM Cdc42, plus or minus some amount of GEF or GAP. They assume exponential decline of [GTP] with time, yielding a cycling "rate". If that is so, then one would expect that added GEF would accelerate only the first step, leaving a slow GTP hydrolysis step that limits the overall cycling rate, while added GAP would accelerate only the last step, leaving a slow GDP release step that limits the overall cycling rate. Adding both together would speed up both steps, and should therefore "synergistically" accelerate cycling. This would be expected based on previous work and does not imply that GEF or GAP are affecting each other's action (except trivially by providing substrate for the next reaction). If the authors wish to demonstrate that something more complex is indeed happening, they need to use assays that directly measure the sub-reaction of interest, as done by prior investigators.

      Response from the authors:

      The reviewer raises the point that we do not consider a simpler, rate-limiting model and that this rate-limiting model could explain our synergy between GAP and GEF in accelerating the GTPase cycle.

      We very much welcome this consideration of the reviewer! We will add a clarification to our manuscript to explain why a rate-limiting model/interpretation does not match our data.

      Intuitively, the rate-limiting model is appealing, as it permits interpretation of cycle rate increases in terms of individual biochemical steps. So, a consideration of this model is indeed relevant. However, as also noted by the reviewer in the next points, data from e.g., figure 3e are not compatible with a simple rate-limiting model with two steps (hydrolysis and nucleotide exchange). We will explain how the acceleration of the total rate by both GAP and GEF individually does not match the rate-limiting model, even if we assume maximal effects of adding GAPs and GEF to the cycle. For this purpose, we consider the rate-limiting model scenario where the sensitivity of the GTPase cycle to adding GAP/GEF is maximized, so the best case-scenario for the rate limiting step-model.

      In the rate-limiting step model, we assume that we have a GTPase cycle in which at least one of the three GTPase cycle steps is rate-limiting: (A) GTP binding, (B) GTP hydrolysis, and (C) GDP release.

      We assume that the addition of a GEF and GAP only accelerates GDP release and GTP hydrolysis respectively. Biochemically, all three steps in the GTPase cycle are expected to be relevant. However, here we will consider only the final two steps, as sensitivity to rate limitation by GAP/GEF is maximized when time spent in the GAP/GEF-independent step in the cycle (step A: GTP) is negligible (i.e. never rate-limiting). The two-step model thus consists of (1) a nucleotide exchange step (step C+A) which is dominated by GDP release (step C) and assumed to be accelerated exclusively by the GEF, and (2) a GTP hydrolysis step (step B) exclusively enhanced by the GAP.

      In the rate limiting step model GEF-GAP synergy can appear if one of the conditions applies:

      1. the addition of a GAP speeds up the GTP hydrolysis step so much that the hydrolysis step stops (or almost stops) being the rate-limiting step, or
      2. the addition of a GEF speeds up the GDP release step so much that the release step stops (or almost stops) being the rate-limiting step. In these conditions, the acceleration of the GTPase cycle, accomplished by adding only a GAP or adding only a GEF, is interdependent. Therefore, we consider the possible acceleration of the GTPase cycle by GAP and GEF individually, and compare these to our observations to determine whether the rate-limiting step model can explain our data.

      The GTPase cycle time Tc is thus composed of hydrolysis Th and nucleotide exchange time Te, and the rates r are connected through:

      1/rc=1/rh + 1/re

      If we compare the ratio of the rates with protein (GAP/GEF) added in the assay (index 1) with the basal rate without protein added (index 0), we obtain the cycle acceleration factor alpha:

      alpha=rc1/rc0=(1/rh0 + 1/re0)/(1/rh1 + 1/re1)=(re0 + rh0)/(re0*rh0/rh1 + rh0*re0/re1)

      Here, rc1 and rc0 are the total GTPase cycle rate with and without effector respectively, rh1 and rh0 are the GTP hydrolysis rate with and without effector respectively, and re1 and re0 are the nucleotide exchange rate with and without effectors respectively.

      There is indeed an interdependence created between how much the GAP and GEF can both accelerate the total cycle, if the GAP and GEF are assumed to only accelerate GTP hydrolysis and nucleotide exchange respectively. E.g., how much the total GTPase cycle rate rc is accelerated by an increase in GTP hydrolysis rate rh depends on and can be limited by the current nucleotide exchange rate re. However, this interdependence is too strict to match the data in Figure 3e, as we will explain in the next paragraphs:

      When we only add a GAP and the GAP accelerates only the GTP hydrolysis rate (re1=re0), then the maximal total GTPase cycle rate acceleration alphaGAP that the GAP can accomplish is when rh1>>rh0,re0:

      alphaGAP=rc1/rc0=(1/rh0 +1/re0)/(1/rh1+1/re0)=(re0+rh0)/(re0*rh0/rh1+rh0)

      ~(re0+rh0)/rh0=1+ re0/rh0

      We thus assume the GAP accelerates the cycle so much that the hydrolysis step is much faster than the exchange step, at which point the effect of adding more GAP would saturate. We note that we do not consider the GAP concentration regime where we see saturation, thus in reality the acceleration by the GAP is more restricted than predicted here.

      Analogously, if the GEF accelerates only the nucleotide exchange rate (rh1=rh0), then the maximum GTPase cycle rate ratio will be when re1>>re0,rh0 , yielding acceleration factor alphaGEF :

      alphaGEF= rc1/rc0=1+ rh0/re0

      Again, note we assume the GEF accelerates the cycle so much that the exchange step is much faster than the hydrolysis step, at which point the effect of adding more GEF would saturate. We note that we do not observe the GEF concentration regime where we see saturation, thus in reality the acceleration by the GEF is more restricted than predicted here.

      We see that the maximum gain in rates for GAP-only and GEF-only assays is limited by the same basal GTP hydrolysis and nucleotide exchange rates (rh0 and re0), leading to the following interdependence:

      alphaGAP=1+ 1/(alphaGEF -1)=alphaGEF/(AlphaGEF -1)

      In our GAP-only and GEF-only assays (Fig. 3e, Tab. 2), we see both a 2-fold and 100-fold increase in the total rate respectively. A 100-fold acceleration factor of the GEF would maximize the GAP acceleration factor to 1.01 (or alternatively, the 2-fold GAP acceleration would maximize the GEF acceleration to 2), which are both significantly lower than what we observe. So even though we made favorable assumptions for the rate-limiting model to maximize rate sensitivity to GAP/GEF, namely neglecting nucleotide binding and assuming GAP/GEF concentrations that saturate in their effects, we still cannot reproduce the acceleration factors in our GAP-only and GEF-only assays.

      Moreover, a rate-limiting step model would also imply saturation effects as stated in the next point of the reviewer. While we observe saturation in total rate acceleration for certain GAP concentrations, we use GEF and GAP concentrations in the combined protein assays for which no saturation effects were observed. Absence of saturation in both cycle steps simultaneously is also not reconcilable with the rate-limiting step model, as will be further discussed in the next point of the reviewer.

      In summary, this means that the rate-limiting model is not sufficient to explain our results: the GAP/GEF synergy we observe is not simply resulting from GEF and GAP independently lifting two different rate-limiting steps.

      Model-based interpretation of the GTPase assay is poorly supported:

      The assay employed measures overall GTP concentration with time. It is assumed (but not well documented-see below) that [GTP] declines exponentially, and that the rate constant for a particular condition can be fit by the sum of a series of terms that are linear or quadratic in the concentrations of Cdc42, GEF, and GAP. There is no theoretical derivation of this model from the elementary reactions, and the assumptions involved are not well articulated.

      As discussed in point 1 above, one would expect that a GEF or GAP alone could only accelerate the cycle to a certain point, where the other (slow) reaction becomes rate limiting. But that does not appear to be true for their phenomenological model, where slow steps (small terms in the sum) will always be overwhelmed by fast steps. This is not the traditional understanding of how GTPases operate.

      Response from the authors:

      The reviewer expresses the concern that because we do not derive our coarse-grained model from elementary reactions, we miss important effects that can occur when adding GAP and GEFs, particularly saturation.

      We understand the concern of the reviewer that if a rate-limiting step model is considered, saturation effects of GAP/GEF will limit the amount with which these effectors can speed up the total cycle. Our coarse-grained model indeed does not account for this saturation. However, as discussed in the previous point of the reviewer, we do not opt for the rate-limiting model interpretation, as the GAP and GEF effects are not compatible with the rate-limiting step model.

      Secondly, we agree that for high enough concentrations of GEF and GAPs, we would experience a saturation in the effect of adding the effectors. We are aware of this possibility, and we verify that we are not in saturation regimes with our added proteins by checking the plots of the individual protein titrations (see Figure 3a-d). If we enter the saturation regime, we expect a negative second derivative in the rate as function of protein concentration (the curve shallows off). We do not see this for any protein except for Rga2 at some point, as discussed in our main text of the manuscript. However, for this protein we only use the data in the linear regime for further analysis. In short, we understand the concern of the author but we empirically check that we are not in the saturation regime.

      Data that do not conform to expectation are not explained: Strangely, the data (as interpreted by the model assumptions) also appear inconsistent with the expectation of rate-limiting steps. GEF addition (alone) is said to accelerate cycling 100-fold, while GAP addition (alone) accelerates it 2-fold. But that would seem to imply that GDP release takes up >99% of the basal cycle (so accelerating that step alone reduces cycling time 100-fold), while GTP hydrolysis takes up >50% of the basal cycle (so accelerating that step alone reduces cycling time 2-fold). In the conventional understanding of GTPase cycles, these cannot both be be true (as the steps would then add to >100% of the basal cycle). There is no attempt to reconcile these findings with previous work.

      Response from the authors:

      The reviewer raises the point that our findings do not match the expectations of the rate-limiting model perspective.

      We fully agree with the reviewer that our data is not compatible with the rate-limiting step model. The 100-fold and 2-fold gain of the total cycle rates for GEF-only and GAP-only assays are one of our arguments against the rate-limiting model view, as described in the first point of the reviewer. Also, our lack of saturation as described in the previous point of the reviewer provides another argument against using expectations based on rate-limiting steps to interpret our findings.

      Lack of detailed timecourse data:

      The decline in [GTP] with time is stated to be exponential, allowing extraction of an overall cycling "rate". But this claim is supported only weakly (S3 Fig. 1 uses only 3 timepoints, is not plotted on semi-log axis, and does not report fit to exponential vs other models) and only for the Cdc42-alone scenario: no data at all are presented to support exponential decline in reactions with GEF or GAP. Most assays seem to measure only a single timepoint, so extraction of a "rate" is very heavily influenced by the unsupported assumption of exponential decline. And if the decline is not exponential, it becomes extremely difficult to interpret what a single timepoint means.

      Response from the authors:

      The reviewer requests additional timeseries data with GEF and GAP to support the assumption of an exponential decline of GTP in the assay and requests to plot it on a semi-log axis.

      We will add data for Cdc42 + Cdc24 and for Cdc42 + Rga2 with two to three time points, and plot it as requested on a semi-log axis.

      Other issues with interpretation of the data:

      (i) It is unclear why the authors chose to employ an assay that is much harder to interpret than the biochemical assays used by others. In biochemical studies, assays that report an output of multiple reactions are always harder to interpret than assays targeting a single reaction. As well-established assays are available for each individual step in GTPase cycles, any conclusions must be supported using such assays.

      Response from the authors:

      The reviewer wonders why an assay that investigates several GTPase steps at once was chosen over assays that investigate sub-steps of the GTPase cycle, given that these give more mechanistic insights.

      We agree that assays investigating GTPase cycle substeps can give more mechanistic insights into these specific steps. However, they do not allow to study how proteins affecting different steps act together. We were interested in investigating the overall GTPase cycle of Cdc42 and a possible interplay of GEFs and GAPs. Cdc42 GTPase cycling was found to be a requirement for polarity establishment (Wedlich-Soldner et al. 2004) and Cdc42 GTPase cycling is physiologically relevant. Ultimately, we hope that in vitro results provide stepping stones towards understanding the complex and less controlled in vivo environment. The in vivo environment often entails the output of many reactions combined, so there is every incentive to study aggregated effects of a full cycle which are not necessarily the sum of individual outputs.

      __We believe that both assay types – assays that investigate sub-steps and yield mechanistic details, and assays that investigate the entire cycle – are important and disagree that one assay type is superior to the other. Instead, we believe they complement each other. __

      (ii) The reported basal (and GEF/GAP-accelerated) rates are very slow, perhaps due to poor folding of recombinant proteins. This raises the possibility that much of the Cdc42 is inactive. If so, then accelerated GTP hydrolysis could come from increasing the active fraction of Cdc42, rather than catalyzing a specific step.

      Response from the authors:

      The reviewer wonders whether the reported rates are slow due to poor folding of recombinant Cdc42. We used S. cerevisae Cdc42, for which it has been shown that it has a significantly lower basal GTPase activity than Cdc42 of other organisms (see Zhang et al. 1999). Many other studies on Cdc42 were conducted with human Cdc42, which has a significantly higher basal GTPase activity (Zhang et al. 1999). We assessed the activity of several recombinantly expressed Cdc42 constructs previously (Tschirpke et al. 2023). We there observed that most constructs had a similar GTPase activity, only some purification batches and constructs had a significantly reduced GTPase activity (which might be linked to poor folding). The Cdc42 construct used here shows a similar activity as the active Cdc42 constructs in Tschirpke et al. 2023, and we therefore believe that it exhibits proper folding. If recombinant Cdc42 folds poorly, we would expect greater variations between Cdc42 constructs and purification batches (caused by different levels of folding/ a different fraction of active Cdc42) than what we observed previously (see Tschirpke et al. 2023).

      Tschirpke et al. 2023:

      Tschirpke et al. A guide to the in vitro reconstitution of Cdc42 activity and its regulation (2023) BioRxiv. (https://doi.org/10.1101/2023.04.24.538075) (in submission at Current Protocols)

      (iii) The GEF and GAP preparations include multiple partial degradation products and it is unclear whether the measured activities come from full-length proteins or more active fragments.

      Response from the authors:

      We agree with the reviewer that the Cdc24 and Rga2 preparations contain degradation products.

      It would be more ideal if the protein purifications were entirely pure, but this is experimentally very difficult to achieve for the used proteins (which are large and partially unstructured, making them prone to partial degradation). Further, it is not uncommon to use protein preparations where some degradation products were present (e.g. Zheng et al. 1993, Zheng et al. 1994). Other studies did not show their purified preparations.

      The vast majority of the Cdc24 preparation is the full-length protein. We therefore expect that the degradation fragments only contribute in a small extend to the overall protein behavior.

      The Rga2 preparation contains a higher amount of degradation product, but only larger size protein fragments (> 60kDa), suggesting that the fragments contain at least and more than 1/3 of the full-length protein (the protein fragments are thus the size or larger than of the GAP peptides used previously). The fragments could in principle have a higher or lower activity. We account for fragments of no/lower activity by comparing our cycling rates to those of BSA/Casein, which has no specific effect on Cdc42. The cycling rate Rga2 is almost an order of magnitude greater than that of BSA/Casein, suggesting that the effect of the full-length protein dominates. We could only imagine that a Rga2 fragment has a higher GAP activity if the fragment consists mainly of the GAP domain and if in Rga2 the activity of the GAP domain is downregulated. Nevertheless, we will do an additional experiment using a purified GAP domain peptide to assess that if a GAP domain by itself has a higher GAP activity than our Rga2 preparation. Using that data, we will discuss possible implication of the GAP fragments in our manuscript.

      (iv) Cdc42 cycling is also accelerated by BSA and casein, suggesting that there are poorly understood aspects of the assay and that GEF and GAP actions may (like BSA and casein) involve non-canonical effects on Cdc42. As GEF and GAP are expected to interact better with Cdc42 than BSA or casein, these effects could dominate the observed changes in GTP levels.

      Response from the authors:

      The reviewer raises the concern that the effects of the added effector proteins on the rates could be caused by non-canonical effects. We do not believe non-canonical effects play a relevant role in our assays. While BSA and casein accelerate the GTPase cycle in our assays, the GAP effect and GEF effect are orders of magnitude stronger.

      (v) Cdc42-alone cycling assays are said to be reproducible. However, assays with added GEF/GAP/BSA/Casein yield rates that vary almost an order of magnitude between replicates. This poor reproducibility further reduces confidence in the findings.

      Response from the authors:

      The reviewer is concerned about the variations in Cdc42 effector rates.

      __We disagree that the variations are concerning and believe to have accounted for them in our analysis: __The Cdc42 (Cdc42 alone) data is very reproducible (see Tschirpke et al. 2023). The GTPase assay is generally sensitive to small concentration changes and errors introduced through pipetting small volumes (as required for the assay). We believe that the small variation observed for Cdc42 alone is because Cdc42 has such a low basal rate and therefore the small concentration changes due to pipetting have a smaller effect. Once other effectors are added, especially highly GTPase stimulating ones as Cdc24, small concentration changes due to pipetting can lead to larger variations between assays (small variations in Cdc24 concentration lead to larger changes in remaining GTP due to Cdc24’s strong and non-linear effect on Cdc42). We conduct the assays multiple times to account for these variations. In our analysis we do not compare single rate numbers but the orders of magnitude of the rate, and report the variations present. Even given the present variations, the differences in effect sizes are still significant. We map and discuss assay variation in (Tschirpke et al. 2023), to which we refer to several times throughout the manuscript.

      Tschirpke et al. 2023:

      Tschirpke et al. A guide to the in vitro reconstitution of Cdc42 activity and its regulation (2023) BioRxiv. (https://doi.org/10.1101/2023.04.24.538075) (in submission at Current Protocols)

      (vi) It is unclear what timepoint was used for the different assays. 1.5 h at 30 degrees seems to be the standard here for the Cdc42-alone assays, but I assume that cannot be what was measured to assess GTP decline for GEF-containing assays as there would be very little GTP left at 1.5 h.

      Response from the authors:

      We used 60-100 min as incubation times for all assays. The assay data will be published on a data server, where all these numbers can be checked. We further added a clarification to the materials and methods section. In order to still have remaining GTP for the Cdc42 GEF mixtures after 60-100 min, we lowered the used protein concentrations.

      (vii) The graph reporting GEF activity is plotted only for [GEF]Response from the authors:

      The graphs show the full range of protein concentrations used.

      In order to calculate K1, K2, K3,Cdc24, K3,Rga2, K3,Cdc24,Rga2 from k1, k2, k3,Cdc24, k3,Rga2, k3,Cdc24,Rga2, …, a protein concentration has to be included in the term (as K1 = k1 [Cdc42], ….). In order to make K comparable, we chose to use 1uM for all protein concentrations. This was done to compare the cycling rate values of different proteins. 1uM was a choice, in the same fashion 0.2uM could have been chosen.

      __We will further discuss in the manuscript how the choices in protein concentration affect the effector strength on Cdc42. __

      (viii) S8 Data with casein seems very noisy and it is no longer at all clear that the quadratic fit for [Cdc24] is justified. Also, the symbol colors are very similar so it is hard to tell what data corresponds to what condition. The synergy between Cdc24 and Rga2 is also very noisy and the fits seem arbitrary.

      Response from the authors:

      The reviewer is concerned with (1) the noise in the S8 data, and (2) the Cdc42-Cdc24-Rga2 fits.

      (1) We acknowledge in the manuscript that the S8 data is noisy and should be viewed with caution. We do not put much emphasis on these data sets and their interpretation and show them only in the supplement.

      (2) We disagree that the Cdc42-Cdc24-Rga2 fits are arbitrary. The fits contain several data points per protein, and reproduce the rate values from Cdc42-Cdc24 and Cdc42-Rga2 assays well.

      The reviewer is concerned with the color scheme choice in the fits.

      __We will adapt the color scheme of the fits to make the colors more distinguishable. __

      (ix) It is disturbing that different Cdc42 constructs behave quite differently (S4). This suggests that protein behavior is influenced by the various added epitope tags and protease cleavage sites (they also leave the C-terminal CAAX box rather than removing the AAX as would happen in vivo). These features raise the concern that these findings may not be directly relevant to the situation with endogenous yeast Cdc42. Of course, it is also the case that relevant Cdc42 biochemistry occurs with prenylated Cdc42 on membranes.

      Response from the authors:

      The reviewer is concerned that the behavior of the Cdc42 constructs is influenced by their tags. In a previous manuscript (Tschirpke et al. 2023) we explored the effect of various N- and C-terminal tags on Cdc42, by comparing it to Cdc42 that is not tagged in that position. We found that most tags, including the tags present in the Cdc42 construct used here, do not affect Cdc42’s properties.

      Instead, we found a general, tag independent, heterogeneity in Cdc42 behavior (which can occur between purification batches and between constructs (but not between different assays)): in some batches GTPase activity depended quadratically on its concentration, others showed a linear relationship. Most batches exhibited a mixed behavior. The differences between the batches are generally small, and only visible in the activity to concentration plots and because of the assay’s high accuracy. We use a two-parameter fit (k1 [Cdc42] + k2 [Cdc42]2) to phenomenologically account for this heterogeneity, and to estimate the basal Cdc42 GTPase activity. We do not interpret this heterogeneity, as more research is needed. We believe that Cdc42 still has unexplored properties, of which this heterogeneous behavior can be one. We speculate in Tschirpke et al. 2023 that it is linked to Cdc42 dimerization mediated by its polybasic region, a relationship that is far from being fully understood yet. __We believe that it is of scientific interest to point out heterogeneous behaviors to encourage more research. __

      Tschirpke et al. 2023:

      Tschirpke et al. A guide to the in vitro reconstitution of Cdc42 activity and its regulation (2023) BioRxiv. (https://doi.org/10.1101/2023.04.24.538075) (in submission at Current Protocols)

      The reviewer is concerned that our findings are biologically not relevant, as our experiments (1) included Cdc42 that was not prenylated and (2) did not include membranes.

      (1) We here used recombinantly purified proteins, which do not contain posttranslational modifications, such as prenylations. So-far Cdc42’s prenyl group, which is responsible for binding it to membranes, has not been linked to its GTPase properties. We therefore believe that unprenylated Cdc42 is an equal choice to prenylated Cdc42 when studying Cdc42’s GTPase cycle. Further, the use of recombinantly purified proteins can be of advantage: when proteins are purified from their native host, the post-translationally modified protein is purified. However, many proteins contain a multitude of post-translational modifications (PTMs). Thus, the purified protein is a mixture of protein with different PTMs. For example, S. cerevisae Cdc42 undergoes ubiquitinylation (Swaney et al. 2013, Back, Gorman, Vogel, & Silva 2019), phosphorylation (Lanz et al. 2021), farnesylation and geranyl-geranylation (Caplin, Hettich, & Marshall 1994). We here used protein preparations that do not contain PTMs, and show how they behave. Natively purified proteins would be mixtures of various PTMs, and the observed protein behavior would be that of the mixture. If Cdc42’s PTMs affect it’s GTPase behavior, the observed behavior of natively purified Cdc42 would represent the average behavior of the mixture. It then would require additional work to disentangle which PTMs affect the GTPase cycling in which way. The use of recombinantly expressed Cdc42 does not require this work, and can set the baseline for how Cdc42 without PTMs behaves. If in the future a link between Cdc42’s GTPase behavior and PTMs are found, the work here could be used as a baseline for Cdc42’s behavior when it is without PTMs.

      (2) The concern about missing membranes was also raised by reviewer 2 (significance), and we like to refer to our response there.

      Reviewer #3 (Significance (Required)):

      The basic biochemistry of Cdc42 cycles was figured out about 30 years ago. However, those studies did not examine how combinations of Cdc42 regulators (as opposed to individual regulators) might interact to produce effects not expected from combining their individual actions. Recently, this combination approach did lead to interesting findings by Rapali et al. This approach is worthwhile and addresses a major question of interest to the broader field of GTPase biochemistry.

      One main limitation of this study is technical: the main assay is less informative (though perhaps easier) than traditional assays, and it is unclear whether the recombinant proteins employed retain their normal activities. Another limitation is the model-based interpretation of the assay that does not include the potential for rate-limiting steps.

      Response from the authors:

      We thank the reviewer for the detailed comments.

      One important point of confusion originated from our lack of discussion concerning a rate-limiting step model, which is an obvious starting point for modelling the GTPase cycle. We thank the reviewer for pointing this out, and we will include an explanation in our manuscript why we reject this model and instead opt for a coarse-grained model.

      Firstly, a rate-limiting model would generate saturation effects that we would observe when adding GEF and/or GAPs. In assays exploring GEF GAP synergy we use GEF and GAP concentrations for which no saturation effects were observed.

      Secondly, in our data we observed a two-fold increase of the total GTPase cycling rate when adding a GAP and a 100-fold rate increase when a GEF is added. These increases are not compatible with a model where either hydrolysis or nucleotide exchange limits the GTPase cycle. While a synergy could arise from the rate-limiting model perspective, the incompatibility of the rate-limiting model with the GAP-only and GEF-only assay data excludes this synergy explanation. Finally, through coarse-graining our model we avoid using single step parameters from literature which are incompatible in terms of proteins/buffers used. (For example; the mayor studies that kinetically characterized the individual GTPase steps of Cdc42 used human Cdc42 (Zhang et al. 1997, Zhang et al. 2000). Because human Cdc42 exhibits a higher basal GTPase activity (Zhang et al. 1999) we are skeptical how useful it is to transfer these parameters to S. cerevisae Cdc42.)

      At the same time, coarse-graining our model permits absorbing unidentified molecular details which is essential when we wish to incorporate BSA and casein rate contributions.

      The reviewer finds our assay, which investigates the GTPase cycle as a whole, less informative. Assays investigating single GTPase cycle sub-steps give more mechanistic insights into these steps. We opted for an assay that studies GTPase cycling as a whole instead, as we were interested in studying how proteins effecting different steps act together. We believe that both assay types are important as they complement each other.

      The reviewer is concerned about our use of recombinant proteins, and whether they retain their normal activities. We assessed Cdc42’s GTPase activity and the influence of added purification tags extensively (Tschirpke et al. 2023), and found that added tags do not affect Cdc42’s GTPase properties. We checked Cdc24’s GEF activity using the GTPase assay and found that it bound strongly to Bem1, as expected (Tschirpke et al. 2023). The Cdc24 concentrations needed to affect Cdc42’s GTPase activity were similar to those used previously (Rapali et al. 2017), suggesting that it is fully active. A similar comparison for Rga2 was not possible, as so-far only domains of Rga2 were used (Smith et al. 2002). We here used recombinantly purified proteins, which do not contain posttranslational modifications (PTMs). To our knowledge the PTMs of the herein used proteins are not linked to their GTPase/GEF/GAP properties. Thus, a lack of PTMs does not diminish our findings. Further, when proteins are purified from their native host, the post-translationally modified protein is purified. However, many proteins contain a multitude of post-translational modifications in vivo. Natively purified proteins would be mixtures of various PTMs, and the observed protein behavior would be that of the mixture. We here used protein preparations that do not contain PTMs, and show how they behave, setting the baseline for proteins without PTMs behaves. If in the future a link between GTPase behavior and PTMs are found, the work here could be used as a baseline for the proteins behavior when it is without PTMs.

      Reviewer #4 (Evidence, reproducibility and clarity (Required)):

      Summary

      The GTPase cdc42 is a key determinant of yeast polarization. Its activity is amplified at the site of polarization through a poorly defined positive feedback mechanism, and depends on numerous GAPs regulating GTP hydrolysis and the GEF cdc24 that regulates GDP release. These components have previously been evaluated for their quantitative effects on the individual steps in the GTPase cycle that they modulate, but potential interactions between the cdc24 GEF and any GAP could not be examined based on these assays. The authors validate and employ a bulk assay of the total GTPase cycle based on GTP consumption to study the activities of and potential interactions between cdc24 and the GAP Rga2. Fitting their data to a mathematical model, they come to three central conclusions: (1) the activating activity of cdc24 to activate cdc42 GTPase activity is nonlinear, showing a quadratic relationship, (2) Rga2 shows a much lower activating activity that is linear at low levels before saturating, and (3) there is a strongly synergistic interaction between the activating activities of cdc24 and Rga2. Some hypotheses for the mechanistic bases of these findings are hypothesized, but not further investigated. Their conclusions are well supported by the data which appears to be of sufficient rigor.

      Major comments

      The three main conclusions of the manuscript are well supported by the data and associated modeling.

      One unresolved issue is the discrepancy between the authors' conclusion that the non-linear activation by cdc24 is likely a result of oligomerization, whereas Mionnet et al 2008 reach the opposite conclusion. It seems that the authors wish to discount the Mionnet results because they used truncated constructs to test deficient oligomerization and an engineered construct to test induced oligomerization. If the authors are correct, then a relatively easy test would be to introduce the oligomerization deficient mutants defined by Mionnet into their fuill length construct and compare to wild type protein. While the authors' measured results don't depend on the offered mechanism and this experiment is therefore optional, their explanation is quite unsatisfying, especially since an experiment to resolve the difference is entirely feasible and not very strenuous.

      Response from the authors:

      __The reviewer suggests to conduct experiments with oligomerization deficient Cdc24 mutants to test our hypothesis that the non-linear concentration dependence of Cdc24’s activity is due to Cdc24 oligomerization. __

      We agree that this is an insightful experiment, and will conduct it. In order to observe the effect in our GTPase assays, we require a mutant that is oligomerizes substantially less than wild-type protein. Mionnet et al. constructed several Cdc24 mutants, but none were entirely oligomerization deficient. However, the DH5 (L339A/E340A) mutant showed a 10-fold reduction in oligomerization and the DH3 (F322A) mutant exhibited 2.5-fold reduction in oligomerization. We will therefore use the DH5 and DH3 mutant for two additional experiments.

      Minor comments

      The results in Fig S4 serve as assay validation, and this should be pointed out early in the Results section. I was initially concerned when the assay was described as based on consumption of GTP that a significantly diminished pool would alter the rate and thereby distort results, and being made aware of the S4 result would have alleviated that concern as I read further.

      Response from the authors:

      We believe that the reviewer refers to S3 (not S4). We appreciate this suggestion and now mention it earlier.

      On page 4 and Fig S4 the authors mention several cdc42 constructs, some of which show linear activity curves and others slightly non-linear curves. I was unable to find where these constructs or their differences are discussed. The authors should also tell us if the construct used for the remaining experiments was one of the two shown in S4, or a different one.

      Response from the authors:

      We added the requested information and explanations to the manuscript.

      It seems that in Fig 4 and Fig S8, some points are missing from the graphs. Were all concentrations for each condition not always assayed, or is some data omitted for some reason? For example, for the 0.125 microM Rga2 condition, only two points are shown vs 4 for some other conditions, and the two missing ones are expected to not be excluded by the >5% GTP remaining criterion.

      Response from the authors:

      The reviewer wonders whether Fig.4 and Fig. S8 miss data points. This is not the case, and __we added clarifying information to the manuscript. __

      In detail: Not all assays contain the same amount of data points/ concentrations for each protein. We first assessed Cdc42 alone using several Cdc42 concentration. We then examined the individual Cdc42 – effector mixtures, using a larger number of effector concentrations. We included a reduced number of effector concentrations in the assays containing two effectors and Cdc42. It would be ideal to include more concentrations, but this is not always feasible: The assay involves a multitude of pipetting steps and is sensitive to any pipetting errors. Further, assays can vary slights from each other, therefore all samples that ought to be compared need to be included in each assay.

      Each three-protein assay contains samples shown (Cdc42, Cdc42 + effector 1, Cdc42 + effector 2, Cdc42 + effector 1 + effector 2) and additional ‘buffer’ wells used for normalization. Each data point shown corresponds to the average of 3-4 replica samples per assay. We therefore did not include all concentrations in all conditions. As pointed out, Fig. 4a only shows two data points for the 0.125uM Rga2 axis (Rga2 + Cdc42 and Rga2 + Cdc24 + Cdc42). The rational was the following: We included three Cdc24 concentrations (for proper fitting for K3,Cdc24), three Rga2 concentrations (for proper fitting for K3,Rga2), and 5 mixtures of the used Cdc24 and Rga2 concentrations (for proper fitting for K3,Cdc24,Rga2).

      The Cdc42-Rga2-BSA and Cdc42-Rga2-Casein data is rather sparse and would benefit from additional data points. However, we only use those as control experiments and are cautious in their interpretation.

      In these graphs, a diamond symbol of slightly varying color is used for the different conditions. The different colors are hard to distinguish. Please use different shape symbols for the different conditions, and choose colors that are more distinct.

      Response from the authors:

      We will adapt the color scheme of the fits to make the colors more distinguishable.

      There are a few sentences that are of unclear meaning, for example on page 10, "It was suggested that each GAP plays a distinct role in Cdc42 regulation, of which the level of GAP activity could be a part of [Smith et al., 2002]." There are also typos and grammatical errors that should be fixed.

      Response from the authors:

      __We will further check the document for potentially unclear sentences and will try to clarify them, as well as further check for grammatical and spelling errors. __

      Reviewer #4 (Significance (Required)):

      Significance

      The most novel and important finding is the strong synergy observed between cdc24 and Rga2 in activating cdc42 GTPase activity. This is undoubtedly an important mechanism underlying positive feedback in polarization. The measured non-linear activity of cdc24 alone is also quite important given that availability of cdc24 is thought to be a critical in vivo stimulus for polarization. However, the unexplained discrepancy between this result and that of Mionnet leaves one to wonder which result is more reliable. Only Mionnet attempts to directly test whether oligomerization is important in cdc24 activity.

      The conclusions are of importance to a broad audience of cell biologists, though the lack of any mechanism for the synergy or the non-linearity of cdc24 activity somewhat diminishes significance.

      Note that my expertise and that of my co-reviewer is in the biology, and while we are able to follow the contributions of the modeling, we do not have the expertise to critically evaluate for potential errors or weaknesses in the modeling itself.

      The reviewer wonders whether our data or the data of Mionnet et al. on the link between Cdc24 oligomerization and its GEF activity is more reliable and suggests to conduct experiments with oligomerization deficient Cdc24 mutants.

      We thank the reviewer for this recommendation and we will do the suggested experiments to resolve the seemingly contradicting observations by us and Mionnet et al..

      The reviewer would find mechanistic insights into (2) the non-linear concentration dependence of Cdc24’s activity and (2) the Cdc24-Rga2 synergy useful.

      (1) We will conduct experiments with partially oligomerization deficient Cdc24 mutants, as suggested by the reviewer.

      (2) We speculate that Cdc24-Rga2 binding could lead to the synergy. ____We will add data on Cdc24 – Rga2 binding (in vitro: Size-Exclusion Chromatography Multi-Angle Light Scattering) to this study.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #4

      Evidence, reproducibility and clarity

      Summary

      The GTPase cdc42 is a key determinant of yeast polarization. Its activity is amplified at the site of polarization through a poorly defined positive feedback mechanism, and depends on numerous GAPs regulating GTP hydrolysis and the GEF cdc24 that regulates GDP release. These components have previously been evaluated for their quantitative effects on the individual steps in the GTPase cycle that they modulate, but potential interactions between the cdc24 GEF and any GAP could not be examined based on these assays. The authors validate and employ a bulk assay of the total GTPase cycle based on GTP consumption to study the activities of and potential interactions between cdc24 and the GAP Rga2. Fitting their data to a mathematical model, they come to three central conclusions: (1) the activating activity of cdc24 to activate cdc42 GTPase activity is nonlinear, showing a quadratic relationship, (2) Rga2 shows a much lower activating activity that is linear at low levels before saturating, and (3) there is a strongly synergistic interaction between the activating activities of cdc24 and Rga2. Some hypotheses for the mechanistic bases of these findings are hypothesized, but not further investigated. Their conclusions are well supported by the data which appears to be of sufficient rigor.

      Major comments

      The three main conclusions of the manuscript are well supported by the data and associated modeling.

      One unresolved issue is the discrepancy between the authors' conclusion that the non-linear activation by cdc24 is likely a result of oligomerization, whereas Mionnet et al 2008 reach the opposite conclusion. It seems that the authors wish to discount the Mionnet results because they used truncated constructs to test deficient oligomerization and an engineered construct to test induced oligomerization. If the authors are correct, then a relatively easy test would be to introduce the oligomerization deficient mutants defined by Mionnet into their fuill length construct and compare to wild type protein. While the authors' measured results don't depend on the offered mechanism and this experiment is therefore optional, their explanation is quite unsatisfying, especially since an experiment to resolve the difference is entirely feasible and not very strenuous.

      Minor comments

      The results in Fig S4 serve as assay validation, and this should be pointed out early in the Results section. I was initially concerned when the assay was described as based on consumption of GTP that a significantly diminished pool would alter the rate and thereby distort results, and being made aware of the S4 result would have alleviated that concern as I read further.

      On page 4 and Fig S4 the authors mention several cdc42 constructs, some of which show linear activity curves and others slightly non-linear curves. I was unable to find where these constructs or their differences are discussed. The authors should also tell us if the construct used for the remaining experiments was one of the two shown in S4, or a different one.

      It seems that in Fig 4 and Fig S8, some points are missing from the graphs. Were all concentrations for each condition not always assayed, or is some data omitted for some reason? For example, for the 0.125 microM Rga2 condition, only two points are shown vs 4 for some other conditions, and the two missing ones are expected to not be excluded by the >5% GTP remaining criterion.

      In these graphs, a diamond symbol of slightly varying color is used for the different conditions. The different colors are hard to distinguish. Please use different shape symbols for the different conditions, and choose colors that are more distinct.

      There are a few sentences that are of unclear meaning, for example on page 10, "It was suggested that each GAP plays a distinct role in Cdc42 regulation, of which the level of GAP activity could be a part of [Smith et al., 2002]." There are also typos and grammatical errors that should be fixed.

      Significance

      The most novel and important finding is the strong synergy observed between cdc24 and Rga2 in activating cdc42 GTPase activity. This is undoubtedly an important mechanism underlying positive feedback in polarization. The measured non-linear activity of cdc24 alone is also quite important given that availability of cdc24 is thought to be a critical in vivo stimulus for polarization. However, the unexplained discrepancy between this result and that of Mionnet leaves one to wonder which result is more reliable. Only Mionnet attempts to directly test whether oligomerization is important in cdc24 activity.

      The conclusions are of importance to a broad audience of cell biologists, though the lack of any mechanism for the synergy or the non-linearity of cdc24 activity somewhat diminishes significance.

      Note that my expertise and that of my co-reviewer is in the biology, and while we are able to follow the contributions of the modeling, we do not have the expertise to critically evaluate for potential errors or weaknesses in the modeling itself.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      This work reports a biochemical analysis of the effects of a recombinant yeast GEF (Cdc24) and GAP (Rga2) on Cdc42 GTPase cycling in vitro. The central conclusion is that the GEF and GAP act "synergistically", which occurs "due to proteins enhancing each other's effects". By this they appear to mean that the GEF enhances the GAP's activity and vice versa. I was not persuaded that this is correct, and was confused by many aspects of the approach and interpretation, as outlined below.

      1. GEF and GAP are expected to accelerate GTPase cycle synergistically even with no effect on each other's activity:

      The Cdc42 GTPase cycle is understood to occur via distinct steps (GDP release, GTP binding, and GTP hydrolysis): GDP release and GTP hydrolysis are intrinsically slow steps that are accelerated by GEFs (GDP release) and GAPs (GTP hydrolysis). This fundamental biochemistry was established in the 1990s using biochemical assays that measure each step independently. Here instead the authors use an assay that measures [GTP] decline in a mix with 5 uM starting GTP, 1 uM Cdc42, plus or minus some amount of GEF or GAP. They assume exponential decline of [GTP] with time, yielding a cycling "rate". If that is so, then one would expect that added GEF would accelerate only the first step, leaving a slow GTP hydrolysis step that limits the overall cycling rate, while added GAP would accelerate only the last step, leaving a slow GDP release step that limits the overall cycling rate. Adding both together would speed up both steps, and should therefore "synergistically" accelerate cycling. This would be expected based on previous work and does not imply that GEF or GAP are affecting each other's action (except trivially by providing substrate for the next reaction). If the authors wish to demonstrate that something more complex is indeed happening, they need to use assays that directly measure the sub-reaction of interest, as done by prior investigators. 2. Model-based interpretation of the GTPase assay is poorly supported:

      The assay employed measures overall GTP concentration with time. It is assumed (but not well documented-see below) that [GTP] declines exponentially, and that the rate constant for a particular condition can be fit by the sum of a series of terms that are linear or quadratic in the concentrations of Cdc42, GEF, and GAP. There is no theoretical derivation of this model from the elementary reactions, and the assumptions involved are not well articulated.

      As discussed in point 1 above, one would expect that a GEF or GAP alone could only accelerate the cycle to a certain point, where the other (slow) reaction becomes rate limiting. But that does not appear to be true for their phenomenological model, where slow steps (small terms in the sum) will always be overwhelmed by fast steps. This is not the traditional understanding of how GTPases operate. 3. Data that do not conform to expectation are not explained: Strangely, the data (as interpreted by the model assumptions) also appear inconsistent with the expectation of rate-limiting steps. GEF addition (alone) is said to accelerate cycling 100-fold, while GAP addition (alone) accelerates it 2-fold. But that would seem to imply that GDP release takes up >99% of the basal cycle (so accelerating that step alone reduces cycling time 100-fold), while GTP hydrolysis takes up >50% of the basal cycle (so accelerating that step alone reduces cycling time 2-fold). In the conventional understanding of GTPase cycles, these cannot both be be true (as the steps would then add to >100% of the basal cycle). There is no attempt to reconcile these findings with previous work. 4. Lack of detailed timecourse data:

      The decline in [GTP] with time is stated to be exponential, allowing extraction of an overall cycling "rate". But this claim is supported only weakly (S3 Fig. 1 uses only 3 timepoints, is not plotted on semi-log axis, and does not report fit to exponential vs other models) and only for the Cdc42-alone scenario: no data at all are presented to support exponential decline in reactions with GEF or GAP. Most assays seem to measure only a single timepoint, so extraction of a "rate" is very heavily influenced by the unsupported assumption of exponential decline. And if the decline is not exponential, it becomes extremely difficult to interpret what a single timepoint means. 5. Other issues with interpretation of the data:

      (i) It is unclear why the authors chose to employ an assay that is much harder to interpret than the biochemical assays used by others. In biochemical studies, assays that report an output of multiple reactions are always harder to interpret than assays targeting a single reaction. As well-established assays are available for each individual step in GTPase cycles, any conclusions must be supported using such assays.

      (ii) The reported basal (and GEF/GAP-accelerated) rates are very slow, perhaps due to poor folding of recombinant proteins. This raises the possibility that much of the Cdc42 is inactive. If so, then accelerated GTP hydrolysis could come from increasing the active fraction of Cdc42, rather than catalyzing a specific step.

      (iii) The GEF and GAP preparations include multiple partial degradation products and it is unclear whether the measured activities come from full-length proteins or more active fragments.

      (iv) Cdc42 cycling is also accelerated by BSA and casein, suggesting that there are poorly understood aspects of the assay and that GEF and GAP actions may (like BSA and casein) involve non-canonical effects on Cdc42. As GEF and GAP are expected to interact better with Cdc42 than BSA or casein, these effects could dominate the observed changes in GTP levels.

      (v) Cdc42-alone cycling assays are said to be reproducible. However, assays with added GEF/GAP/BSA/Casein yield rates that vary almost an order of magnitude between replicates. This poor reproducibility further reduces confidence in the findings.

      (vi) It is unclear what timepoint was used for the different assays. 1.5 h at 30 degrees seems to be the standard here for the Cdc42-alone assays, but I assume that cannot be what was measured to assess GTP decline for GEF-containing assays as there would be very little GTP left at 1.5 h.

      (vii) The graph reporting GEF activity is plotted only for [GEF]<0.2 uM, but the rates used in the subsequent experiments are reported for mixtures with 1 uM GEF. The full range of GEF data should be plotted.

      (viii) S8 Data with casein seems very noisy and it is no longer at all clear that the quadratic fit for [Cdc24] is justified. Also, the symbol colors are very similar so it is hard to tell what data corresponds to what condition. The synergy between Cdc24 and Rga2 is also very noisy and the fits seem arbitrary.

      (ix) It is disturbing that different Cdc42 constructs behave quite differently (S4). This suggests that protein behavior is influenced by the various added epitope tags and protease cleavage sites (they also leave the C-terminal CAAX box rather than removing the AAX as would happen in vivo). These features raise the concern that these findings may not be directly relevant to the situation with endogenous yeast Cdc42. Of course, it is also the case that relevant Cdc42 biochemistry occurs with prenylated Cdc42 on membranes.

      Significance

      The basic biochemistry of Cdc42 cycles was figured out about 30 years ago. However, those studies did not examine how combinations of Cdc42 regulators (as opposed to individual regulators) might interact to produce effects not expected from combining their individual actions. Recently, this combination approach did lead to interesting findings by Rapali et al. This approach is worthwhile and addresses a major question of interest to the broader field of GTPase biochemistry.

      One main limitation of this study is technical: the main assay is less informative (though perhaps easier) than traditional assays, and it is unclear whether the recombinant proteins employed retain their normal activities. Another limitation is the model-based interpretation of the assay that does not include the potential for rate-limiting steps.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      The study entitled, "The GEF Cdc24 and GAP Rga2 synergistically regulate Cdc42 GTPase cycling" by Tschirpke et al., uses an in vitro GTPase assay to examine the GTPase cycle of Cdc42 in combination with its GEF and GAP effectors. The authors find that the Cdc24 GEF activity scales non-linearly with its concentration and the GAP Rga2 has substantially weaker effect on stimulating Cdc42 GTPase activity. Not surprisingly, the combined addition of Cdc24 and Rga2 lead to a substantial increase in Cdc42 GTPase activity.

      Referees cross-commenting

      In Zheng, Y., Cerione, R., and Bender, A. (1994) J. Biol. Chem. 269: 2369-2372 (Fig. 3C), the authors show that Cdc24 combined with the GAP Bem3 lead to a large synergy in boosting Cdc42 GTPase activity.

      Significance

      There is very little new information in this manuscript. Previous studies (Rapali et al. 2017) have shown that the scaffold protein Bem1 enhances the GEF activity of Cdc24. It is expected that the reconstitution of a GEF and GAP protein promote the GTPase cycle and indeed Zheng et al. (1994) showed that that Cdc24 combined with the GAP Bem3 lead to a large synergy in boosting Cdc42 GTPase activity. Hence the only potentially interesting finding in this work is that, in solution Cdc24 activity scales non-linearly with its concentration. However as this GEF and Cdc42 are associated with the membrane, the relevance of solution studies are less clear and furthermore the mechanistic basis for the non-linearity is not explored in detail. Given the limited new information from this work, the findings are, in their current form, too preliminary.

    5. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      This study would be much convincing if additional line of eukaryotic cells can be used to demonstrate the GEF-GAP synergy tis important for cell physiology. In addition, it would be best to demonstrate the spatiotemporal interaction of GEF-GAP using high-resolution live cell imaging.

      Significance

      The revised study would provide first line evidence that GEF-GAP synergy to be general regulatory property in eukaryotic kingdom.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We would like to thank Review Commons for their innovative approach to scientific peer-review and publishing. We thank all the Reviewers for their positive, highly complementary assessment of the manuscript and for highlighting the high quality and reproducibility of the work and the novelty and significance of the results: “The experiments are well-designed and perfectly executed and presented”; “I felt that this is a strong manuscript for peer-review as it serves diversified interests in modern cell biology.”; “The manuscript would be of interest to basic researchers working on epithelial development. Also potentially to basic researchers working on cancer, due to the mitotic errors described.”. We are grateful for the Reviewers’ comments and suggestions that have contributed to improving the revised manuscript. We have addressed all the Reviewers’ concerns, as detailed below in the point-by-point response to the Reviewers. Textual changes in the revised manuscript are marked in Blue.

      __Reviewer #1 (Evidence, reproducibility and clarity (Required)): __

      *The manuscript "Crosstalk between the plasma membrane and cell-cell adhesion maintains epithelial identity for correct polarised cell divisions" by Dr. Hosawi and colleagues reports the characterisation of the mitotic connection between plasma membrane dynamics and division orientation in polarised mammalian epithelial cells in culture. The authors start from the comparison of mitotic events of human mammary MCF10A cells grown at optimal density or at low density. They observed that only at optimal density MCF10A cells polarise by E-cadherin mediated cell-cell contacts, and display uniform membrane enrichment at the cortex, whereas cells grown at low density do not show cortical E-Cadherin enrichment, and distribute aberrantly the plasma membrane at one side and in cytoplasmic vesicles, generating daughter cells with unequal size. Consistently, further analyses revealed that low-density MCF10A cells undergo misoriented mitosis, with chromosome congression and misegregetion defects. Mechanistically, low density MCF10A cells fail to organise a symmetric mitotic spindle and center it in metaphase. This is due to an increased cortical actomyosin thickness coupled to abnormal astral microtubule stability. Building on previous data from the Elias lab, the authors uncover a role of the membrane-associated S100A11 protein in maintaining correct plasma membrane dynamics and E-cadherin localisation in mitosis. Further dissection of the molecular mechanism underlying this mitotic function od S10011A revealed that it enriches at the cortex only in optimal-density MCF10A cells, and promotes spindle orientation by association with LGN and E-cadherin, upstream of E-cadherin. This evidence depicts the plasma membrane and S100A11 proteins as a key mechanical sensors of cell-cell adhesion orchestrating the recruitment of E-cadherin and LGN-dependent force generators to ensure correct division orientation. *

      *Major points: *

      *- Important information is presented in Supplementary Figure S3. I suggest to move these panels in the main figures. Specifically, I would replace figure 4A with S3A showing the distribution of endogenous S100A11 in MCF10A cells, rather than the one of the GFP-tagged version which is over-expressed. *

      __Authors response: __We thank the Reviewer for this suggestion. We have now moved Figure S3A to Figure 4, to replace Figure 4A and show the localisation of endogenous S100A11 during mitosis and included new quantifications in new Figure 4B. We have moved Figure 3A to supplementary figures (new Figure S4A). We have amended the text of the results section and the Source Data file accordingly.

      *- The mechanisms of division orientation governed by S100A11 seems to impinge on the control of cortical F-actin and astral microtubule dynamics. This is illustrated in figure S3C, which in my opinion should be shown in the main figures with some more explanation / experiments. The authors mention the " tight actin F-actin bundles at the cell-cell contacts" that are lost in S100A11-depleted cells, and that interact with astral microtubules. However this is not fully clear in figure S3C. I think the authors should find a way to present better these evidence which is key in supporting their molecular model. *

      __Authors response: __As requested by the Reviewer we have now moved Figure S3C to the main manuscript, as new Figure 5. To clarify further the effect of S100A11 depletion on the tight actin bundle formation at the cell-cell contacts, we have now included a new illustration in new Figure 5C. Additionally, we have clarified further these findings in the results section (page 11). While we agree with the Reviewer that additional experiments, for example using live imaging of MCF-10A cells co-labelled for F-actin and tubulin, would help assess further the crosstalk between cortical actin and astral microtubules, based on our experience these live imaging experiments are challenging and can take up to several months to optimise and may not warrant successful outcome.

      *- I think the discussion would benefit from the addition of a graphical cartoon model illustrating the role of S100A11 in controlling plasma membrane dynamics in mitosis and spindle orientation. *

      __Authors response: __We thank the Reviewer for this suggestion. We have now added a graphical cartoon (new Figure 7), summarising the role of S100A11-mediated regulation of plasma membrane dynamics in polarised cell division orientation, progression and outcome. We hope this new illustration clarifies further the mechanisms described in this study.

      *- Finally, to understand the relevance of S100A11 in the context of 3D polarised mammary epithelia, it would be very interesting to analyse the effect of S100A11 knock-downn in mouse mammary epithelial acini grown in matrigel. This is not essential for the proposed studies, but would add biological relevance to the mechanisms characterised in 2D colture. *

      __Authors response: __We agree with the Reviewer that validating our findings in 3D cultures of mammary epithelial cells will be important to determine the influence of S100A11-mediated regulation of plasma membrane dynamics during mitosis on lumen formation and tissue morphogenesis. This is exactly the direction where the follow-up of these findings will go. While the first author who led this work has graduated and left our lab, we have recently recruited a new PhD student to address this important question, which will need a few years of investigation to provide important insights, similarly to what we did in our previous work (Fankhaenel et al., 2023 Nat Commun).

      *Minor comments: *

      *- It would be preferable to mention the known functions of S100A11 in the introduction rather than at the beginning of the paragraph at pg. 9. *

      __Authors response: __In response to the Reviewer’s suggestion, we have now moved the paragraph describing known functions of S100A11 to the introduction of the revised manuscript (see page 5).

      *- at pg 10, beginning of paragraph, I find it a weird phrasing that "LGN interacts with F-actin". As reported in the reference cited here, this is through Afadin, which binds simultaneously LGN and cortical F-actin. I would rephrase it. *

      __Authors response: __We thank the Reviewer for clarifying this point, which we have now rectified in the revised manuscript (see page 11).

      __Reviewer #1 (Significance (Required)): __

      *The description of cell adhesion as key factor instructing correct mitotic progression and execution of oriented division of vertebrate epithelial cells by controlling plasma membrane dynamics is novel and interesting for scientist in the spindle orientation/polarity field. The experiments are well-designed and perfectly executed and presented. I am in favour of publication of the manuscript, providing that a few points are addressed. *

      Authors response: We thank the Reviewer for their very positive evaluation of our work.

      __Reviewer #2 (Evidence, reproducibility and clarity (Required)): __

      *Establishment and maintenance of cell polarity are fundamental processes for physiology in multi-cellular organism given the fact that more than 380 million epithelial cell renewal for every second in human adults. However, the precise mechanisms linking plasma membrane polarity and cortical cytoskeleton dynamics of epithelial cells during mitotic exit and interphase remain ill-illustrated. Salah Elias and her colleagues experimentally manipulated the density of mammary epithelial cells in culture, which led to several mitotic defects. Specifically, they found that perturbation of cell-cell adhesion integrity impairs the dynamics of the plasma membrane during mitosis, affecting the shape and size of mitotic cells and resulting in defects in mitosis progression and generating daughter cells with aberrant cytoarchitecture. In these conditions, F-actin-astral microtubule crosstalk is impaired leading to mitotic spindle misassembly and misorientation, which in turn contributes to chromosome mis-segregation. Mechanistically, they identified the S100 Ca2+-binding protein A11 as a key membrane-associated regulator that forms a complex with E-cadherin and LGN to coordinate plasma membrane remodelling with E-cadherin-mediated cell adhesion and LGN-dependent mitotic spindle machinery. I felt that this is a strong manuscript for peer-review as it serves diversified interests in modern cell biology. *

      Authors response: We thank the Reviewer for their overall very positive feedback on our manuscript.

      __Reviewer #2 (Significance (Required)): __

      Several key cellular experiments should be repeated using a second line of epithelial cells such as RPE1.

      __Authors response: __We agree with the Reviewer it will be interesting to test our findings in other epithelial cells, including RPE1 cells, a widely used epithelial cell model to study the mechanisms controlling cell division. Nonetheless, we would like to emphasise that while our work demonstrates the importance of the interplay between plasma membrane dynamics and cell-cell adhesion for correct execution of polarised cell divisions in mammary epithelial cells, our aim is not to generalise the role of these S100A11-mediated mechanisms. An elegant study has shown that the mechanisms controlling plasma membrane remodelling and elongation during mitosis to ensure correct positioning of the mitotic spindle and symmetric division differ between HeLa cells and RPE1 cells (Kiyomitsu and Cheeseman, 2013 Cell). Additional experiments in a second cell line will require a thorough characterisation of the expression and localisation of S100A11 during the cell cycle, as well as the use of extensive and time-consuming knockdown and imaging experiments over several months and may lead to different observations requiring further mechanistic investigation, which is beyond the initial scope of this study. Additionally, the PhD student who led this study has graduated and left the lab and presently we don’t have capacity or resources to conduct these suggested experiments. Finally, to precisely address the Reviewer’s concern, we have now amended the revised manuscript to make our statements more specific to mammary epithelial cells throughout the text.

      __Reviewer #3 (Evidence, reproducibility and clarity (Required)): __

      *Summary: your understanding of the study and its conclusions. *

      *The scope of the study is to understand the links between cell-cell adhesion integrity, plasma membrane dynamics and mitotic spindle in mammalian epithelial tissues. To test this, the authors cultured mammary epithelial cells at optimal or low density as a way of perturbing cell-cell adhesion. The authors conclude that perturbing cell-cell adhesion alters plasma membrane dynamics, causing mitotic defects and that S100A11 coordinates this link via E-cadherin. Whilst this is an interesting manuscript, illustrating the differences of mitotic success in optimal density vs. low density cell cultures, I do not think that the conclusions are supported by the evidence presented for the reasons stated below. *

      *Major comments: major issues affecting the conclusions. *

      *- The manuscript clearly shows that culturing cells at a lower density results in a higher incidence of asymmetric division (figure 1) and mitosis defects (figure 2). Cells round more and faster and there is more actin at the cortex during rounding (figure 3). However, whilst differences in cell-cell adhesion are likely to play a role in mediating these effects, I don't think that it is possible to claim from the data presented that these defects are specifically due to cell-cell adhesion differences. This is because the morphology of cells at low density is also very different - cells appear more mesenchymal, with migratory front-rear polarity instead of apical-basal polarity. These cells will therefore have many differences between them, cell-adhesion being just one. The data is also not showing a 'loss' of cell-cell adhesion integrity but are rather illustrating the differences between cells that have formed cell-cell adhesions and those that have not. To really test the specific role of cell-cell adhesions, the authors would need to inhibit adhesions directly but without altering the cell density - for example via chemical or genetic perturbation within a confined environment. I suggest that the authors either need to do these experiments or to requalify what their data is telling us. *

      __Authors response: __We thank the Reviewer for their insightful discussion of the proposed mechanisms described in our manuscript. Several of the Reviewer’s comments pinpoint and exactly match the messages that we would like to convey to the scientific community. Therefore, to address the Reviewer’s comments, we have carefully requalified our statements in several places in the revised manuscript, to ensure they are more clear and more precise.

      We agree with the Reviewer’s comment that our experiments using sub-optimal density of mammary epithelial cells rather prevents the formation of cell-cell adhesions than disturbing them. The Reviewer is right, our experiments in low-density cultures suggest that perturbation of cell-cell adhesion formation impairs mammary epithelial identity, where cells lose their polarity and adopt a more mesenchymal phenotype, associated with plasma membrane remodelling defects. This affects the dynamics and progression of cell division. Nonetheless, our observations suggest an interplay between cell-cell adhesion and the plasma membrane to maintains correct cell shape during mitosis. To test this hypothesis, we explored the function of S100A11 which we have identified in the LGN interactome in mitotic mammary epithelial cells (Fankhaenel et al., 2023 Nat Commun), and which has been shown to interact with E-cadherin at adherens junctions in MDCK cells (Guo et al., 2014 Sci Signal). This, together with the fact that S100A11 controls plasma membrane repair (Jaiswal et al., 2014 Nat Commun), suggested S100A11 as an interesting candidate to investigate the interplay between cell-cell adhesion and membrane remodelling during mitosis. The data presented here suggest that we were right and the perturbation of our membrane-bound target, S100A11, indeed leads to the same mitotic phenotypes. S100A11 RNAi-mediated knockdown (48h) affects E-cadherin localisation at the plasma membrane and impairs cell-cell adhesion formation with effects on plasma membrane dynamics that phenocopy the defects observed in our low-density culture experiments. Remarkably, perturbation of cell-cell adhesions persisted in cell treated with si-S100A11 for 72h (see Figure S3). Of note, all our siRNA experiments have been carried out in cells cultured at optimal density to establish cell-cell adhesions. Thus, S100A11 knockdown allows genetic perturbation of E-cadherin-mediated cell-cell adhesion and recapitulates the plasma membrane and mitotic defects observed in sub-optimal cultures of mammary epithelial cells. Future experiments will be key to dissect these S100A11-mediated mechanisms to further understand how plasma membrane remodelling and cell-cell adhesions are coordinated during mitosis. Finally, as suggested by the Reviewer, we have now requalified our conclusions as appropriate in the revised manuscript.

      *- The current manuscript also demonstrates that cell adhesion is affected when S100A11 is knocked down (figure 4). It shows binding between and colocalization of S100A11 and E-cadherin, and shows that LGN cortical distribution is affected when S100A11 is knocked down (Figure 5). The results presented are suggestive of S100A11 being upstream of E-cadherin. However, I don't understand how the data shows "crosstalk between the plasma membrane, cell-cell adhesion, and the cell cortex during mitosis". For example, on P9: "We observed unequal distribution of CellMaskTM in a vast majority of S100A11-depleted cells (si-S100A11#1: ~79% versus si-Control: ~26%), indicating defects in plasma membrane remodelling (Figures 4B and 4C)." I don't agree that this demonstrates a defect in PM remodelling. Rather the cells in the representative images are less adherent and have adopted a more migratory cell state similar to that seen in figure 1 when seeded at low density. The fluidity of the much larger cells shown in knock down cells in panel F also appears higher, again suggesting an adhesion defect. *

      • *

      __Authors response: __The Reviewer has raised very important points here, which we would like to clarify.

      We agree with the Reviewer that our results in S100A11-depleted cells indicate impaired cell adhesions which generates cells displaying an invasive/migratory behaviour. However, our analysis of S100A11-depleted mitotic cells labelled with CellMaskTM reveals abnormal plasma membrane elongation generating two daughter cells displaying defective geometry as compared to control cells. These defects in the plasma membrane and cell shape were not noticeable upon E-cadherin knockdown (see previous Figures 5K and 5L; now new Figures 6K and 6L). Thus, our results strongly suggest that S100A11 acts as an upstream cue that coordinates plasma membrane dynamics with E-cadherin-mediated cell adhesions, and that additional mechanisms may be regulated by S100A11 to coordinate cell-cell adhesion with plasma membrane remodelling. How S100A11 ensures such a dynamic interplay between the plasma membrane and E-cadherin during mitosis remains a key question that we have not fully addressed in this initial study. An attractive mechanism could be mediated by the function of S100A11 in regulating the dynamic interaction between F-actin and the plasma membrane, as previously reported (Jaiswal et al., 2014 Nat Commun). Increasing evidence shows the importance of the crosstalk between the plasma membrane, the cortex and cell shape for correct execution of mitosis (Rizzelli et al., 2020 Open Biol). In our experiments, we show that impaired plasma membrane remodelling and cell shape are associated with defects in F-actin and astral microtubule organisation. Thus, our findings reinforce a model whereby S100A11 is a key membrane-associated protein that coordinates the crosstalk between the plasma membrane, cell-cell adhesion, and the cell cortex during mitosis. It will be key to characterise the interactome of S100A11 during mitosis to provide important mechanistic insights into this new role of S100A11; it is our intention to investigate this in the future.

      To address the points raised by the Reviewer, we have changed and clarified the statements they highlighted above, in the revised manuscript (pages 10 and 11).

      *- An earlier paper from the same lab this year identified Annexin A1 as directing mitotic spindle orientation via localising LGN at lateral cortex. During this earlier paper they also identified S100A11, which is a partner for Annexin A1. The authors could more clearly explain what S100A11 is in the current manuscript and how the current study builds on this earlier study. *

      __Authors response: __We thank the Reviewer for highlighting our previous work characterising the interactome of LGN in mitotic mammary epithelial cells (Fankhaenel et al., 2023 Nat Comms), and identifying Annexin A1 (ANXA1) as a polarity cue regulating the localisation and function of the evolutionarily conserved mitotic spindle orientation LGN complex. We also showed that ANXA1 direct partner S100A11 co-purifies with LGN and that perturbation of the ANXA1-S100A11 complex impairs the localisation of the LGN complex at the cell cortex during mitosis. Thus, as rightly pointed out by the Reviewer, this work builds on our previous work discussed above, but also on previous studies establishing S100A11 as a key regulator of plasma membrane repair by regulating the dynamic interplay between F-actin and the plasma membrane (Jaiswal et al., 2014 Nat Commun), and studies showing that S100A11 interacts with E-cadherin at adherens junctions (Guo et al., 2014 Sci Signal). To address the Reviewer’s point (also raised by Reviewer 1), we have now included a paragraph in the introduction (page 5) and results (page 10) of the revised manuscript describing these and other functions of S100A11 to provide a strong rational to our decision to investigate this protein.


      *- Based on the data presented, I suggest that the authors should requalify their data. I suggest that the conclusions that can be drawn from the data are that cellular state is important for regulating mitosis orientation and fidelity (i.e. adherent epithelia cells vs. less adherent more migratory cells). S100A11 is important for promoting cell-cell adhesions and might be upstream of the known role of E-cadherin in regulating spindle orientation. Whilst I suggest that more quantified experiments would need to be included in order to assess possible effects on plasma membrane remodelling, the manuscript could be generally improved by a clearer explanation of the open question that they are addressing and what specific advance this manuscript has made in relation to the current literature, including their own. I do not currently feel that the title of the manuscript is appropriate since I don't think that a crosstalk between the plasma membrane and cell-cell adhesion has been shown here. *

      __Authors response: __We would like to reiterate our agreement with the Reviewer’s suggestion about the conclusions drawn from our data. In the initial submission we proposed that perturbation of S100A11-mediated regulation of cell adhesion and plasma membrane impairs the identity of mammary epithelial cells, which affects their shape during mitosis leading to aberrant mitotic progression and outcome. While we have not checked the migratory behaviour of cells not forming cell-cell adhesions, we suggested that the cells adopted a mesenchymal phenotype. Furthermore, we discussed the implication of epithelial-to-mesenchymal transition on chromosome segregation fidelity and execution of mitosis, and how precisely they link with our study (see initial submission’s pages 14 and 19). As suggested by the Reviewer, we have now clarified further these observations in the results (pages 7 and 11) and discussion (pages 15 and 19) of the revised manuscript.

      We have quantified several aspects of the changes in plasma membrane dynamics and remodelling throughout, in the initial manuscript (Figure 1D-H; Figure 4C). To address the Reviewer’s point, we have now added quantifications of membrane blebbing (new Figure 1I).

      We would like to emphasise that the introduction of the initial manuscript has included the open questions that led to this study. These questions have been addressed further in the discussion, where we have also formulated new hypotheses and discussed what we think are the important outstanding questions for future investigations, in light of our findings. In this study we demonstrate that maintaining epithelial identity is essential for correct execution of polarised cell divisions. Our findings indicate that mammary epithelial cells grown at sub-optimal density lose their epithelial identity, which results in several mitotic defects. We propose a novel mechanism in which S100A11 acts as a molecular sensor of external cues coordinating the interplay between plasma membrane dynamics and cell-cell adhesion to maintain epithelial identity and integrity, thereby ensuring correct progression, orientation, and outcome of cell division. As suggested by the Reviewer, we have clarified further the advances made in this study, in the revised Results and Discussion sections.

      To address the Reviewer’s final point, we would like to suggest the following revised title “Interplay between the plasma membrane and cell-cell adhesion maintains epithelial identity for correct polarised cell divisions”, which we hope reflects better the results described in our studies.

      *Minor comments: important issues that can confidently be addressed. *

      - P3: I wouldn't describe the junctional proteins listed as polarity proteins.

      __Authors response: __We have now made this rectification in page 3, as suggested by the Reviewer.

      *- Figure 1 - can the membrane blebbing phenotype by quantified? At the moment this part is observational so can't really be used to determine the role of plasma membrane remodelling. *

      • *

      __Authors response: __We have now included quantifications of blebbing in the revised manuscript, as suggested by the Reviewer (new Figure 1I).

      *- Figure 3. I'm not sure what the 'subcortical actin cloud' measurement is. Figure 3G suggests it may be the distance from the cortex to the spindle pole but how does this relate to actin? *

      __Authors response: __The Reviewer is right, the subcortical actin cloud includes a pool of dynamic subcortical actin that extends from the cortex (excluding the stiff cortical actin) to the cytoplasm, interacting with the centrosomes and concentrating near the retraction fibres. The subcortical actin cloud has been shown to mediate cortical forces and to concentrate force-generating proteins at the retraction fibres acting on centrosome dynamics and pulling on astral microtubules to orient the mitotic spindle (for example, please see Kwon et al., 2015 Dev Cell). We have now included this clarification in the revised manuscript (page 10).

      *- Figure 4A. I can't see GFP-S100A11 accumulating at the cell surface. To me these images suggest that it is relatively ubiquitously expressed throughout the cytoplasm and surface, which is different to the later antibody stains, that show localisation at the cell surface. *

      __Authors response: __A similar point has been raised by Reviewer 1. Although our retroviral-mediated transduction allows to avoid excessive expression of GFP-S100A11, the ectopic S100A11 is expressed at higher levels as compared to its endogenous counterpart. Our live images show an accumulation of the protein at the cell surface, but relatively high levels are also visible in the cytoplasm (previous Figure 4A, new Figure S4A). By contrast immunolabelling for endogenous S100A11 shows an obvious accumulation of the protein at the plasma membrane. This difference could also be due to a dynamic behaviour of the protein translocation of GFP-S100A11 between the cell surface and cytoplasm that is captured in our live imaging. Similar slight differences between immunofluorescence and live imaging of cortical proteins involved in mitosis, such as Dynein, NuMA, LGN and CAPZB, have been reported in several studies (to cite a few: di Pietro et al., 2017 Curr Biol; Elias et al., 2014 Stem Cell Rep; Fankhaenel et al., 2023). To address this point, we have now moved the panel showing S100A11 immunofluorescence in Figure S3A to new Figure 4A (also see response to Reviewer 1 Major Point 1).

      *- Fig 4H doesn't show an active process of translocation of E-Cadherin to the cytoplasm. It shows representative images with slightly higher levels of E-Cadherin in the cytoplasm. This could be due to translocation or it could be to do with lack of E-Cadherin assembly. *

      • *

      __Authors response: __We thank the Reviewer for pointing this out. We have rectified this statement accordingly (page 11).

      *- 4I I don't understand where the line profile is derived from - where is apical and where is basal in the images? Could a diagram be included? *

      __Authors response: __We have now included an illustration of this quantification, in the revised manuscript (new Figure 4J).

      - The discussion could be shortened and more clearly written - perhaps with subheadings of the main findings.

      __Authors response: __We have clarified several ideas and statements, based on the specific points addressed above. While it is challenging to reduce the size of this section, given that the study addresses several mechanisms of mitosis, we have now shortened the discussion in the revised manuscript.

      *- Methods: Why is cholera toxin used in the cell culture medium? *

      • *

      __Authors response: __Cholera toxin is a key component of MCF-10A medium, which has been shown to stimulate cAMP activation promoting cell proliferation in culture. This culture protocol is a gold standard in the field (Debnath et al., 2023 Methods). Given that cholera toxin is a highly regulated chemical and takes several months to purchase, we have tried culturing MCF-10A without the toxin, but this negatively affected proliferation and passage of this cells. Therefore, we concluded that adding it to the culture medium is important.

      __Reviewer #3 (Significance (Required)): __

      *In general, this is an interesting paper about the fidelity of mitosis in cells in adherent monolayers vs. in more migratory, non-adherent states. There is existing literature on this topic (some cited in the manuscript, alongside reviews of the topic). *

      • *

      *The main conceptual advance, as far as I can see, is that S100A11 is important for promoting cell-cell adhesions and might be upstream of the known role of E-cadherin in regulating spindle orientation via LGN. The main limitation is that plating cells at different densities is not a direct 'perturbation' of cell-cell adhesion. This means that the phenotypes seen could be due to many factors, not just cell adhesion. Assessment of plasma membrane and cytoskeletal dynamics are also often observational and not conclusive. *

      • *

      *The manuscript would be of interest to basic researchers working on epithelial development. Also potentially to basic researchers working on cancer, due to the mitotic errors described. *

      • *

      *I have expertise in epithelial cell biology. *

      I estimate the authors would need between 3 and 6 months for revisions if they decide to do further experiments and between 1 and 3 months if they decide to re-qualify their claims.

      • *

      __Authors response: __We thanks the Reviewer for their overall positive feedback on our work and its broader importance for researchers in epithelial development and cancer biology.

      We would like to reiterate our agreement with the Reviewer’s assessment of the conceptual advances of our work. We show that S100A11 complexes with E-cadherin and LGN during mitosis to control cell-cell adhesion assembly and the mitotic spindle machinery, respectively, which in turn ensures faithful chromosome segregation. Our results also suggest that S100A11 lies upstream of E-cadherin in the regulation of the LGN-mediated mitotic spindle machinery. We also agree with the Reviewer that plating epithelial cells at low density does not directly affect cell-cell adhesion, because, in these culture conditions, cells are not dense enough to establish cell-cell contacts necessary to assemble stable adherens junctions. Rather, and as rightly pointed out by the Reviewer, cells grown at low density fail to maintain their epithelial identity and adopt a more mesenchymal and elongated behaviour, which is accompanied by dramatic changes in plasma membrane remodelling throughout mitosis. Interestingly, our results show that both S100A11 and E-cadherin do not localise at the plasma membrane in these sub-optimal culture conditions. This along with our results showing that depletion of S100A11 phenocopies the effect of low-density culture conditions on plasma membrane remodelling and E-cadherin mediated cell-cell adhesion assembly, allow us to propose a mechanism whereby the membrane-associated S100A11 protein acts as a molecular sensor of external cues bridging plasma membrane remodelling to E-cadherin-dependent cell adhesion to coordinate correct progression and outcome of mammary epithelial cell divisions.

      We are grateful for the Reviewer’s insightful discussion of our findings. As we discussed above in our responses to their specific points, we have requalified many of our statements to clarify further our main findings and conclusions throughout the revised manuscript. We have also added new quantifications in response to the Reviewer’s suggestions. We believe, that together, these revisions have advanced further the initial manuscript.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary: your understanding of the study and its conclusions.

      The scope of the study is to understand the links between cell-cell adhesion integrity, plasma membrane dynamics and mitotic spindle in mammalian epithelial tissues. To test this, the authors cultured mammary epithelial cells at optimal or low density as a way of perturbing cell-cell adhesion. The authors conclude that perturbing cell-cell adhesion alters plasma membrane dynamics, causing mitotic defects and that S100A11 coordinates this link via E-cadherin. Whilst this is an interesting manuscript, illustrating the differences of mitotic success in optimal density vs. low density cell cultures, I do not think that the conclusions are supported by the evidence presented for the reasons stated below.

      Major comments: major issues affecting the conclusions.

      The manuscript clearly shows that culturing cells at a lower density results in a higher incidence of asymmetric division (figure 1) and mitosis defects (figure 2). Cells round more and faster and there is more actin at the cortex during rounding (figure 3). However, whilst differences in cell-cell adhesion are likely to play a role in mediating these effects, I don't think that it is possible to claim from the data presented that these defects are specifically due to cell-cell adhesion differences. This is because the morphology of cells at low density is also very different - cells appear more mesenchymal, with migratory front-rear polarity instead of apical-basal polarity. These cells will therefore have many differences between them, cell-adhesion being just one. The data is also not showing a 'loss' of cell-cell adhesion integrity but are rather illustrating the differences between cells that have formed cell-cell adhesions and those that have not. To really test the specific role of cell-cell adhesions, the authors would need to inhibit adhesions directly but without altering the cell density - for example via chemical or genetic perturbation within a confined environment. I suggest that the authors either need to do these experiments or to requalify what their data is telling us. The current manuscript also demonstrates that cell adhesion is affected when S100A11 is knocked down (figure 4). It shows binding between and colocalization of S100A11 and E-cadherin, and shows that LGN cortical distribution is affected when S100A11 is knocked down (Figure 5). The results presented are suggestive of S100A11 being upstream of E-cadherin. However, I don't understand how the data shows "crosstalk between the plasma membrane, cell-cell adhesion, and the cell cortex during mitosis". For example, on P9: "We observed unequal distribution of CellMaskTM in a vast majority of S100A11-depleted cells (si-S100A11#1: ~79% versus si-Control: ~26%), indicating defects in plasma membrane remodelling (Figures 4B and 4C)." I don't agree that this demonstrates a defect in PM remodelling. Rather the cells in the representative images are less adherent and have adopted a more migratory cell state similar to that seen in figure 1 when seeded at low density. The fluidity of the much larger cells shown in knock down cells in panel F also appears higher, again suggesting an adhesion defect. An earlier paper from the same lab this year identified Annexin A1 as directing mitotic spindle orientation via localising LGN at lateral cortex. During this earlier paper they also identified S100A11, which is a partner for Annexin A1. The authors could more clearly explain what S100A11 is in the current manuscript and how the current study builds on this earlier study.

      Based on the data presented, I suggest that the authors should requalify their data. I suggest that the conclusions that can be drawn from the data are that cellular state is important for regulating mitosis orientation and fidelity (i.e. adherent epithelia cells vs. less adherent more migratory cells). S100A11 is important for promoting cell-cell adhesions and might be upstream of the known role of E-cadherin in regulating spindle orientation. Whilst I suggest that more quantified experiments would need to be included in order to assess possible effects on plasma membrane remodelling, the manuscript could be generally improved by a clearer explanation of the open question that they are addressing and what specific advance this manuscript has made in relation to the current literature, including their own. I do not currently feel that the title of the manuscript is appropriate since I don't think that a crosstalk between the plasma membrane and cell-cell adhesion has been shown here.

      Minor comments: important issues that can confidently be addressed.

      P3: I wouldn't describe the junctional proteins listed as polarity proteins. Figure 1 - can the membrane blebbing phenotype by quantified? At the moment this part is observational so can't really be used to determine the role of plasma membrane remodelling.

      Figure 3. I'm not sure what the 'subcortical actin cloud' measurement is. Figure 3G suggests it may be the distance from the cortex to the spindle pole but how does this relate to actin?

      Figure 4A. I can't see GFP-S100A11 accumulating at the cell surface. To me these images suggest that it is relatively ubiquitously expressed throughout the cytoplasm and surface, which is different to the later antibody stains, that show localisation at the cell surface.

      Fig 4H doesn't show an active process of translocation of E-Cadherin to the cytoplasm. It shows representative images with slightly higher levels of E-Cadherin in the cytoplasm. This could be due to translocation or it could be to do with lack of E-Cadherin assembly.

      4I I don't understand where the line profile is derived from - where is apical and where is basal in the images? Could a diagram be included?

      The discussion could be shortened and more clearly written - perhaps with subheadings of the main findings.

      Methods: Why is cholera toxin used in the cell culture medium?

      Significance

      In general, this is an interesting paper about the fidelity of mitosis in cells in adherent monolayers vs. in more migratory, non-adherent states. There is existing literature on this topic (some cited in the manuscript, alongside reviews of the topic).

      The main conceptual advance, as far as I can see, is that S100A11 is important for promoting cell-cell adhesions and might be upstream of the known role of E-cadherin in regulating spindle orientation via LGN. The main limitation is that plating cells at different densities is not a direct 'perturbation' of cell-cell adhesion. This means that the phenotypes seen could be due to many factors, not just cell adhesion. Assessment of plasma membrane and cytoskeletal dynamics are also often observational and not conclusive.

      The manuscript would be of interest to basic researchers working on epithelial development. Also potentially to basic researchers working on cancer, due to the mitotic errors described.

      I have expertise in epithelial cell biology.

      I estimate the authors would need between 3 and 6 months for revisions if they decide to do further experiments and between 1 and 3 months if they decide to re-qualify their claims.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Establishment and maintenance of cell polarity are fundamental processes for physiology in multi-cellular organism given the fact that more than 380 million epithelial cell renewal for every second in human adults. However, the precise mechanisms linking plasma membrane polarity and cortical cytoskeleton dynamics of epithelial cells during mitotic exit and interphase remain ill-illustrated. Salah Elias and her colleagues experimentally manipulated the density of mammary epithelial cells in culture, which led to several mitotic defects. Specifically, they found that perturbation of cell-cell adhesion integrity impairs the dynamics of the plasma membrane during mitosis, affecting the shape and size of mitotic cells and resulting in defects in mitosis progression and generating daughter cells with aberrant cytoarchitecture. In these conditions, F-actin-astral microtubule crosstalk is impaired leading to mitotic spindle misassembly and misorientation, which in turn contributes to chromosome mis-segregation. Mechanistically, they identified the S100 Ca2+-binding protein A11 as a key membrane-associated regulator that forms a complex with E-cadherin and LGN to coordinate plasma membrane remodelling with E-cadherin-mediated cell adhesion and LGN-dependent mitotic spindle machinery. I felt that this is a strong manuscript for peer-review as it serves diversified interests in modern cell biology.

      Significance

      Several key cellular experiments should be repeated using a second line of epithelial cells such as RPE1.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      The manuscript "Crosstalk between the plasma membrane and cell-cell adhesion maintains epithelial identity for correct polarised cell divisions" by Dr. Hosawi and colleagues reports the characterisation of the mitotic connection between plasma membrane dynamics and division orientation in polarised mammalian epithelial cells in culture. The authors start from the comparison of mitotic events of human mammary MCF10A cells grown at optimal density or at low density. They observed that only at optimal density MCF10A cells polarise by E-cadherin mediated cell-cell contacts, and display uniform membrane enrichment at the cortex, whereas cells grown at low density do not show cortical E-Cadherin enrichment, and distribute aberrantly the plasma membrane at one side and in cytoplasmic vesicles, generating daughter cells with unequal size. Consistently, further analyses revealed that low-density MCF10A cells undergo misoriented mitosis, with chromosome congression and misegregetion defects. Mechanistically, low density MCF10A cells fail to organise a symmetric mitotic spindle and center it in metaphase. This is due to an increased cortical actomyosin thickness coupled to abnormal astral microtubule stability. Building on previous data from the Elias lab, the authors uncover a role of the membrane-associated S100A11 protein in maintaining correct plasma membrane dynamics and E-cadherin localisation in mitosis. Further dissection of the molecular mechanism underlying this mitotic function od S10011A revealed that it enriches at the cortex only in optimal-density MCF10A cells, and promotes spindle orientation by association with LGN and E-cadherin, upstream of E-cadherin. This evidence depicts the plasma membrane and S100A11 proteins as a key mechanical sensors of cell-cell adhesion orchestrating the recruitment of E-cadherin and LGN-dependent force generators to ensure correct division orientation.

      Major points:

      • Important information is presented in Supplementary Figure S3. I suggest to move these panels in the main figures. Specifically, I would replace figure 4A with S3A showing the distribution of endogenous S100A11 in MCF10A cells, rather than the one of the GFP-tagged version which is over-expressed.
      • The mechanisms of division orientation governed by S100A11 seems to impinge on the control of cortical F-actin and astral microtubule dynamics. This is illustrated in figure S3C, which in my opinion should be shown in the main figures with some more explanation / experiments. The authors mention the " tight actin F-actin bundles at the cell-cell contacts" that are lost in S100A11-depleted cells, and that interact with astral microtubules. However this is not fully clear in figure S3C. I think the authors should find a way to present better these evidence which is key in supporting their molecular model.
      • I think the discussion would benefit from the addition of a graphical cartoon model illustrating the role of S100A11 in controlling plasma membrane dynamics in mitosis and spindle orientation.
      • Finally, to understand the relevance of S100A11 in the context of 3D polarised mammary epithelia, it would be very interesting to analyse the effect of S100A11 knock-downn in mouse mammary epithelial acini grown in matrigel. This is not essential for the proposed studies, but would add biological relevance to the mechanisms characterised in 2D colture.

      Minor comments:

      • It would be preferable to mention the known functions of S100A11 in the introduction rather than at the beginning of the paragraph at pg. 9.
      • at pg 10, beginning of paragraph, I find it a weird phrasing that "LGN interacts with F-actin". As reported in the reference cited here, this is through Afadin, which binds simultaneously LGN and cortical F-actin. I would rephrase it.

      Significance

      The description of cell adhesion as key factor instructing correct mitotic progression and execution of oriented division of vertebrate epithelial cells by controlling plasma membrane dynamics is novel and interesting for scientist in the spindle orientation/polarity field. The experiments are well-designed and perfectly executed and presented. I am in favour of publication of the manuscript, providing that a few points are addressed.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      This MS contains carefully carried out and well controlled experiments describing a new pFFAT in ELYS. There is a similarly convincing demonstration of functionally relevant colocalisation by proximity ligation assay (PLA), particularly that both ELYS and VAP are nuclear envelope proteins in interphase without interacting (neg control in Fig 4D).

      Major Issue: Functional significance

      A key conclusion is that experiments prove that "ELYS serves as the crucial initiation factor for post-mitotic NPC-assembly" (p5). However, evidence for this is lacking as this would require reconstitution of NPC assembly with a mutant form of ELYS carefully changing the FFAT motif (e.g. 1321A 1324E) and exclusion of other probable VAP targets in experiments with mutant VAP. VAPs are among the proteins with the highest number of documented interactors (see Huttlin 2015/7 etc, e.g. PMID 26186194), so knocking down VAP may have pleiotropic effects and quite indirect read-outs in many aspects of cell function. In addition, for this work specifically there are other NE proteins that are known interactors of VAP: Emerin (EMD) and LBR both interact with VAP (high-throughput data, VAPA and VAPB). EMD has a motif similar to the canonical phospho-FFAT: 98 SYFTTRT 104. LBR has no motif. These findings should not be overlooked in this work. For example, was the interaction with emerin (page 4) sensitive to mutating VAP or ELYS? Could the effect seen in Figure 5 result from interactions with proteins other them ELYS?

      Further experiments should be carried out to justify all statements in the current MS of functional significance. Instead of doing more experiments, an alternative for the authors would be to describe the current set of results more cautiously. However, that would require changing much of the impact of the current MS, from the title onwards.

      Moderate Issue: VAPA

      From the start of the Introduction and some elements of the Discussion, include VAPA in equal measure with VAPB. When describing interactions of ELYS with VAP note that Huttlin et al., reported interactions twice for each of VAPA and VAPB. When describing own results (James et al. 2019) and those of others (Saiz-Ros et al., 2019) that focused on VAPB, clarify if the authors' view is that VAPA would (or would not) have the same interaction.

      Is there any evidence that only VAPB is on NE? Note that some refs in the Introduction relate to VAPA: Mesmin (not VAPB); ACBD5: although article titles refer to VAPB, early work (10.1083/jcb.201607055) showed almost identical involvement of VAPA. Also, this redundancy likely explains "function of VAPB in mitosis is not essential," (in Discussion). The lack of effect of VAPA knock-down may indicate that in these cells VAPB is dominant, but does not exclude a role for VAPA when VAPB is reduced. That might be tested by depleting both. Even following that, there is MOSPD2 to consider

      Other aspects of the writing

      "two amino acid residues are crucial for the interaction (VAPB K87 and M89)." This is wrong. Many residues are critical, these are merely 2 of possibly >10 that were chosen by Kaiser et al (2005) to create their non-binder.. Others have used different mutations to block FFAT binding.

      "They may exhibit a certain binding preference to specific members of the VAP ... family...". I cannot think of any example. I note no citation is given.

      When listing many or all MSP proteins, the text should state that MOSPD2 is uniquely close to VAPA/B. CFAP65 is typically not mentioned in the VAP-like lists as it does not have any of the conserved sequence that binds FFAT. If however the authors wish to include all human MSP domain protein, they should also include Hydin.

      Slightly wrong to cite De Vos et al., 2012 about PTPIP51's FFAT as that paper makes no mention of the motif. Better pick Di Mattia (again)

      On VAPB (and also A) on INM: there are references to be cited esp. relating to intranuclear Scs2 in yeast (Brickner et al 2004, Ptak et al 2021)

      Citations for VAP at ER-mito contacts "De Vos et al., 2012; Gómez-Suaga et al., 2019; Stoica et al., 2014)". These all refer to the same bridging protein, PTPIP51. Reduce to one citation. Then mention other proteins at the same site VPS13A, mitoguardin(MIGA)-2 ...

      "The domain interacts with characteristic peptide sequences ..." add citation to this sentence

      "Several variants of such motifs have been described: (i)" ... "(ii)": (i) and (ii) are entirely unlinked. Delete these and also "Several variants of such motifs have been described." Which is repeated later

      "FFAT-like motifs come in different flavors and may even lack the two phenylalanine residues (Murphy and Levine, 2016)": while motifs can tolerate variation at both positions, this text is misleading as it implies much more variation than is known. The 1st F can only be conservatively substituted (Y).

      Minor aspects in Results:

      ORP1L peptide as positive control: cite Kaiser 2005

      Was phosphoproteomics done in such a way as to find peptides that have both S1314 and S1326?

      Figure 4D, row 2: Comment on intranuclear staining in Prophase (at approx 4 o'clock) of both ELYS & VAP that is PLA positive

      Referees cross-commenting

      I agree with this point from Reviewer #1. We all agree that the main issue can be resolved experimentally to determine the effect of subtle point mutations in ELYS. Both other reviewers have done a good job in finding issues with the experiments that can also be addressed.

      Significance

      This work documents an interaction between the protein ELYS, that is involved in the reformation of nuclear pore complexes after mitosis, and the ER membrane protein VAPB. The interactions was previously known through high-throughput studies, along with many 100's of others for VAP, but here it is studied in detail and with care, identifying how the motif is induced by phosphorylation of ELYS. The two proteins are co-localised using convincing proximity ligation assays. This biochemistry and cell biological localisation is well done.

      Functional experiments then show that VAP (in this case VAPB) knock-down affects mitosis and chromosome segregation. While the result is incontrovertible, it has many possible interpretations, mainly because VAP has hundreds of interactions, including with multiple proteins involved in mitosis beyond just ELYS. This means that there are major limitations on how the interaction and co-localisation should be interpreted, reducing the advance associated with the current manuscript to incremental, and the limiting the audience to specialized.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary:

      In this study, James et al. follow up on their prior discovery that the ER contact site protein VAPB localizes to the nuclear envelope and is a putative binding partner of the nucleoporin ELYS, which coordinates nuclear envelope reformation (NER) with nuclear pore complex (NPC) biogenesis at mitotic exit and is also a constituent of the nuclear facing Y-complexes of mature NPCs. Using a series of complementary biochemical approaches the authors 1) demonstrate that VAPB and ELYS directly interact, 2) map the binding sites on ELYS that are sufficient to bind VAPB, 3) show that mutations that disrupt VAPB-FFAT motif binding also abrogate binding to ELYS including of the full-length protein, 4) define mitotic phosphorylation sties on VAPB-bound ELYS, 5) demonstrate that phosphorylation of ELYS, specifically at the FFAT2 motif, is required for binding to VAPB, and 6) demonstrate that the phosphorylation of ELYS that regulates VAPB binding occurs in mitosis. Turning to cell biology, the authors find that VAPB, which is an established ER protein, has some preference for non-core regions during NER (like ELYS). In addition, PLA analysis suggests that the interaction of VAPB and ELYS is most robust during anaphase and is somewhat disrupted when the binding of VAPB to FFAT motifs is lost due to targeted mutation. Last, the authors demonstrate that depletion of VAPB leads to metaphase delay and lagging chromosomes.

      Major comments:

      The data supporting direct binding of peptides encoding the FFAT 1 and FFAT2 motif derived from ELYS to VAPB in a manner similar to other FFAT sequences is strong, as is the effect of phosphorylation of FFAT1 on the strength of this interaction.

      The evidence supporting the mitotic-specific nature of the ELYS-VAPB interaction is strong, and that this interaction is direct, is also strong, and was rigorously tested using a combination of endogenous expression, heterologous expression, and recombinant protein approaches. Moreover, the sensitivity of this interaction to established mutations in VAPB abrogating FFAT interactions reinforces the outlined underlying biochemical interaction mechanism. The essentiality of ELYS phosphorylation (and therefore the mechanism underlying the mitotic specificity of the interaction) is also strongly supported by the data using phosphatase treatment. Although it is an intuitive model, whether the cell biological evidence support the simplest view that the ELYS-VAPB complex bridges the nuclear envelope to chromatin during NER in late anaphase / at mitotic exit is far less solid and, at a minimum, alternative models should be considered/discussed. For example, how a delay in metaphase in the siVAPB condition is consistent with a role in NER, which occurs exclusively post-metaphase, is unclear. Is it not possible that the VAPB-ELYS complex is regulated by phosphorylation during mitotic progression such that VAPB and/or ELYS can only exert their biological effects when released from the complex? In other words, might ELYS be licensed to act in NER only when it is released from VAPB, which could prevent premature NER/NPC biogenesis? Subtleties of when during mitosis the phosphorylation occurs is challenging, and it could be that the anaphase A to anaphase B transition, when many mitotic entry phosphorylation events begin to be reversed, could be relevant here. Along these lines, in Fig. 5 how the VAPB knock-down does or does not recapitulate the phenotype of an ELYS knock-down in this cell type (and the effect of the combination, to address epistasis) is needed for context, as is whether VAPB knock-down affects ELYS distribution in mitosis. ELYS knock-down would also be very beneficial for the PLA analysis to establish the "floor" of measurable signal. Last, it is also possible that VAPB has other roles in mitosis that should be acknowledged - for example although it is in yeast, it is relevant that a VAPB orthologue Scs2 is required for normal nuclear envelope expansion in mitosis by regulating SUMOylation (Ptak, Saik et al., JCB, 2021 and Saik et al., JCB, 2023) - this work should be referenced as well. Of course, the ideal experiment would be one in which an ELYS knock-down is complemented with a resistant form that encodes the S to A mutations in the FFAT2 region to assess its localization and to see if it can complement the knock-out function of ELYS in post-mitotic NPC assembly or, as suggested by a sequestration model, it can drive the same metaphase delay seen upon VAPB knock-down. This is technically challenging for sure, particularly given the size of the ELYS gene, but it would address the cell biological function of this interaction in the most direct manner. Several other observations that could warrant further comment or study include 1) is there a VAPB signal at the metaphase poles as suggested by Fig. 4A and, if so, could this represent aa distinct mitotic function?; 2) Does the HA-VAPB KD/MD mutant localize differently in mitosis compared to the WT - it appears that it might be less enriched in non-core regions (Fig. 4E)?; 3) does VAPB alter post-mitotic NPC biogenesis/number?

      Minor comments:

      I would suggest avoiding the use of "novel" when describing newly assembled NPCs or post-mitotic nuclear envelope reformation, as its other meaning of "non-standard" makes this wording confusing. It is unclear whether when the authors state that ELYS localizes "to the nuclear side of the nuclear envelope" they are referring to the nuclear aspect of the NPC and/or a separate pool at the INM - please edit to clarify. More descriptive y-axes for the plots in Fig. 4F and 5F and related legends would be useful; although the details are in the methods section, it would be nice not to have to hunt them down. Also, please clarify the meaning of blue and orange points in Fig. 4F.

      Significance

      General assessment: The biochemical analysis is rigorous and compelling and establishes the mitotic-specific interaction of VAPB and ELYS including detailed information about the binding interface and its regulation by phosphorylation. The new insight provided into the function of this VAPB-ELYS interaction is somewhat less well developed as the current manuscript, in its current form, does not yet mechanistically define the function of the VAPB-ELYS interaction in mitosis.

      Advance: Conceptually, to the best of my knowledge, the idea that VAPB contributes to mitosis in mammalian cells is novel and is therefore impactful and will motivate further work. As the authors connect VAPB biochemically to ELYS, an established factor that promotes the coordination of NER and NPC biogenesis, this interaction is likely to be mechanistically important, although the specific details by which this interaction facilitate normal mitotic progression is not yet clear.

      Audience: This work will be of interest to a broad swath of cell biologists including those interested in NPCs, the nuclear envelope, the ER, membrane remodeling, and chromosome segregation.

      My expertise is in nuclear envelope dynamics, nuclear pore complexes, and chromatin organization.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary

      The VAP proteins are well established as tail anchored proteins of the ER membrane. VAPs mediates co-operation between the ER and other organelles by creating a transient molecular tether with binding partners on opposing organelles to form a membrane contact site over which lipids and metabolites are exchanged. Proteins which bind VAPs generally contain a short FFAT motif, of varying sequence which binds the MSP domain of VAP. More recently the FFAT motif has been more extensively analysed in multiple different proteins and differential phosphorylation of the FFAT motif has been shown to either enhance or block VAP binding depending on the position of the phosphosite.

      Recent work conducted by the authors demonstrated that a small population of VAPB is not exclusively localised to the ER and can also reach the inner nuclear membrane. They also identified ELYS as a potential interaction partner of VAPB in a screening approach. ELYS is a nucleoporin that can be found at the nuclear side of the nuclear envelope where it forms part of nuclear pore complexes. During mitosis, ELYS serves as an assembly platform that bridges an interaction between decondensing chromosomes and recruited nucleoporin subcomplexes to generate new nuclear pore complexes for post-mitotic daughter cells. In this manuscript, James et al seek to explore this enigmatic potential interaction between ELYS and VAPB to address why VAPB may be found at the inner nuclear membrane.

      Peptide binding assays and some co-immunoprecipitation experiments are used to demonstrate that interactions occur via the MSP-domain of VAPB and FFAT-like motifs within ELYS. In addition, it is demonstrated that, for the ELYS FFAT peptides, the interaction is dependent on the phosphorylation status of serine residues of a particular FFAT-motif that can either promote or reduce its affinity to VAPB. Of most relevance is a serine in the acidic tract (1314) which, when phosphorylated increases VAPB binding. This is completely in line with what is already known about the FFAT motif and so is not surprising, in particular when using a peptide in an in vitro assay.

      The authors then utilise cell synchronisation techniques to provide evidence that both phosphorylation of ELYS and its binding to VAPB are heightened during mitosis. Immunofluorescence and proximity ligation assays are used to demonstrate that the proteins co-localise specifically during anaphase and at the non-core regions of segregating chromosomes.

      The manuscript is concluded by investigating the effect of VAPB depletion on mitosis with some evidence to suggest that transition from meta-anaphase is delayed and defects such as lagging chromosomes are observed.

      Major comments

      Overall, this manuscript is well written and the data presented in Figures 1-3 convincingly show the nature of the interaction between ELYS and VAPB. Clearly the proteins interact via FFAT motifs and this interaction appears to be enhanced during mitosis. However, the work as is, relies heavily on peptide binding assays and would benefit from additional experiments to further support the results. The authors need to more clearly show that this specific phosphorylation happens during mitosis, they may have this data but it is not clearly explained. In addition, the data that VAPB-ELYS interaction contributes to temporal progression of mitosis (as per the title) is not sufficiently clear. VAPB silencing appears to have some impact on mitosis but this is not the same thing. So this section needs to be strengthened before this statement can be made.

      The authors claim that the study "suggests an active role of VAPB in recruiting membrane fragments to chromatin and in the biogenesis of a novel nuclear envelope during mitosis". Given the data presented in Figures 4 and 5, this appears to be rather speculative with little evidence to support it, so data should be provided or this statement toned down. Currently, without additional supporting data the authors may wish to revise the overarching conclusions of the study and change the title.

      Specific points.

      Peptide pull down assays clearly show which FFAT-like motifs are important in facilitating binding. The co-immunoprecipitation systems used in Figure 2 also provide useful information on the interaction in a cell context. The authors should combine these findings by introducing full length ELYS mutants with altered FFAT-like motifs into their stably expressing GFP-VAPB HeLa cell line and then performing Co-IPs to help identify which FFAT motif/s drive the mitotic interaction. Other mutants of ELYS harbouring either phosphomimetic or phospho-resistant residues may also be introduced to further investigate mechanisms of the molecular switch in a cellular environment to support the work currently done with peptides alone. This is an obvious gap in the work which, based on the other data the authors have shown, should presumably be straightforward and would also lead directly into the next major point.

      • Whilst silencing VAPB does appear to delay mitosis, no reference is made to ELYS throughout Figure 5 nor as part of its associated discussion. Given that VAPB has more than 250 proposed binding partners, the observed aberration of mitotic progression could result from a huge number of indirect processes. Further work is needed to link the experiment specifically to the VAPB-ELYS interaction and not just loss of VAPB. We would suggest generating a complementation system where ELYS is either knocked out or silenced and then wild-type ELYS and an ELYS FFAT mutant (which cannot interact with VAPB),and/or a phospho mutant (whose interaction cannot be regulated during mitosis) are introduced. Then the observed effects can be better attributed to the VAPB-ELYS interaction and not just loss of VAPB.
      • The immunofluorescence and PLA results in Figure 4 could be strengthened by including other ER markers. This would show that co-localisation of ELYS at the non-core region is specific to VAPB protein, not any ER protein or rather than an artefact of the ER being pushed out of the organelle exclusion zone during mitosis and therefore 'bunching' at the periphery of the nuclear envelope. It would be worthwhile repeating these experiments with candidates such as VAPA, other ER membrane proteins or at least GFP-KDEL, to make this phenomenon more convincing. As part of this the authors should ideally generate a complemented ELYS KO (see point above) to avoid the residual activity attributed to endogenous background in the PLA Figure 4E.
      • Authors should clarify if the phosphorylation events (in particular S1314) only occur or are increased during mitosis. This may be data they have from the MS experiment in Figure 3 or it could also be shown using a phospho-antibody (although this can be challenging if a suitable antibody cannot be made).
      • The authors should clarify why they need to do these semi in-vitro assays with purified GST-VAPB-MSP on beads and then lysates added and not just a standard co-IP. If this is simply signal intensity due to a very small proportion of VAPB binding to ELYS then this is fine but this should be stated and it should be made clear that ELYS is not a major binding partner - most of VAPB is on the ER. Otherwise, this is misleading.

      I estimate that the suggested alterations above would incur approximately 3-6 months of additional experimental work, depending on if KO cell lines were required.

      Minor comments

      • To show that the observed interactions and potential role of VAPB-ELYS interaction is universal it would be useful to have at least a subset of experiments also shown in another cell line or system - this is now also a requirement for some journals.
      • Consider re-wording the title of the manuscript to better reflect the data presented within the study. Alternatively, provide further evidence that VAPB-ELYS interactions directly affect temporal progression of mitosis to validate this claim, as discussed above.
      • Quantification of blots in Figure 2A could allow measurement of relative binding affinities between VAPB-ELYS throughout the cell cycle. The same could be applied to the effect of phosphorylation on binding affinity in Figure 2D.
      • The cells used are never clearly mentioned in the text - I assume this is always in HeLa but this should be added in all cases for clarity
      • Page 8: "As shown in Fig. 2A,a large proportion of GFP-VAPB was precipitated under our experimental conditions." - I don't understand how this is shown in this figure as the non-bound fraction is not shown?
      • Please provide some controls to demonstrate the extent to which the samples used are asyn, G1/M or M.
      • Page 9 - why are Phos-tag gels not shown as this would make this result more convincing?
      • Figure 3A - I find the SDS-PAGE gel confusing. Why not show the whole gel and why is the band size apparently reduced in the mitotic fraction when previously it was increased (by phosphorylation)? It would also be useful to see if there were any other band shifts.
      • "FFAT-2 of ELYS is regulated by phosphorylation" The way you have setup the experiment leads the reader to think you are going to show which sites are differentially phosphorylated in mitosis, but then this is not the case - so there seems no purpose to doing the experiment this way. If you used TMT MS approach you would be able to potentially quantify the change in phosphorylation at the FFAT motif sites in mitosis. Otherwise what is the purpose of using these 2 samples, mitotic and AS?
      • For all of the antibodies used, in particular for the PLA, please provide evidence of validation of the antibodies.
      • Just a minor point to consider - In the methods for your lysis buffer you use 400mM NaCl - might this slightly reduce the VAPB-FFAT interaction? Worth considering reducing this?
      • "The rather small difference observed between the wild-type and the mutant protein observed in this experiment probably results from the presence of endogenous VAPB in the stable cell lines, which could form dimers with the exogeneous HA-tagged versions." If this is the case then please demonstrate that this is happening, or use the KO approach in the major points above.
      • "we now show that the proteins can indeed interact with each other, without the need for additional bridging factors (Figs. 1 and 3)." You show that the peptides can bind - but this is not the same thing as the peptide in the full context of the protein - so this should be toned down or removed.
      • "Remarkably, this region is highly conserved between species, suggesting that it is important for protein functions (data not shown)". Please show the alignments so the reader can judge for themselves. It is conserved in ALL species and the phosphosites are also conserved??
      • "In our experiments, knockdown of VAPA alone did not lead to a delay in mitosis (data not shown). " Why not show this data - as this is a very interesting and potentially important observation? Also add the validation of knockdown of VAPA.
      • I find the end to the discussion to the paper rather abrupt. It would be interesting to discuss further how VAPB, but not apparently VAPA reaches the INM and if so why this function is required of an ER adaptor and not another more obvious adaptor protein. In short - why would VAPB be performing this role?

      Referees cross-commenting

      I agree with the comments of the other reviewers, and they are very much in line with my own review. We all seem convinced that VAPB binds ELYS via a pFFAT, and that this interaction is enhanced during mitosois. However the role of this interaction in mitotic progression remains unclear and based on this data should not be claimed in the title or discussion of the paper.

      Significance

      Overall, if the manuscript could be improved with the suggested changes, then this could be a considerable conceptual advance in how we understand the VAP proteins, showing functions beyond those as an ER adaptor. This would be significant for the field.

      In the context of the existing literature the work does not advance our knowledge of FFAT-VAP interactions, this has already been shown, but it would give a nice example of how this can be regulated during mitosis and how VAP can contribute beyond just as an ER adaptor at membrane contact sites.

      There would be a wide audience in the cell biology field and more widely as mutations in VAPB cause a form of ALS, and many people are working in this area.

      My field of expertise is in organelle cell biology and membrane contact sites.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      This work uses state-of-the art cell imaging and careful image quantification to study early secretory pathway dynamics during budding yeast gametogenesis. The work builds on previous findings of roles for Sec16 in ER exit site formation, Sec-body formation during specific developmental stages, and for Vps13 in lipid homeostasis. The work appears to be carefully conducted and is nicely presented.

      Much of the early work - here relating to meiosis in budding yeast, reflects that from studies of mitosis in other systems. This work therefore adds nicely to our understanding of membrane dynamics during cell division. Figures 1 and 2 are useful additions to the literature in this regard. I would have preferred images to be presented in magenta/green rather than red/green for wider accessibility.

      The advance is therefore not conceptual but functional. It would, in my view, be unfair to dismiss this as incremental.

      Major

      My major comment here relates to the FRAP data - the difference in half-life of recovery is clear but there are also substantial differences in the immobile fraction. It is vital that this is expanded on and discussed - it has direct relevance to the conclusions relating to the ongoing functional activity of ERES and the comparison to Sec bodies. Is it not possible that the immobile element here is a functional "reserve" like with Sec bodies? This might be consistent with multiple pools of COPII proteins acting at different stages to maintain then promote secretory activity. Some consideration needs to be given to expanding this and possibly including these data in the main figure. Further analysis and controls should also be included here, other COPII proteins and other markers that one might predict would not alter dynamics in these conditions.

      The key mechanistic advance in the manuscript relates to the role of Gip1 with clearly defined outcomes showing its role in ERES remodelling in nascent spores, regeneration of the Golgi and PSM elongation. The context of this part of the work is most important. Specifically, the comparison to VPS13 mutant needs to be expanded on and better explained. The analysis in Fig.4 needs a clearer explanation within the figure of how localization to the PSM is defined. The detail in the methods is also insufficient and the "custom R script" should be published with the work (or on a publicly accessible repository such as Git/Zenodo etc).

      The development of this work with the delta-sep mutant gives useful insight and the analysis of Sec16 does indeed support a model where this is an early marker for the process. Despite the link to septins no direct analysis of YSW1 is included (which suppresses the sporulation defect in gip1 ts alleles.

      Minor:

      Figure 3 introduces new data on reticulons and their impact on ER membrane shape. Again, this reflects findings in other systems but does not add much to the specific narrative of this story but is useful for those in the field. Similar to this, the data on Sec4 are of interest to the specialist but add little to the overall story.

      The discussion is quite lengthy and speculative dealing with themes and ideas that are not addressed directly by this work. My comments on the FRAP data relate directly to the models in Figure 8 and this discussion. Given the emphasis on nutrient starvation in the final discussion more detail is needed on the relative experimental conditions used here and in flies/mammals.

      Some relevant prior work should also be cited e.g. on the role of Sec16 on exit from mitosis PMID: 21045114, other work relating to gip1 mutants (PMID: 19465564).

      Consider presenting images as magenta/green.

      Referees cross-commenting

      I agree broadly with the other reviewers comments.

      While there are elements that could be developed much further. I am not familiar with the role of GIP1 in transcriptional regulation - is this from work in yeast or solely Arabidopsis (is GIP1 here - GBF1 interacting protein, a true equivalent?).

      I agree with the comments on the need for further - and well explained - statistical analyses.

      Significance

      Overall, the work is solid and adds nicely to our understanding. It is likely to be of most interest to a quite specialist audience. The work on PSM formation and spore formation is a clear advance with significant sections of the work being of interest to a wider audience working on early secretory pathway (notably COPII dynamics). Deeper mechanistic insight is missing but non-trivial. More depth would be added by studying further deletion mutants but I am not entirely convinced that this will rapidly advance the field further than this current presentation.

      My expertise is in early secretory pathway function.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Suda et al. conducted an in-depth investigation of gametogenesis in budding yeast, focusing on the formation of the prospore membrane (PSM) through membrane trafficking rearrangement. They made an interesting observation that the number of endoplasmic reticulum exit sites (ERES) fluctuates during PSM formation, transitioning from decreasing to increasing. The study proposed that ERES regeneration, facilitated by protein phosphatase-1 and its specific subunit, Gip1, plays a crucial role in this process. However, the mechanism by which Gip1 regulates ERES numbers remains unclear, and the authors primarily used Gip1 mutants that may affect transcriptional regulation through Glc7, raising concerns about potential indirect effects. It is essential for the authors to experimentally validate the key mechanisms underlying their findings to strengthen their conclusions.

      Major Points:

      1. The conclusion that the loss of ERES causes a transient stall in membrane trafficking and leads to Golgi loss is based on the phenotype of GIP1 KO and SED4 KO cells. However, how Gip1 regulates ERES numbers remains unclear. The authors need to define whether Gip1 mediates this regulation through Glc7 dephosphorylation or via transcriptional regulation.
      2. The claim of ERES fluctuation during gametogenesis lacks statistical validation (Figure 1D). Since the difference is very small, the authors should perform a statistical analysis to determine if there is a significant difference in ERES numbers during different stages of gametogenesis.
      3. The conclusion regarding the loss and regeneration of the Golgi apparatus is based on qualitative observations of Mnn9, Sys1, and Sec7 signals. A quantitative analysis is necessary to strengthen these findings, as some cells may retain these signals despite their disappearance in representative images.
      4. Based on phenotypic similarity between GIP1 KO and SED4 KO cells, they concluded that Gip1 regulates the ERES number required for PSM expansion. They demonstrated that the number of ERES and Golgi dramatically decreased in GIP1 KO cells. The authors also need to do this experiment in SED4 KO cells? Since Sed4 affects ER function in general, the authors should demonstrate that SED4 KO cells are appropriate to make a conclusion about ERES regulation and PSM expansion.

      Referees cross-commenting

      Consistent with the other two reviewers, we feel our comments should be addressed prior to publication of this manuscript.

      Significance

      Overall, the study presents a high-quality imaging analysis of gametogenesis in budding yeast. However, the authors should experimentally validate the mechanisms underlying ERES regulation by Gip1 and conduct rigorous statistical analyses to support their observations. Additionally, since gametogenesis and Gip1 are yeast specific, the significance of this study might be limited.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary: Yeast gametogenesis requires major membrane reorganization to ensure proper spore formation for survival during starvation, but many questions remain for how this process occurs. This current manuscript by Suda et al. uses fluorescence live imaging to visualize the dynamics of secretory pathway components which are critical for contributing lipids to the prospore membrane (PSM) in the developing spore. The authors find that ER exit sites (ERES) initially decrease and then gradually increase, coinciding with their appearance inside the PSM, suggesting that new lipids for PSM growth are trafficked through the secretory pathway from within the PSM. By screening through known genetic mutants that cause meiosis defects, the authors identify Gip1p, an adaptor for protein phosphatase 1, as a master upstream factor for prospore-associated ERES formation. Interestingly, the authors additionally identify a non-essential component of ERES in vegetative cells, sed4, to be important for sporulation and ERES PSM localization.

      Overall, the biological question is interesting and the imaging quality is appropriate. The general conclusion that ERES foci localize inside developing PSMs in a gip1- and sed4- dependent manner is supported by the data. However, the manuscript is purely descriptive; not much molecular insight is gleaned into how secretory pathway components localize to the inside of the PSM, nor is it clear how important this localization is in contributing new lipids to the PSM. Additionally, there are multiple points within the writing and presentation of the results, some specified below, that require clarification; more details in the quantifications also need to be included to ascertain whether the data robustly support the authors' current conclusions.

      Major comments:

      • The loss of gip1 affects multiple aspects of sporulation and leads to an early termination of spore formation, giving little insight into how ERES are established inside the PSM. The most intriguing result is that loss of sed4, a nonessential paralog of the membrane-bound Sar1 GEF, leads not only to sporulation defects, but also affects the localization of Sec13/ERES to the spores. Given that some spores still form in the sed4 cells, more experiments detailing ERES and golgi localization within the forming spores could be done. Does the golgi no longer localize within the PSM in sed4 cells? Is there are a PSM size difference between those that do and do not have ERES foci in this genetic background? Where does Sed4 localize in gip1 cells?
      • While Vps13 is introduced as an additional pathway for supplying lipids, this manuscript does not address the relative contribution of vesicular trafficking versus vps13 lipid transport in PSM formation. Where does Vsp13 localize in the sed4 cells? Are they enriched around/within those spores that do form?
      • The clarity of writing in the results and discussion section could be improved, some of which I point out below. The discussion could also be shortened.

      Specific comments:

      • For all quantifications, more information is necessary, including sample sizes, mean/median values, and number of biological replicates. It may be helpful to include these values in a separate supplemental table.
      • Relatedly, for 1D, 3C, and 4C graphs: It is difficult to judge whether the changes of ERES # are significantly different across the various genetic backgrounds as displayed, and given the large spread and small changes, statistical analyses are required to make such conclusions. Could the authors comment on why there is a minor yet noticeable percent of cells with very high ERES numbers?
      • To make specific conclusions that ERES 'regenerate' inside PSMs, more detailed quantifications of ERES foci # inside the developing prospores should be included, with appropriate statistical analysis.
      • Figure 6A, B: The localization of Glc7 does not look different to me, as claimed. The septin-like cable localization presumably occurs during elongation, as seen in 6A, and gip1D cells do not enter this phase, then it should be expected that there would be no septin-like localization. In 6B, the lower panels seem to show mature, closed PSMs; can the authors label the phases and explain why this is?
      • Figure 8, Top panels, indicate the purple coverage is PSM. It is unclear why the authors suddenly say that ERES are 'transiently inactivated' here and in the discussion to describe the lower # of ERES foci, whereas the appearance of PSM-associated ERES foci is considered 'regenerated' (which implies de novo assembly). In general, from the present data, one cannot conclude inactivation vs. formation/regeneration, so some caution in terminology is warranted.

      Minor comments:

      • A schematic showing the different stages of meiosis and of PSM formation would be useful.
      • Scale bar dimensions are missing for most of the figures.
      • It may be helpful to use an alternate color combination for merged images (i.e. cyan/yellow, red/cyan, or magenta/green), to accommodate colorblind readers.
      • For Figure 1C, authors should show orthogonal views along the z plane at timepoint 8 to show that ERES foci are indeed inside the PSM.
      • Figure 1E legend, define closed arrowhead; additionally, include an explanation in the main text of what the Spo20(51-91) marker is.
      • For kymograph displays (Figures 1E, 5A, 7E), please include time points in each frame.
      • Figure 4D, 4E legend, the multiple terms describing PSM circumference length is confusing: 'cell perimeter, 'PSM perimeter' and 'PSM length'. Please choose one term and describe this fully in the text.
      • Fig 5: The images in Fig 5 are dim and the gain should be adjusted accordingly. Figure 5B, is this an intensity trace of one punctum, or punctae from multiple cells as implied in the text?
      • More details, not just references, in methods for sporulation induction and image analysis should be included.

      Referees cross-commenting

      I also agree that our comments should be addressed prior to publication. Of the existing data, the need for further statistical analysis is a high priority.

      Significance

      The data and conclusions presented here are for a specialized, basic audience interested in yeast meiosis, especially focused on how membranes and the secretory pathway are remodeled during this process. The paper's results have some implications for the reproductive aging field, but this area is not directly investigated in this current manuscript. The paper uses mostly established organelle markers and gene mutants previously known to be involved. The finding of Sed4's involvement in sporulation is, to my knowledge, novel and intriguing.

      Reviewer Expertise: organelle morphology, the secretory pathway, protein aggregation, stress responses, aging, fluorescence microscopy, yeast, C. elegans, mammalian cells, biochemistry

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      I - General criticisms

      Reviewer #1: My main criticism is unfortunately inherent to the approach: comparative studies are absolutely critical, but they can only provide a very sparse sampling of diversity. Fortunately, thanks to high-throughput sequencing, bioinformatic analyses can now be performed on a large number of species, but experimental validation is typically restricted to two or three species. The consequence of this for the present manuscript is that while the functional conservation of the Gwl site is convincingly shown, the exact mechanisms responsible for the reduced effect of PKA phosphorylation remain relatively vaguely defined. Indeed, in their Discussion the authors list a number of experimental approaches to address this - but I understand that these would all involve substantial efforts to address. In particular, testing chimeric constructs around the consensus PKA site and from multiple species could be very informative.

      We completely agree with the reviewer that comparative approaches are critical to understanding biological mechanisms, and are excited by the increasing possibilities to perform not only sequence and descriptive comparisons but functional studies across a range of emerging model organisms. We hope that more and more researchers in cell and molecular biology will profit from experimental tools and techniques now available in such species, and to pioneer new ones. Of course, and he/she rightly points out, conclusions are currently limited by the number of species studied, but comparisons between two judiciously chosen species can already be very informative. Thus, in our study, the use of Xenopus and Clytia allowed us to make significant progress towards our main objective of understanding the cAMP-PKA paradox in the control of oocyte maturation; specifically by showing both that PKA phosphorylation of Clytia ARPP19 is lower in efficiency and that the phosphorylated protein has a lower effect on oocyte maturation than the Xenopus protein. As the reviewer points out, unravelling the exact mechanisms underlying these differences will require a large amount of additional work and is beyond the scope of the current study. Actually, we have embarked on several series of experiments to this end using some of the approaches listed in the Discussion. Specifically, we are testing the biochemical and functional properties of chimeric constructs containing the consensus PKA site from various species. This is a substantial undertaking which will require one to two years to complete, but is already giving some very interesting findings.

      Reviewer #1: The figures and text could be slightly condensed down to about 6 figures.

      We have reduced the number of figure panels but we prefer to maintain the number of figures, because the experimental data presented in them is essential to the interpretation of our results and the overall conclusions of the article. If the journal editor would like us to reduce the number of figures, we could do this by displacing Figure 4 and some panels of other figures (to then fuse some of them) to supplementary material, but this would be a pity.

      ____________II - Abstract

      As recommended by Reviewer #2, we have reworked the Abstract to make it more accessible to new readers, attempting to bring out more clearly and simply the main results and conclusions of the study. We correspondingly simplified and shortened the title of the article. Changes: Page 2.

      ____________III- Introduction points

      Reviewer #2: I believe that it would be interesting to include some time-references when introducing the prophase arrest of Clytia and Xenopus oocytes. How long is prophase arrest in Xenopus compared to Clytia or other organisms? How can this affect the prophase arrest mechanisms? It seems that the prophase arrest in Xenopus oocytes is found to be significantly more prolonged compared to Clytia and various other organisms, and also meiotic maturation proceeds much more rapidly in Clytia than in Xenopus. This should be indicated in the introduction with a short introduction of why, and not others, were these species chosen for this study.

      Differences in timing of oocyte prophase arrest and in maturation kinetics across animals are indeed highly relevant in relation to the underlying biochemical mechanisms. Unfortunately, not enough information is currently available concerning the duration of the successive phases of oocyte prophase arrest across species to make any meaningful correlations with PKA regulation of maturation initiation. We have nevertheless expanded the Introduction to cover this issue as follows:

      • We start the introduction by mentioning how the length of the prophase arrest varies across species. Changes: Page 3, lines 5-11.
      • We have added examples of species which likely have similar durations of prophase arrest but show cAMP-stimulated vs cAMP-inhibited release. Changes: Page 4, lines 28-35.
      • We have specified the temporal differences in meiotic maturation in Xenopus (3-7 hrs) and Clytia (10-15 min). Changes: Page 5, lines 32-33.

      Reviewer #2: why, and not others, were these species [Xenopus, Clytia] chosen for this study. A brief justification is included in lines 1-page 5 "..a laboratory model hydrozoan species well suited to oogenesis studies", but it does not explain why this and not other hydrozoan species like Hydra, that has also been used for meiosis studies.

      As requested by Reviewer #2, fuller details are now included about the advantages of Clytia compared to other hydrozoan species, citing several articles and recent reviews here and also in the Discussion. Changes: Page 5, lines 21-32 & 37-39.

      Hydra is a classic cnidarian experimental species and has proved an extremely useful model for regeneration and body patterning, but is not suitable for experimental studies on oocyte maturation because spawning is hard to control and fully-grown oocytes cannot easily be obtained, manipulated or observed. In contrast many hydromedusae (including Clytia, Cytaeis, and Cladonema) have daily dark/light induced spawning and accessible gonads, so provide great material for studying oogenesis and maturation. Of these, Clytia has currently by far the most advanced molecular and experimental tools.

      Reviewer #2: The proteins MAPK is not introduced properly, as it is first mentioned in the results section in line 12. Given the importance of the results provided with it, it should be presented in the introduction prior to the results section.

      As requested by Reviewer #2, the involvement of MAPK activation during Xenopus oocyte meiotic maturation is now introduced, explaining how its phosphorylation serves as a marker of Cdk1 activation. Changes: Page 5, lines 1-5.

      Reviewer #2: These sentences need a more elaborate explanation: Page 4 Lines 16-17 "... no role for cAMP has been detected in meiotic resumption, which is mediated by distinct signaling pathways" Which pathways?

      We now give the example of the well-characterized pathway Gbg-PI3K pathway for oocyte maturation initiation in the starfish. Changes: Page 4, lines 1-15.

      Reviewer #2: Page 4 line 34-39. Introduction indicates that the phosphorylation of ARPP19 on S67 by Gwl is a poorly understood molecular signaling cascade (line 34). However, the positive role of ARPP19 on Cdk1 activation, through the S67 phosphorylation by Gwl, appears to be widespread across all eukaryotic mitotic and meiotic divisions studied (lines 36-37). These two sentences seem a little contradictory. If the general pathway has been identified but the signaling cascade is still not well described, please indicate that in a clearer way.

      We apologise that the wording we used was not clear and implied that the mechanisms of PP2A inhibition by Gwl-phosphorylated ARPP19 were poorly understood. On the contrary, they are very well studied. The part that remains mysterious concerns the upstream mechanisms. We have reworded the paragraph to make this point unambiguous. Changes: Page 5, lines 1-8.

      ____________IV - Results

      Reviewer #2: The text of the results is generally well described; however, all the sections start with a long introductory paragraph. I believe this facilitates the contextualization of the experiments, but please try to summarize when possible. For example, in page 5 lines 12-25, or page 7 lines 30-37, are all introduction information.

      As requested by Reviewer #2, we have shortened or removed the introductory passages of the Results section paragraphs, which were redundant with the information given in the introduction. We did not restrict to the two examples cited by the reviewer, but have shortened all the Results passages that repeat information already provided in the Introduction. Changes: Page 7, lines 3-4 & 14-16 & 36-37 - Page 8, lines 12-15 - Page 8, lines 37-40 & Page 9, lines 1-6.

      Reviewer #2: Page 7, Lines 14-19 present a general conclusion of the findings explained in lines 20-27. I think these results are important and they should be explained better, in my opinion they are slightly poorly described.

      We have followed the reviewer's recommendation. The explanation of the experiments and the results are more detailed and the paragraph ends with a general conclusion which came too early in the previous version. Changes: Page 8, lines 22-24 & 32-34.

      Reviewer #2: Page 8, lines 16-17: "It was not possible to increase injection volumes or protein concentrations without inducing high levels of non-specific toxicity". What are the non-specific toxicity effects? How was this addressed? What fundaments this conclusion?

      Clytia oocytes are relatively fragile. Sensitivity of oocytes to injection varies between batches, while in general increasing injection volumes or protein concentrations increases the levels of lysis observed. We do not know exactly what causes this but lysis can happen either immediately following injection or during the natural exaggerated cortical contraction waves that accompany meiotic maturation, suggesting that it relates to mechanical trauma. We have expanded this paragraph and the legend of Fig. 3C to explain these injection experiments more fully in the text and to clarify these issues. Changes: Page 9, lines 16-29 - Page 32, lines 34-41 & Page 33, lines 1-11 - Supplementary Table 1.

      Same paragraph: Lines 25-27 of page 8. Text reads, "These results suggest that PP2A inhibition is not sufficient to induce oocyte maturation in Clytia, although we cannot rule out that the quantity of OA or Gwl thiophosphorylated ARPP proteins delivered was insufficient to trigger GVBD.". Please provide evidence if higher concentrations of OA or Gwl were tested to state this conclusion.

      As explained above, we could not increase the concentrations of ARPP19 protein beyond 4mg/ml. It is important to note that at the same concentration, both Clytia and Xenopus proteins induce activation of Cdk1 and GVBD in the Xenopus oocyte.

      Concerning OA, it is well documented in many systems including Xenopus, starfish and mouse oocytes as well as mammalian cell cultures, that high concentrations lead to cell lysis/apoptosis as a result of a massive deregulation of protein phosphorylation (Goris et al, 1989; Rime & Ozon, 1990; Alexandre et al, 1991; Boe et al, 1991; Gehringer, 2004; Maton el al, 2005; Kleppe et al, 2015). Specific tests in Xenopus oocytes, have shown that injecting 50 nl of 1 or 2 mM OA specifically inhibits PP2A, while injecting 5 mM also targets PP1 and higher OA concentrations inhibit all phosphatases. For these reasons, we did not increase OA concentrations over 2 mM. When injected in Xenopus oocyte at 1 or 2 mM, OA induces Cdk1 activation, GVBD but then the cell dies because PP2A has multiple substrates essential for cell life. When injected at 2 mM in Clytia oocytes, OA does not induce Cdk1 activation nor GVBD but promotes cell lysis. This supports the conclusion that 2 mM OA is sufficient to inhibit PP2A (and possibly other phosphatases) but that PP2A inhibition is not sufficient to induce oocyte maturation in Clytia.

      We have reworded the relevant text to make these points clearer. The previous statement that “we cannot rule out that the quantity of OA or Gwl thiophosphorylated ARPP proteins delivered was insufficient to trigger GVBD” has been removed because it was unnecessarily cautious in the context of the literature cited above, as now fully explained_._ Changes: Page 9, lines 31-35 - Page 32, lines 34-41 & Page 33, lines 1-11 - Supplementary Table 1.

      References: Alexandre et al, 1991, doi: 10.1242/dev.112.4.971; Boe et al, 1991, doi: 10.1016/0014-4827(91)90523-w; Gehringer, 2004, doi: 10.1016/s0014-5793(03)01447-9; Goris et al, 1989, doi: 10.1016/0014-5793(89)80198-x; Kleppe et al, 2015, doi: 10.3390/md13106505; Maton el al, 2005, doi: 10.1242/jcs.02370; Rime & Ozon, 1990, doi: 10.1016/0012-1606(90)90106-s

      Reviewer #2: Lines 12-13: the sentence "This in vitro assay thus places S81 as the sole residue in ClyARPP19 for phosphorylation by PKA." is overstated. As not all residues had been tested, please indicate that "it is likely that" or "among the residues tested", in contrast to "the sole residue in ClyARPP19".

      We realise that we had not explained clearly enough how the thiophosphorylation assay works. In this assay, γ-S-ATP will be incorporated into any amino acid of ClyARPP19 phosphorylatable by PKA. The observed thiophosphorylation of the wild-type protein, demonstrates that one or more residues are phosphorylated by PKA. This thiophosphorylation was completely prevented by mutation of a single residue, S81. This experiment thus shows that S81 is entirely responsible for phosphorylation by PKA in this assay. We have rewritten this section more clearly. Changes: Page 10, lines 18-28.

      ____________V - Figures and text related to the figures

      Figure 1A

      Reviewer #2: Why is mouse not included in Figure 1A? Although it might be very similar to human, given that mouse is the species that is most commonly use as a mammalian model, I believe it could be included. However, this is optional upon decision by the authors.

      We have replaced the human sequence in Figure 1A with the mouse sequence as suggested. The sequences of each of the mouse and human ENSA/ARPP19 proteins are indeed virtually identical across mammals. Changes: Fig. 1A.

      Figure 1C

      Reviewer #2: There should be a better explanation in the text of the results sections for the image included in in Fig1 C. Note that Clytia is not a commonly used species, therefore images should be properly explained for general readers. Please indicate in the text that ClyARPP19 mRNA is expressed in previtellogenic oocytes and not in vitellogenic, plus any additional information needed to understand the image. In addition, the detection of ARPP19 in the nerve rings is intriguing. This is mentioned in the discussion section, any idea of its function there? Please include some additional information or additional references, if they exist.

      We have expanded the explanations of Fig. 1C in the text and in the figure legend. We have also added cartoons to the figure to help readers understand the organisation of the Clytia jellyfish and gonad. As now explained, ClyARPP19 mRNA is detected in oocytes at all stages, but the signal is much stronger in pre-vitellogenic oocytes because all cytoplasmic components including mRNAs are significantly diluted by high quantity of yolk proteins as the oocytes grow to full size. Changes: page 7, line 40 & page 8, lines 1-9 - Fig. 1C - Legend page 31, lines 19-31.

      Nothing is known about the function of ARPP19 in the Clytia nervous system. The only data linking ARPP19 and the nervous system concerns mammalian ARPP16, an alternatively spliced variant of ARPP19. ARPP16 is highly expressed in medium spiny neurons of the striatum and likely mediates effects of the neurotransmitter dopamine acting on these cells (Andrade et al, 2017; Musante et al, 2017). This point is included in the Discussion in relation to the hypothesis that PKA phosphorylation of ARPP19 proteins in animals first arose in the nervous system and only later was coopted into oocyte maturation initiation. Changes: page 16, lines 12-13 & 17-20 - page 19, lines 6-9.

      Figure 2A

      Reviewer #1: Fig. 2A (and similar plots in subsequent figures): is it really necessary to cut the x axis? Would it be possible to indicate the number of oocytes for each experiment (maybe in the legend in brackets)?

      As requested by reviewer #1, the x-axis is no longer cut. The number of oocytes for each experiment is now provided in the legend of Fig. 2A and in similar plots of Fig. 5A and 5D. Changes: Fig. 2A - Legends page 31, lines 37-38 (Fig. 2A), page 33, line 25 (Fig. 5A) - page 33, line 34 (Fig. 5D).

      Figure 2D-E (as well as Figure 6C-D and Figure 8B-C)

      Reviewer #1: Fig. 2D (and all similar plots below): I am lacking the discrete data points that were measured. Without these it is impossible to evaluate the fits. The half-times shown in 2E are somewhat redundant, and the information could be combined on a single plot.

      We added all the data points to the concerned plots: 2D, 6C and 8B. As recommended by reviewer #1, we combined on a single plot the phosphorylation levels and the half-times. 2D-E => 2D, 6C-D => 6C and 8B-C => 8B. Changes: Figs 2D, 6C and 8B - Legends page 32, lines 9-14 (Fig. 2D), page 34, lines 24-30 (Fig. 6C) - page 35, lines 13-18 (Fig. 8B).

      Figure 3A and 3B

      Reviewer #1: Fig. 3: why is the blot for PKA substrates cut into 3 pieces? It would be clearer to show the entire membrane.

      In western blot experiments using Clytia oocytes, the amount of material was limited so the membranes were cut into three parts. The central part was incubated sequentially in distinct antibodies. We finally incubated all three parts of the membrane with the anti-phospho-PKA substrate antibody to reveal the full spectrum of proteins recognized by this antibody. The 3 pieces in Fig. 3A therefore together make up the same original membrane. We had separated them on the figure to make it clear that the membrane had been cut. In the new presentation, the 3 pieces are shown next to each other, making it clear that all the membrane is present, with dotted lines indicating the cut zone as explained in the legend. Changes: Fig. 3A and 3B - Legend page 32, lines 22-25 (Fig. 3A), lines 30-33 (Fig. 3B) - Page 24, lines 3-6 (Methods).

      Figure 3C

      Reviewer #2: Fig. 3C needs a better explanation in the text. The way these graphs are presented is somehow confusing. The meaning of the dots is not self-explanted in the graph, and it seems that each experiment was done independently but then the complete set of results is presented. Legend says that "each dot represents one experiment" but this is difficult to read as in every analysis the figure also indicates the average and the total number of oocytes. If authors wish so, they can keep the figure as it is, but then please explain this graph better in the text, and please include statistical analysis. These results are very robust, but a comparison between the number of oocytes that go through spontaneous GVBD of lysis in the different conditions will benefit their understanding.

      This figure is intended to provide an overview of all the Clytia oocyte injection experiments that we performed, for which full details are given in Supplementary Table 1. Since these experiments were not equivalent in terms of exact timing and types of observation (or films) made and oocyte sensitivity to injection -as ascertained by buffer injections-, it is not justified to make statistical comparisons between groups. We apologise that the presentation was misleading in this respect and hope that the new version is easier to understand. We removed from the figure the average percentage of maturation for each condition between experiments to avoid any misunderstanding of the nature of the data, and rather represent the values of each experiment independently. We also now explain the data included in the figure fully in the text and figure legend. Changes: Page 9, lines 16-39 - Fig. 3C and Supplementary Table 1 - Legend page 32, lines 34-41 & page 33, lines 1-11.

      Reviewer #2: Also, please provide in the text a plausible explanation for the cause of oocyte lysis for all experimental conditions (Fig 3C). Given that in the control experiments with buffer this effect is also observed in some oocytes, please explain if this is caused by a mechanical disruption of the oocyte during the injection. In contrast, okadaic acid induces the lysis in all the 14/14 oocytes analyzed, is this due also to the mechanical approach? Or is there other reason more related to the PP2A inhibition? Please explain.

      These points are treated above in the response to this reviewer concerning the Results section.

      Figure 5

      Reviewer #2: In Figure 5 D-F, cited in page 9 lines 35-35. Can you provide an explanation of why the time course of meiosis resumption was delayed?

      The binding partners/effectors of XeARPP19-S109D that are involved in maintaining the prophase arrest have not yet been identified. The most probable explanation of the delay in meiotic maturation induced by ClyARPP19-S109D is that Clytia protein recognizes less efficiently these unknown ARPP19 effectors that mediate the prophase arrest. As a result, maturation would be delayed, but not blocked. This explanation was provided in the Discussion (page 17, lines 14-17) and is now mentioned in the Results section. Changes: page 11, lines 16-19.

      ____________VI - Discussion

      Reviewer #2: Although it presents highly interesting suggestions, discussion may border on being overly speculative, especially from line 37 of page 15 till the end.

      We agree and have reduced the speculation in this part of the discussion, in particular regrouping and reformulating ideas about evolutionary scenarios in a single paragraph. Changes: page 17, lines 37-41 - page 18, lines 1-41 - page 19, lines 1-18.

      SUMMARY - Point by point responses to individual reviewers’ comments in their order of appearance.

      Reviewer 1

      • The figures and text could be slightly condensed down to about 6 figures.

      We have reduced the number of figure panels but we prefer to maintain the number of figures, because the experimental data presented in them is essential to the interpretation of our results and the overall conclusions of the article. If the journal editor would like us to reduce the number of figures, we could do this by displacing Figure 4 and some panels of other figures (to then fuse some of them) to supplementary material, but this would be a pity.

      • The exact mechanisms responsible for the reduced effect of PKA phosphorylation remain relatively vaguely defined. Indeed, in their Discussion the authors list a number of experimental approaches to address this - but I understand that these would all involve substantial efforts to address. In particular, testing chimeric constructs around the consensus PKA site and from multiple species could be very informative.

      As the reviewer points out, unravelling these exact mechanisms will require a large amount of additional work and is beyond the scope of the current study.

      • 2A (and similar plots in subsequent figures): is it really necessary to cut the x axis? Would it be possible to indicate the number of oocytes for each experiment (maybe in the legend in brackets)?

      Fig. 2A has been changed in line with the reviewer's request (as well as similar plots in Fig. 5A and 5D). Changes: Fig. 2A - Legends page 31, lines 37-38 (Fig. 2A), page 33, line 25 (Fig. 5A) - page 33, line 34 (Fig. 5D).

      • 2D (and all similar plots below): I am lacking the discrete data points that were measured. Without these it is impossible to evaluate the fits. The half-times shown in 2E are somewhat redundant, and the information could be combined on a single plot.

      Fig. 2D has been changed in line with the reviewer's request (as well as similar plots in Figs 6C-D and 8B-C). Changes: Fig. 2D, 6C and 8B - Legends page 32, lines 9-14 (Fig. 2D), page 34, lines 24-30 (Fig. 6C) - page 35, lines 13-18 (Fig. 8B).

      • 3: why is the blot for PKA substrates cut into 3 pieces? It would be clearer to show the entire membrane.

      In western blot experiments using Clytia oocytes, the amount of material was limited so the membranes were cut into three parts. The central part was incubated sequentially in distinct antibodies. We finally incubated all three parts of the membrane with the anti-phospho-PKA substrate antibody to reveal the full spectrum of proteins recognized by this antibody. The 3 pieces in Fig. 3A therefore together make up the same original membrane. In the new presentation, the 3 pieces are shown next to each other, making it clear that all the membrane is present, with dotted lines indicating the cut zone as explained in the legend. Changes: Fig. 3A and 3B - Legend page 32, lines 22-25 (Fig. 3A), lines 30-33 (Fig. 3B) - Page 24, lines 3-6 (Methods).

      Reviewer 2

      • Abstract needs to be simplified if wants to reach a broader range of readers.

      We have reworked the Abstract to make it more accessible to new readers. Changes: Page 2.

      • It would be interesting to include some time-references when introducing the prophase arrest of Clytia and Xenopus oocytes. This should be indicated in the introduction with a short introduction of why, and not others, were these species chosen for this study.

      We have expanded the Introduction to cover the issue of time-references. Fuller details are now included about the advantages of Clytia compared to other hydrozoan species. Changes: Page 3, lines 5-11, page 4, lines 28-35, page 5, lines 32-33, page 5, lines 21-32 & 37-39.

      • The proteins MAPK is not introduced properly, as it is first mentioned in the results section.

      The involvement of MAPK activation during Xenopus oocyte meiotic maturation is now introduced. Changes: Page 5, lines 1-5.

      • Page 4 Lines 16-17 "... no role for cAMP has been detected in meiotic resumption, which is mediated by distinct signaling pathways" Which pathways?

      We now give the example of the well-characterized pathway Gbg-PI3K pathway for oocyte maturation in starfish, also mentioning that in many species the pathways are still unknown. Changes: Page 4, lines 1-15.

      • Page 4 line 34-39. Introduction indicates that the phosphorylation of ARPP19 on S67 by Gwl is a poorly understood molecular signaling cascade (line 34). However, the positive role of ARPP19 on Cdk1 activation, through the S67 phosphorylation by Gwl, appears to be widespread across all eukaryotic mitotic and meiotic divisions studied (lines 36-37). These two sentences seem a little contradictory.

      The mechanisms of PP2A inhibition by Gwl-phosphorylated ARPP19 are very well studied. The part that remains mysterious concerns the upstream mechanisms. We have reworded the paragraph to make this point unambiguous. Changes: Page 5, lines 1-8.

      • Why is mouse not included in Figure 1A?

      We have replaced the human sequence in Figure 1A with the mouse sequence. Changes: Fig. 1A.

      • 1C: There should be a better explanation in the text of the results sections for the image included in in Fig1 C. Please indicate in the text that ClyARPP19 mRNA is expressed in previtellogenic oocytes and not in vitellogenic.

      We have expanded the explanations of Fig. 1C in the text. We have also added cartoons to the figure to help readers understand the organisation of the Clytia jellyfish and gonad. As now explained, ClyARPP19 mRNA is detected in oocytes at all stages, but the signal is much stronger in pre-vitellogenic oocytes because all cytoplasmic components are significantly diluted by high quantity of yolk proteins. Changes: page 7, line 40 & page 8, lines 1-9 - Fig. 1C - Legend page 31, lines 19-31.

      • In addition, the detection of ARPP19 in the nerve rings is intriguing. Any idea of its function there?

      The only data linking ARPP19 and the nervous system concerns a mammalian variant of ARPP19 that is highly expressed in the striatum. This point is included in the Discussion_. Changes: page 16, lines 12-13 & 17-20 - page 19, lines 6-9._

      • Figure 3C. The way these graphs are presented is somehow confusing. If authors wish so, they can keep the figure as it is, but then Also, please provide in the text a plausible explanation for the cause of oocyte lysis for all experimental conditions. please explain this graph better in the text, and please include statistical analysis.

      This figure is intended to provide an overview of all the Clytia oocyte injection experiments, for which full details are given in Supplementary Table 1. We have modified the figure and now clarified this fully in the text and figure legend. Clytia oocytes are relatively fragile. Sensitivity of oocytes to injection varies between batches, while in general increasing injection volumes or protein concentrations increases the levels of lysis observed. We do not know exactly what causes this but it probably relates to mechanical trauma. We now explain these injection experiments more fully in the text. Changes: Page 9, lines 16-39 - Fig. 3C and Supplementary Table 1 - Legend page 32, lines 34-41 & page 33, lines 1-11.

      • In Figure 5 D-F, cited in page 9 lines 35-35. Can you provide an explanation of why the time course of meiosis resumption was delayed?

      The most probable explanation is that Clytia protein recognizes less efficiently the unknown ARPP19 effectors that mediate the prophase arrest in Xenopus. This explanation is provided in the Results section. Changes: page 11, line 16-19.

      • All the sections start with a long introductory paragraph. I believe this facilitates the contextualization of the experiments, but please try to summarize when possible.

      As requested, we have shortened or removed the introductory passages of the Results section paragraphs, which were redundant with the information given in the introduction. Changes: Page 7, lines 3-4 & 14-16 & 36-37 - Page 8, lines 12-15 - Page 8, lines 37-40 & Page 9, lines 1-6.

      • Page 7, Lines 14-19 present a general conclusion of the findings explained in lines 20-27. I think these results are important and they should be explained better, in my opinion they are slightly poorly described.

      The explanation of the experiments and the results are now more detailed and the paragraph ends with a general conclusion which came too early in the previous version. Changes: Page 8, lines 22-24 & 32-34.

      • Page 8, lines 16-17: "It was not possible to increase injection volumes or protein concentrations without inducing high levels of non-specific toxicity". What are the non-specific toxicity effects? How was this addressed? What fundaments this conclusion?

      As explained above, increasing injection volumes or protein concentrations increases the levels of lysis observed due probably to mechanical trauma. But it is important to note that at the same concentration, both Clytia and Xenopus proteins induce activation of Cdk1 and GVBD in the Xenopus oocyte. Changes: Page 9, lines 16-29 - Page 32, lines 34-41 & Page 33, lines 1-11 - Supplementary Table 1.

      • Lines 25-27 of page 8. "These results suggest that PP2A inhibition is not sufficient to induce oocyte maturation in Clytia, although we cannot rule out that the quantity of OA or Gwl thiophosphorylated ARPP proteins delivered was insufficient to trigger GVBD." Please provide evidence if higher concentrations of OA or Gwl were tested to state this conclusion.

      High OA concentrations lead to cell lysis/apoptosis as a result of a massive deregulation of protein phosphorylation. For these reasons, we cannot increase OA concentrations over 2 µM. When injected in Xenopus oocyte at 1 or 2 µM, OA induces Cdk1 activation, but then the cell dies because PP2A has multiple substrates essential for cell life. When injected at 2 µM in Clytia oocytes, OA does not induce Cdk1 activation but promotes cell lysis. This supports the conclusion that 2 µM OA is sufficient to inhibit PP2A but that PP2A inhibition is not sufficient to induce oocyte maturation in Clytia. We have reworded the relevant text. Changes: Page 9, lines 31-35 - Page 32, lines 34-41 & Page 33, lines 1-11 - Supplementary Table 1.

      • Lines 12-13: the sentence "This in vitro assay thus places S81 as the sole residue in ClyARPP19 for phosphorylation by PKA." is overstated. As not all residues had been tested, please indicate that "it is likely that" or "among the residues tested", in contrast to "the sole residue in ClyARPP19".

      The observed thiophosphorylation of the wild-type protein demonstrates that one or more residues are phosphorylated by PKA. This thiophosphorylation was completely prevented by mutation of a single residue, S81. This experiment thus shows that S81 is entirely responsible for phosphorylation by PKA in this assay. We have rewritten this section more clearly. Changes: Page 10, lines 18-28.

      • Some parts of the discussion are a bit speculative.

      We have reduced the speculation in this part of the discussion, in particular regrouping and reformulating ideas about evolutionary scenarios into a single paragraph. Changes: page 17, lines 37-41 - page 18, lines 1-41 - page 19, lines 1-18.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary of the main findings of the study.

      This work presents very interesting data about the maintenance and release of the prophase arrest of oocytes during sexual reproduction. Authors approach some of the remaining questions about oocyte maturation in animals by taking a comparative approach between two species (Clytia and Xenopus) that use opposing cAMP/PKA signaling pathways to trigger oocyte maturation. To do it they focused on phosphorylation characteristics and function of the regulatory protein ARPP19 from the amphibian Xenopus and its orthologue in the hydrozoan Clytia. Results suggest that the low capacity of Clytia ARPP19 to be phosphorylated by PKA. Moreover, Clytia ARPP19 is inherently a poorer PKA substrate than Xenopus ARPP109 both in vivo and in vitro, despite the presence of a functional PKA site. In addition, the absence of functional interactors mediating its negative effects on Cdk1 activation may provide a double security allowing induction of meiosis resumption in Clytia by elevated PKA activity despite the presence of ARPP19, while additional and yet unidentified mechanisms ensure the Clytia oocyte prophase arrest.

      Minor comments: read detailed review below. Figure 1 and Figure 3 need a better explanation of the results. Abstract needs to be simplified if wants to reach a broader range of readers. Some parts of the discussion are a bit speculative.

      Overall, this work used a robust set of molecular experiments that strongly support the conclusions of the study.

      Significance

      Strengths and limitations of this work:

      The primary strength of this work lies in its innovative use of two distinct species and the integration of molecular experiments to extract conclusions from their different signaling pathways. The well-designed and executed experiments, particularly those of figures 5-9, contribute to an elaborated exploration of the topic, elucidating the underlying mechanisms with clarity. The explanation of each experiment in the results section further adds to the clarity and depth of the study.

      The abstract requires improvement, particularly from lines 10 to 21, as it becomes fully understood only after reading the entire manuscript. To make the work more accessible to new readers, it would be good to present the abstract in a more approachable manner. Figures 1C and 3C need a better explanation in the text. Additionally, some sentences would benefit from citations or further clarification in the results or discussion section. Although is presents highly interesting suggestions, discussion may border on being overly speculative, especially from line 37 of page 15 till the end.

      Detailed review

      Introduction:<br /> I believe that it would be interesting to include some time-references when introducing the prophase arrest of Clytia and Xenopus oocytes. How long is prophase arrest in Xenopus compared to Clytia or other organisms? How can this affect the prophase arrest mechanisms? It seems that the prophase arrest in Xenopus oocytes is found to be significantly more prolonged compared to Clytia and various other organisms, and also meiotic maturation proceeds much more rapidly in Clytia than in Xenopus. This should be indicated in the introduction with a short introduction of why, and not others, were these species chosen for this study. A brief justification is included in lines 1-page 5 "..a laboratory model hydrozoan species well suited to oogenesis studies", but it does not explain why this and not other hydrozoan species like Hydra, that has also been used for meiosis studies.<br /> The proteins MAPK is not introduced properly, as it is first mentioned in the results section in line 12. Given the importance of the results provided with it, it should be presented in the introduction prior to the results section.

      These sentences need a more elaborate explanation:<br /> Page 4 Lines 16-17 "... no role for cAMP has been detected in meiotic resumption, which is mediated by distinct signaling pathways" Which pathways?

      Page 4 line 34-39. Introduction indicates that the phosphorylation of ARPP19 on S67 by Gwl is a poorly understood molecular signaling cascade (line 34). However, the positive role of ARPP19 on Cdk1 activation, through the S67 phosphorylation by Gwl, appears to be widespread across all eukaryotic mitotic and meiotic divisions studied (lines 36-37). These two sentences seem a little contradictory. If the general pathway has been identified but the signaling cascade is still not well described, please indicate that in a clearer way.

      Results section: this review will first comment the figures, and then the text.<br /> Figure 1<br /> Why is mouse not included in Figure 1A? Although it might be very similar to human, given that mouse is the species that is most commonly use as a mammalian model, I believe it could be included. However, this is optional upon decision by the authors.<br /> There should be a better explanation in the text of the results sections for the image included in in Fig1 C. Note that Clytia is not a commonly used species, therefore images should be properly explained for general readers. Please indicate in the text that ClyARPP19 mRNA is expressed in previtellogenic oocytes and not in vitellogenic, plus any additional information needed to understand the image. In addition, the detection of ARPP19 in the nerve rings is intriguing. This is mentioned in the discussion section, any idea of its function there? Please include some additional information or additional references, if they exist.

      Figure 3<br /> The way these graphs are presented is somehow confusing. The meaning of the dots is not self-explanted in the graph, and it seems that each experiment was done independently but then the complete set of results is presented. Legend says that "each dot represents one experiment" but this is difficult to read as in every analysis the figure also indicates the average and the total number of oocytes. If authors wish so, they can keep the figure as it is, but then please explain this graph better in the text, and please include statistical analysis. These results are very robust, but a comparison between the number of oocytes that go through spontaneous GVBD of lysis in the different conditions will benefit their understanding.

      Also, please provide in the text a plausible explanation for the cause of oocyte lysis for all experimental conditions (Fig 3C). Given that in the control experiments with buffer this effect is also observed in some oocytes, please explain if this is caused by a mechanical disruption of the oocyte during the injection. In contrast, okadaic acid induces the lysis in all the 14/14 oocytes analyzed, is this due also to the mechanical approach? Or is there other reason more related to the PP2A inhibition? Please explain.

      Figure 5<br /> In Figure 5 D-F, cited in page 9 lines 35-35. Can you provide an explanation of why the time course of meiosis resumption was delayed?

      • The text of the results is generally well described; however, all the sections start with a long introductory paragraph. I believe this facilitates the contextualization of the experiments, but please try to summarize when possible. For example, in page 5 lines 12-25, or page 7 lines 30-37, are all introduction information.<br /> Page 7, Lines 14-19 present a general conclusion of the findings explained in lines 20-27. I think these results are important and they should be explained better, in my opinion they are slightly poorly described.

      Page 8, lines 16-17: "It was not possible to increase injection volumes or protein concentrations without inducing high levels of non-specific toxicity". What are the non-specific toxicity effects? How was this addressed? What fundaments this conclusion?

      Lines 25-27 of page 8. Text reads, "These results suggest that PP2A inhibition is not sufficient to induce oocyte maturation in Clytia, although we cannot rule out that the quantity of OA or Gwl thiophosphorylated ARPP proteins delivered was insufficient to trigger GVBD.". Please provide evidence if higher concentrations of OA or Gwl were tested to state this conclusion.

      Lines 12-13: the sentence "This in vitro assay thus places S81 as the sole residue in ClyARPP19 for phosphorylation by PKA." is overstated. As not all residues had been tested, please indicate that "it is likely that" or "among the residues tested", in contrast to "the sole residue in ClyARPP19".

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      In their present manuscript Meneau and coworkers investigate the evolutionary conserved functions of ARPP19 in regulation of meiotic maturation of oocytes. During meiotic maturation, the maturation hormone induces a signaling cascade ultimately leading to the activation of the master regulator, cdk1-cyclin B. within this signaling network, the phosphatase PP2A prevents cdk1 activation in immature oocytes. Upon the action of the maturation hormone, ARPP19 is activated through phosphorylation by the kinase Gwl, and then functions as a potent inhibitor of PP2A, thereby contributing to cdk1 activation. Additionally, ARPP19 is subject to a second layer of regulation: a second site is phosphorylated by the kinase PKA. Interestingly, in vertebrates this cAMP/PKA pathway prevents maturation, while in many other species the same pathway has an opposite effect and cAMP/PKA is indeed sufficient to drive maturation -- referred to as the cAMP paradox.

      The authors' major aim was to reveal the molecular basis of these diverse functions of ARPP19 in triggering meiotic maturation. Firstly, they show that the Gwl site is extremely well-conserved all across eukaryotes. They then functionally validate this by comparing the functions of Xenopus ARPP19 to its orthologue in the jellyfish Clytia hemisphaerica. They confirm that the jellyfish ARPP19 is phosphorylated on the conserved Gwl site in vitro and in frog and jellyfish oocytes, acting as a PP2A inhibitor and contributing to cdk1 activation. However, while this is sufficient to drive maturation in Xenopus, PP2A inhibition alone is not sufficient to trigger entry to meiosis in Clytia oocytes, indicating the existence of additional mechanisms. Secondly, they show that the PKA site exists and is phosphorylated both in Xenopus and Clytia. However, the Clytia protein appears to be a much worst substrate for PKA and other interactors, which explains why PKA-phosphorylated ARPP19 does not inhibit maturation either in jellyfish oocytes or when exogenously injected into Xenopus oocytes.

      I find the manuscript well-written and easy to follow. The experiments are carefully performed, well-controlled and well-documented. The data shown on the figures fully supports the conclusions drawn -- although the figures and text could be slightly condensed down to about 6 figures. Overall, I would highly recommend the manuscript for publication.

      My main criticism is unfortunately inherent to the approach: comparative studies are absolutely critical, but they can only provide a very sparse sampling of diversity. Fortunately, thanks to high-throughput sequencing, bioinformatic analyses can now be performed on a large number of species, but experimental validation is typically restricted to two or three species. The consequence of this for the present manuscript is that while the functional conservation of the Gwl site is convincingly shown, the exact mechanisms responsible for the reduced effect of PKA phosphorylation remain relatively vaguely defined. Indeed, in their Discussion the authors list a number of experimental approaches to address this - but I understand that these would all involve substantial efforts to address. In particular, testing chimeric constructs around the consensus PKA site and from multiple species could be very informative.

      In addition, I would have a few small suggestions for improving the figures:

      • Fig. 2A (and similar plots in subsequent figures): is it really necessary to cut the x axis? Would it be possible to indicate the number of oocytes for each experiment (maybe in the legend in brackets)?
      • Fig. 2D (and all similar plots below): I am lacking the discrete data points that were measured. Without these it is impossible to evaluate the fits. The half-times shown in 2E are somewhat redundant, and the information could be combined on a single plot.
      • Fig. 3: why is the blot for PKA substrates cut into 3 pieces? It would be clearer to show the entire membrane.

      Significance

      Overall, I find this study extremely important, because it is only possible to entangle the diversity of cellular mechanisms though such comparative studies. Oocyte maturation perfectly exemplifies this issue: without doubt, oocyte maturation is a fundamental process and its detailed understanding is critical. However, researchers are often discouraged by diversity across species, which indeed complicates and hinders progress, well-reflected by the name "cAMP paradox". Combined with careful bioinformatic analyses, comparative studies can elegantly resolve such "paradoxes" through resolving the evolutionary history of molecular mechanisms.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In this interesting paper Bideau et al. report an antero-posterior gradient in the plasticity of tail tissues during tail regeneration in the annelid worm Platynereis dumerilii. The experiments are well designed and thoroughly quantified, the figures are of high quality.

      Major comments:

      The microscopic images lack scale bars. These should be added to all figures.

      The authors should provide the source data for all quantifications as txt files. They should also provide as supplement representative confocal stacks for the various stainings.

      The authors use LatrunculinB treatment to investigate the role of cell migration in regeneration. However, since LatB inhibits f-actin, it could also interfere with cell proliferation and other processes. The authors should check if this is the case and provide control data.

      Minor comments:

      Sometimes the language is a bit quite cryptic. For example, the title of Figure 4 is "Cell proliferation and migration, as well as tissue maturity modulate the plasticity of posteriorized gut progenitors through regeneration"<br /> in short: 'cell migration modulates the plasticity of progenitors' - this is just to say that inhibiting cell migration reduces regeneration

      The authors should attempt to simplify the language.

      Language:

      "is an tremendous and essential process in animals" - not clear what 'tremendous' means here - please revise

      "Those regeneration processes have been studied from a long" - for a long time

      "more EdU+ cells in S1 than in S6 or S7 regardless the EdU incubation time" - regardless of the

      "It showed that the gut is composed of" - The stainings showed that

      "Indeed, cell labelled with a rather short EdU" - cells labelled

      "tissues plays a major role on the reformation" - in the formation

      The paper will be of interest to animal developmental biologists and scientists working on the plasticity of tissues during regeneration.

      Referees cross-commenting

      I agree with the comments made by the other reviewers. The authors need to be more clear and careful in interpreting their data. I don't think that new data are needed (unless they would like to demonstrate a 'gradient' with more positions) and the comments could be addressed by substantially rewriting the text and revising the claims.

      Significance

      The paper will be of interest to animal developmental biologists and scientists working on the plasticity of tissues during regeneration.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Bideau et al. studied the origin, plasticity and fate of the cells participating in blastema formation during posterior regeneration in the annelid Platynereis dumerilii. To label and track the fate of proliferative cells, the authors applied EdU/BrDU incorporation coupled with mRNA in situ hybridization and fluorescent beads labelling, on a wide array of regeneration assays. They also performed drug treatments to assess the role of proliferation and cell migration during posterior regeneration. Interestingly, the Authors showed that some proliferative gut cells can participate in the formation of ectodermal and mesodermal tissues during regeneration, in case of two successive posterior regeneration events, suggesting that gut cycling cells residing in a regenerating segment are more plastic than those located in a non-regenerating segment. They also suggested the existence of two different cell populations - "slowly" and "quickly" cycling cells - acting during regeneration. Overall, the experiments are well presented, and methods clearly described. The Authors concluded that posterior regeneration in Platynereis relies on a gradient of cell plasticity and cell proliferation, along the antero-posterior axis of the animal.

      Major comments

      Two of the main conclusions of this study are, in my opinion, not supported by the data:

      As indicated in the title of the manuscript, the Authors put forward a cellular model for posterior regeneration relying on gradients of cell proliferation, cell differentiation and cell plasticity along the the antero-posterior axis of the animal. I am not convinced that the Authors have provided strong enough evidence to prove any of these gradients. They showed that there are differences between the region directly adjacent the most posterior segment and a region located more anteriorly (6 or 7 segments from the posterior end). However, by comparing only two positions, they cannot distinguish between graded or clearly regionalized contexts. To prove the existence of a gradient along the animal's antero-posterior axis, the authors would need to compare cell proliferation, cell dynamics and cell differentiation between multiple regions at increasing anterior positions, and show that their responses are indeed graded. This would represent a quite substantial amount of work. Instead, I would suggest removing the reference to a gradient in the paper entirely.

      Using "short" (5h) and "long" (48h) EdU pulses, the Authors claim they have established the existence of two cell populations, namely "slowly-cycling cells" and "quickly-cycling cells" (first paragraph of the result section - pages 5/6 "We exposed uninjured worms to EdU, either for 5 or 48h to discriminate quickly-cycling cells from cells harboring a slower replication rate"). I am not convinced that the Authors provide strong enough evidence to demonstrate the existence of two such cell populations. Given that about 20% of cells incorporated EdU after 5h of exposure, that almost all of them have done so after 48h, and that only a fraction of proliferative cells are in S-phase at any given time, it is well possible that a majority of cells stained after 5h and 48h are from the same cell cycling population. To show the existence of different populations of cells, cycling at different rates, the Authors would need to compare staining after an equal EdU exposure time, following a period of chase of different duration. Without this set of experiments, I would refrain from distinguishing between several slower and faster cell cycling populations.

      Minor comments

      Page 1. Please correct "is an tremendous" into "is a tremendous".

      Page 7. "The huge majority of the EdU+ cells colocalize with FoxA". Please provide quantification.

      Page 11 "Quickly-cycling gut progenitors.... cannot give rise to neural progenitors and probably not to stem cells from the ectodermal growth zone"; Page 12 "cannot regenerate neural tissues"; Page 20 "posterior gut progenitors cannot produce nervous system or putative posterior stem cells". What the authors show in their experiments, is that labeled gut cycling cells likely do not generate neural cells or stem cells, in the assessed context. However, the Authors do not show that those cells 'cannot' do so. Please rephrase.

      Page 11. "migration, through actin polymerization (LatrunculinB or LatB) widely used inhibitors". Please add a reference to justify the use of LatB as a cell migration inhibitor.

      Significance

      This is a thorough, well executed and interesting study on a tractable annelid regeneration model. The experiments are neatly performed and the manuscript reads well. As stated in my major comments, two of the main conclusions of the study (gradient of cell proliferation/plasticity/differentiation; identification of two types of progenitors differing in their cell cycle rates) have not been demonstrated properly and would need to be either strengthened or deleted from the manuscript. Several other findings, notably the increased plasticity of cells that recently participated in posterior regeneration (notably gut cells) are well demonstrated and of interest. Overall, this manuscript significantly advances our understanding of the cellular mechanisms that occur during posterior regeneration in Platynereis. It will be of interest to anyone working on comparative regeneration, but may be of lesser interest to researchers working outside this field.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Bideau et al. describe posterior regeneration in the annelid Platynereis. The authors aimed to identify patterns of proliferative cells. Pulse-chase and double labeling by EdU/BrdU was used to track cells. Finally, they attempted to reveal the identity of cycling cells and their contribution to regeneration. Platynereis is a relatively new regeneration model. Understanding the cellular source of regeneration in this annelid would be of considerable interest.

      The authors performed EdU labeling of intact worms to find a posterior-anterior decreasing gradient of S-phase cells. Histological sections showed that proliferative cells are located in all tissues in the posterior-most segment, but mostly restricted to the gut epithelium in more anterior segments. Using fluorescent beads that are taken up specifically by gut epithelial cells, they show that gut epithelial cells of the intact animal contribute only to gut regeneration, i.e., they are lineage restricted. The authors also performed immunostaining and mRNA in situ hybridization experiments to better understand the tissue identity of proliferative cells.

      The following are my specific comments:

      1. I am not sure I understand how the authors identify slow- or fast-cycling cells. EdU gets incorporated in S-phase; the longer the incubation time the more cells will be labeled until saturation is reached. The length of the cell cycle and the number of different populations cannot be directly derived from this experiment. I think it would be fair to conclude that there are more cycling cells in posterior segments and in the gut of anterior segments but the conclusion of two distinct populations is unsupported in my opinion.
      2. The Results and Discussion sections will have to be revised to address the above issue. The two supported conclusions are (1) the gradient of proliferative cells (but w/o reference to the number of distinct populations); (2) the fate-restricted nature of gut epithelial cells. The plasticity gradient is unsupported because worms can regenerate if amputated at segment #5. This suggests the presence of either resident stem cells (with broad potential or lineage-specific), cells that can dedifferentiate, or a combination of both. The authors' experiments cannot discriminate between the alternatives.
      3. The text would benefit from copy editing to improve the language and making it more accessible. In its current form, it is rather difficult to read, with descriptions of experiments that are not easy to follow.
      4. The figures and their legends can be improved. Re the legends, one has to read the full text to understand what each panel shows. The figures are very complex. It would already be easier if usage of A', A', A' was avoided. The figures could also be improved by direct annotation. Finally, consider simplifying the main figures and moving some material to the supplement.
      5. How do the authors know that proliferative cells in the gut are "gut progenitors"? They might simply be proliferative gut epithelial cells.
      6. The conclusions drawn from the drug experiments are overstated.

      Referees cross-commenting

      The comments made by the two other reviewers are complementary to mine. Either the authors extensively revise the text to remove unsupported conclusions or they perform additional experiments.

      Significance

      Little is known about the cellular basis of Platynereis posterior regeneration.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We thank the Reviewers for their helpful and constructive comments. In response to these suggestions we have performed new experiments and amended the manuscript, as we describe in our detailed response below.

      Reviewer #1:

      1. The Reviewer notes that while our analysis of centrosome size was comprehensive, we provided no analysis of centrosomal MTs, pointing out that while centrosome size declines as the embryos enter mitosis, the ability of centrosomes to organise MTs might not. This is a good point, and we now provide an analysis of centrosomal-MT behaviour (Figure 2). We find that there is a dramatic decline in centrosomal MT fluorescence at NEB, although the pattern of centrosomal MT recruitment prior to NEB is surprisingly complex.

      2. The Reviewer questions how PCM client proteins can be recruited in different ways by the same Cdk/Cyclin oscillator. We apologise for not explaining this properly. It is widely accepted that Cdk/Cyclins drive cell cycle progression, in part, by phosphorylating different substrates at different activity thresholds (e.g. Coudreuse and Nurse, Nature, 2010; Swaffer et al., Cell, 2016). Moreover, it is also clear that Cdk/Cyclins can phosphorylate the same protein at different sites at different activity thresholds (e.g. Koivomagi et al., Nature, 2011; Asafa et al., Curr. Biol., 2022; Ord et al., Nat. Struct. Mol. Biol., 2019). Thus, we hypothesise that rising Cdk/Cyclin cell cycle oscillator (CCO) activity phosphorylates multiple proteins at different times and/or at different sites to generate the complicated kinetics of centrosome growth. We now explain this point more clearly throughout the manuscript.

      3. The Reviewer is puzzled as to how we conclude that Cdk/Cyclins phosphorylate Spd-2 and Cnn at all the potential Cdk/Cyclin phosphorylation sites we mutate in our study. The Reviewer is right that we cannot make this conclusion, and we did not intend to make this claim. As we now clarify (p11, para.1), although it is unclear if Cdk/Cyclins phosphorylate Spd-2 or Cnn on all, some, or none of these sites, if either protein can be phosphorylated by Cdk/Cyclins, then these mutants should not be able to be phosphorylated in this way—allowing us to address the potential significance of any such phosphorylation. We now also note that several of these sites have been shown to be phosphorylated in embryos in Mass Spectroscopy screens (Figure S6).

      4. The Reviewer highlights differences in how Spd-2 and Cnn help recruit γ-tubulin to centrosomes (Figure 6). They ask for a more detailed description, and are puzzled as to how this is compatible with direct regulation by a single oscillator. We now explain our thinking on this important point in much more detail. It appears that Spd-2 helps recruit γ-tubulin throughout S-phase, while Cnn has a more prominent role in late S-phase (Figure 6). This is consistent with our overall hypothesis of CCO regulation, as we postulate that low-level CCO activity promotes the Spd-2/γ-tubulin interaction in early S-phase, while higher CCO activity promotes the Cnn/γ-tubulin interaction in late-S-phase, potentially explaining the increase in the rate of γ-tubulin (but not γ-TuRC) recruitment we observe at this point (see minor comment #1, below, for an explanation of the various γ-tubulin complexes in flies). This is consistent with recent literature showing that CCO activity promotes γ-tubulin (but not γ-TuRC) recruitment by Cnn/SPD-5 in worms and flies (Ohta et al., 2021; Tovey et al., 2021).

      5. The Reviewer was not convinced by our model (Figure 8, now Figure 9), raising two major concerns. First, they were unsure how a single oscillator could generate different patterns of protein recruitment. We addressed this in point #2 and #4, above, where we explain how different thresholds of CCO activity trigger different events, so there is no expectation that we should observe steady changes in recruitment over time as CCO activity rises. Second, they questioned how modest levels of Cdk/Cyclin activity can promote recruitment, while high levels of activity can inhibit recruitment. In point #1, above, we cite several examples where such positive and negative regulation by different Cdk/Cyclin activity levels have been described. We also now explain throughout the manuscript why this hypothesis provides a plausible explanation for our results: with moderate CCO activity promoting Spd-2-dependent PCM-client recruitment in early S-phase; higher CCO activity promoting a decrease in Spd-2 recruitment in mid-late-S-phase (so centrosomal Spd-2 levels decline); and even higher levels of CCO activity leading to a decrease in the interactions between the client proteins and the Spd-2/Cnn scaffold as the embryos enter mitosis (so the client proteins are rapidly released from the centrosome).

      The Reviewer also raised the important point here that our model does not explain why the mutant forms of Spd-2 and Cnn accumulate to higher levels at the start of S-phase, and not just at the end of S-phase/entry into mitosis. We apologise for not explaining this properly. The accumulation of the mutant proteins (particularly Spd-2, Figure 5C) in early-S-phase occurs because the excess mutant protein that accumulates at centrosomes in _late-_S-phase/mitosis is not removed properly from centrosomes during mitosis (presumably because there is insufficient time). Thus, centrosomes still have too much mutant Spd-2 at the start of the next S-phase. We show this in Reviewer Figure 1 (attached to this letter), which tracks Spd-2 behaviour further into mitosis, and now explain this in more detail in the text (p12, para.1).

      1. The Reviewer questions how the CCO can both induce centrosome growth and also switch it off, as it is unclear how an oscillator that only phosphorylates sites to decrease centrosome binding could also promote growth. They ask if we can identify and mutate any Cdk/Cyclin sites in centrosome proteins that promote centrosome recruitment. As we now clarify, we did not intend to claim that the CCO only phosphorylates sites that decrease the centrosome binding of proteins, although we do hypothesise that such phosphorylation is important for switching off centrosome growth in mitosis. In addition, we hypothesise that moderate levels of CCO initially promote centrosome growth, and our data suggests that the CCO does this, at least in part, by promoting Polo recruitment (Figure 8). We speculate that the CCO phosphorylates specific Polo-box-binding sites in Ana1 and Spd-2, the main proteins that recruit Polo to centrioles. We agree that identifying these sites is an important next step, but it is complicated as our studies indicate that multiple sites contribute in a complex manner. Importantly, it is well established that the CCO triggers centrosome growth as cells prepare to enter mitosis, so our hypothesis that moderate levels of CCO activity initiate centrosome growth is not new or controversial.

      Minor Comments

      1. The reviewer asks how we explain the different incorporation profiles we observe for the different subunits of the γ-tubulin ring complex. We apologise for not discussing this point. In flies there is a “core” γ-tubulin-small complex (γ-TuSC) and a larger γ-tubulin-ring complex (γ-TuRC) that contains the Grip71, Grip75 and Grip128 subunits we analyse here (Oegema et al., JCB, 1999). The γ-TuSC functions independently of the γ-TuRC so γ-tubulin and γ-TuRC components can behave differently.

      2. The Reviewer questions why we claim an “inverse-linear” relationship between S-phase length and the centrosome growth rate when the relationship is not linear (Figure 3, now Figure S3). I was originally confused by this as well but, mathematically, a linear relationship means y is proportional to x, whereas an inverse-linear relationship means y is proportional to 1/x. Thus, an inverse-linear relationship between x and y does not plot as a straight line, but rather as the curves we show on the graphs. We now explain this in text (p9, para.2).

      Reviewer #2:

      This Reviewer found the manuscript hard to follow, so we are very grateful that they took the time to try to understand it. We agree that the subject matter is complicated, and that our presentation was not always helpful. The Reviewer’s comments have been very useful in helping us to identify (and hopefully improve) areas of particular difficulty.

      Major points:

      1. The Reviewer highlights that the two experimental approaches underpinning our main conclusions are problematic: (1) Experiments with mutants of Spd-2 and Cnn that theoretically cannot be phosphorylated by Cdk/Cyclins are hard to interpret as these mutations may have other effects; (2) It is unclear whether reducing Cyclin B levels reduces peak CDK activity or simply slows the time it takes to reach peak levels. They suggest a more direct test of our model would be to analyse PCM recruitment in embryos arrested in S-phase or mitosis. (1) We agree that the mutations designed to prevent Cdk/Cyclin phosphorylation could perturb function in other ways, but this is true for any such mutation, and there are many papers that infer a function for Cdk/Cyclin phosphorylation from such experiments. Importantly, the centrosomal accumulation of the phospho-null mutants actually slightly increases compared to WT (Figure 5C and I), and we now show that the centrosomal accumulation of a phosphomimicking Spd-2-Cdk20E mutant slightly decreases (Figure S8). We now acknowledge the potential caveat of a non-specific perturbation of protein function, but feel that the reciprocal behaviour of the phospho-null and phospho-mimicking mutants somewhat mitigates this concern (p12, para.2). (2) Fortunately, and as we now clarify, it has recently been shown that reducing Cyclin levels does not reduce peak Cdk activity, but rather slows the time it takes to reach peak activity (Figure 2A, Hayden et al., Curr. Biol., 2022). Thus, the cyclin half-dose experiments provide an excellent alternative test of our hypothesis as they show that the WT proteins can exhibit similar behaviour to the mutants if the rate of Cdk/Cyclin activation is slowed. We feel the evidence supporting our hypothesis is strong enough that it warrants serious consideration.

      The suggestion to look at PCM recruitment in embryos arrested in either S-phase or M-phase is a good one, but these experiments produce complicated data. In M-phase arrested embryos, for example, Cnn levels continue to rise (see Figure 1G, Conduit et al., Dev. Cell, 2014), but the other PCM proteins do not (unpublished); in S-phase arrested embryos (arrested by mitotic cyclin depletion) centrosomes continue to duplicate, but now do so asynchronously, greatly complicating the analysis (McCleland and O’Farrell, Curr. Biol.., 2008; Aydogan et al., Cell, 2020). The centrosomes that don’t duplicate, however, reach a constant steady-state size (where the rate of centrosome protein addition is balanced by the rate of loss). These observations are consistent with our recent mathematical modelling of mitotic PCM assembly (Wong et al., 2022) if we additionally account for cell cycle regulation (which was not considered in our original model). We believe such analyses are beyond the scope of the current paper and we plan to publish a second paper incorporating our new hypothesis into our mathematical modelling.

      1. The Reviewer questions whether our methods accurately measure centrosomal protein accumulation, pointing out that γ-tubulin and Grip128 occupy different centrosomal areas—which should not be possible if they are part of the same complex. They suspect that our use of different transgenes with different promotors could explain these differences. As we should have described (see point #1 in our response to the minor comments of Reviewer #1), γ-tubulin exists in two complexes in flies, only one of which contains Grip128, so γ-tubulin and Grip128 exhibit different localisations. Moreover, as we now show (Figure S2), using different promotors does not seem to make a difference to overall recruitment kinetics. Thus, we are confident that our methods measure centrosome protein recruitment dynamics accurately.

      2. The Reviewer is concerned that our measurements of centrosome size based on fluorescence intensity (Figure 1) and centrosomal area (Figure S1) do not always match. They suggest a potential reason for this is that proteins are not uniformly distributed within centrosomes, and this may impact our ability to measure protein accumulation based on 2D projections (noting, for example, that Polo and Spd-2 are concentrated at centrioles and in the PCM, potentially explaining the different shape of their growth curves compared to the client proteins). When the centrosome-fluorescence-intensity and centrosome-area recruitment profiles of a protein do not match, the average “centrosome-density” of that protein must be changing over time. In some cases, we understand why density changes. Cnn, for example, stops flaring outwards on the centrosomal MTs during mitosis so its centrosomal area decreases even as its fluorescence intensity increases (leading to an increase in its centrosomal-density). We agree (and now discuss—p19, para.3) that the prominent accumulation of Spd-2 and Polo at centrioles could help to explain why Spd-2 and Polo accumulation dynamics differ from the client proteins.

      Other points:

      1. The Reviewer suggests it would be good to know how much Polo at the centrosome is active. We agree, but although commercial antibodies against PLK1 phosphorylated in its activation loop work in cultured fly cells, we cannot get them to work in embryos. Moreover, the recruitment of Polo/PLK1 to its site of action by its Polo-Box Domain is sufficient to partially activate the kinase independently of phosphorylation (Xu et al., NSMB, 2013). Thus, it seems likely that all the Polo/PLK1 recruited to centrosomes will be at least partially activated, even if it is not necessarily phosphorylated on its activation loop.

      2. The Reviewer asks if it is clear that less Spd-2 and Cnn are recruited to centrosomes in the half gene-dosage embryos. We apologise for not mentioning that this is indeed the case. We showed this previously for Cnn (Conduit et al., Curr. Biol., 2010) and we now state that this is also the case for Spd-2. We do not show the Spd-2 data as we plan to publish a comprehensive dose-response curve of Spd-2 (and Cnn) recruitment in our next modelling paper.

      3. Would it not be relevant to examine Polo ½ dosage embryos? We do have this data (Reviewer Figure 2), attached to this letter, but it is quite complicated to interpret (as we explain in the legend). We feel it would be more appropriate to include this in our next modelling paper where we can properly explain the behaviours we observe. Publishing this data here would distract from our main message without changing any of our conclusions.

      4. The Reviewer asks why the non-phosphorylatable Spd-2 protein is also present at higher levels on centrosomes at the start of S-phase (not just the end of S-phase). This was also raised by Reviewer #1 (point #5), so please see the second paragraph of our response there.

      Minor/Discussion Points:

      1. We thank the Reviewer for highlighting that absolute and relative centrosome size control are different things and we have amended the manuscript accordingly.

      2. The Reviewer questions whether it is accurate to describe Spd-2 and Polo as scaffold proteins, noting that only Cnn has been shown to have scaffolding properties. There is strong evidence that Spd-2 has Cnn-independent scaffolding properties in flies (e.g. Conduit et al., eLife, 2014), but this is a fair point for Polo. We think it is justified to separate Polo from other client proteins as Polo is essential for scaffold assembly, whereas other client proteins are not. We now define our scaffold/client terminology to avoid confusion (p4, para.3).

      3. The Reviewer highlights several points related to differences in recruitment kinetics (also touched on in points #2 and #3, above), noting we don’t discuss properly the idea of two different modes of PCM recruitment. These are all good points, largely addressed in our response to points #2 and #3, above. We now discuss much more prominently the two different modes of client protein recruitment throughout the manuscript.

      4. As we now clarify, in all our experiments we use centrosome separation and nuclear envelope breakdown (NEB) to define the start and end of S-phase, respectively.

      5. The Reviewer quotes the landmark Woodruff paper (Cell, 2017) as showing that the ability to concentrate client proteins (including ZYG-9, the worm homologue of Msps) is an intrinsic property of the PCM scaffold, so how do we explain that Msps departs prior to NEB while Cnn continues to accumulate? It is indeed a striking observation of our study that all PCM client proteins (not just Msps) start to leave the centrosome prior to NEB, even as Cnn levels continue to accumulate. Our hypothesis is that this ‘leaving’ event is triggered by a threshold level of Cdk/Cyclin activity—explaining why these client proteins all start to leave the PCM at the same time (just prior to NEB) irrespective of nuclear cycle length. This is not incompatible with the Woodruff paper, which did not attempt to reconstitute any potential regulation by Cdk/Cyclins in their in vitro studies.

      6. The Reviewer questions why Spd-2 that cannot be phosphorylated by Cdk/Cyclins (Spd-2-Cdk20A) accumulates abnormally at centrosomes in late S-phase, yet γ-tubulin (which is recruited by Spd-2) seems to leave centrosomes more slowly in the presence of the mutant protein. As we now explain more clearly, there is no contradiction here. Spd-2-Cdk20A accumulates to abnormally high levels in late-S-phase/early mitosis (Figure 5C), and this reduces the γ-tubulin dissociation rate, as we would predict (Figure 7B, right most graph). It does not “prevent” dissociation, however, (as the Reviewer seems to suggest it should?), but this is probably because these experiments have to be performed in the presence of large amounts of the WT Spd-2 (Figure 5A).

      7. The referencing error has been corrected.

      8. The Reviewer asks why in Figure 1 not all of the centrosome proteins could be followed for the full time period (as we mention in the legend, but do not explain). There are different reasons for different proteins: (1) Polo cannot be followed in mitosis as it binds to the kinetochores, making it impossible to accurately track centrosomes (so the data for mitosis is missing for Polo); (2) Cnn exhibits extensive flaring at the end of mitosis/early S-phase (Megraw et al., JCS, 1999), so we cannot track individual separating centrosomes labelled with NG-Cnn in early S-phase until they have moved sufficiently far-apart (so the early S-phase time-points are missing for Cnn); (3) In addition, several of the client proteins bind to the mitotic spindle, so although we can still track and measure the centrosomes in late mitosis in the graphs, we don’t show pictures of these late mitosis centrosomes in the montage in Figure 1A as the images look a bit odd. We now explain these reasons in the Materials and Methods.

      9. We now indicate that nuclear cycle 12 (NC12) is being analysed in Figures 4-8.

      10. The reviewer questions why we don’t show the decrease rate for γ-tubulin in Figure 6 (the Spd-2 and Cnn half-dose experiments), when we do show it in Figure 7 (the Spd-2 and Cnn Cdk-mutant experiments), suspecting that it is slowed in both cases. The reviewer is correct and we now show this data for both sets of experiments.

      11. We have corrected the labelling error in Figure S1.

      12. The Reviewer suggest moving some of the data from the main Figures, and the entirety of Figures 2 and 3 to the Supplemental Information. We understand this point, and agree that the amount of data presented in Figures 1-3 is somewhat overwhelming. We have played around with the Figures a lot—in particular trying to show a few examples of the data and moving the rest to Supplementary—but it is hard to pick a “typical” example, and the power of comparing the behaviour of so many different centrosome proteins is somewhat lost. We have tidied up several Figures and, as a compromise, we keep Figure 2 (now Figure 3) in the main text, but have moved Figure 3 to Supplementary (now Figure S5).

      13. The Reviewer suggests that we should repeat the analysis of Spd-2, Polo and Cnn dynamics that we show here, as we already presented this data in a previous publication (Wong et al., EMBO. J, 2022). We understand this point, but feel this would be a less accurate comparison, as essentially all of the data shown in Figure 1 was obtained several years ago during a contiguous ~6month period. Since then, the lasers and software on our microscope system have been updated, so it would probably be less fair of a comparison to obtain new data for a subset of these proteins (and it seems overkill to perform the entire analysis again). We clearly state that this data has been presented previously, so we hope the Reviewer will agree that it is acceptable to present it again here so readers can more easily compare the data.

      Reviewer #3:

      This Reviewer is broadly supportive of the manuscript, but to publish in a prestigious journal they think additional experimental evidence will be required to support our hypothesis.

      The Reviewer notes that our only evidence that Cdk/Cyclins directly phosphorylate Spd-2 comes from our analysis of the Spd-2-Cdk20A mutant, as the effect of reducing Cyclin B dosage on WT Spd-2 behaviour is very modest. They request that we analyse the behaviour of a Spd-2-Cdk20E phospho-mimicking mutant. The effect of halving the dose of Cyclin B on Spd-2 behaviour is modest, but this is what we would predict as all we are doing in this experiment is slowing S-phase by ~15%, so Spd-2 should accumulate at centrosomes for a slightly longer time and to a slightly higher level (as we observe, Figure 5E). A great advantage of the early fly embryo system is that we can compare the behaviour of many hundreds of centrosomes, so even subtle differences like this are usually meaningful. To illustrate this point, we have now repeated the Spd-2 analysis in WT and CycB1/2 embryos (but now using a CRISPR/Cas9 Spd-2-NG knock-in line) and we see the same subtle differences (Figure S9). In addition, as requested, we have now analysed the behaviour of a Spd-2Cdk20E mutant protein using an mRNA injection assay (as it would have taken too long to generate and test new transgenic lines). In this assay we injected embryos with mRNA encoding either WT Spd-2-GFP, Spd-2-Cdk20A-GFP or Spd-2-Cdk20E-GFP. The mRNA is quickly translated, and we computationally measured the fluorescence intensity of the centrosomes in mid-S-phase (i.e. at the Spd-2 peak) (Figure S8). This analysis confirms that Cdk20A accumulates to slightly higher levels, and reveals that Cdk20E accumulates to slightly lower levels, than the WT protein. Together, these new experiments strongly support our original conclusions.

      The Reviewer notes that we propose that the CCO initially promotes centrosome growth by stimulating Polo recruitment to centrosomes, but states that we only provide indirect evidence for this by showing that centrosomal Polo levels are strongly reduced in Cyclin B half-dose embryos. They suggest we determine Spd-2 levels in Polo half-dose embryos, and/or the centrosome levels of mutant forms of Spd-2 that cannot be phosphorylated by Polo. We believe the Cyclin B half-dose experiment provide direct support for our hypothesis that Cdk/Cyclin activity influences Polo recruitment (Figure 8), although, clearly, we have not identified the mechanism. We do, however, suggest a plausible mechanism: Ana1 and Spd-2 are largely responsible for recruiting Polo to centrosomes, and we have previously shown that several of the potential phosphorylation sites in these proteins that help recruit Polo to centrosomes are Cdk/Cyclin or Polo phosphorylation sites (Alvarez-Rodrigo et al., eLife, 2020 and JCS, 2021; Wong et al., EMBO J., 2022). We are currently testing this hypothesis, but progress is slow as it is clear that multiple sites in both proteins can influence this process.

      As the Reviewer requests, we have now also examined how Spd-2 and Cnn behave in Polo half-dose embryos (Reviewer Figure 2, attached to this letter). As we describe in the Figure legend, this data is informative, but is complicated. With relatively minor, but mechanistically important, tweaks to our previous mathematical modelling we can explain these behaviours, but introducing such a significant mathematical modelling element would be beyond the scope of this paper. As described above, these findings will form the basis of a follow-up paper that is more mathematically oriented.

      It is a great idea to look at mutant forms of Spd-2 that cannot be phosphorylated by Polo, but the consensus Polo phosphorylation site (N/D/E-X-S, with the N/D/E at -2 and the S at 0 being preferences, rather than a strict rule) is less well-defined than the consensus Cdk/Cyclin phosphorylation site (where the Pro at -1 is essentially invariant). Thus, we cannot accurately predict which sites would need to be mutated to generate such a mutant.

      The Reviewer requests that we analyse the behaviour of TACC in embryos expressing the Spd-2-Cdk20A and Cnn-Cdk6A (as we do in Figure 7 for γ-tubulin). This is a reasonable request, but we prefer not to show this data as we have recently identified an interesting interaction between TACC, Spd-2 and Aurora A that will be the subject of another paper we hope to submit shortly. This data is hard to interpret without explaining these interactions properly, which is beyond the scope of the current manuscript.

      We hope the Reviewers will agree that these changes have improved the manuscript substantially, and that it is now suitable for publication. We would like to thank them again for taking the time to read this rather complicated paper so thoroughly.

      We look forward to hearing from you.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In this manuscript, the authors investigated growth control of PCM at the mitotic centrosomes in late stages of the Drosophila syncytial embryos. They observed that mitotic centrosomes reach to the correct sizes through 13 rounds of nuclear division by reciprocally slowing their growth rate and increasing their growth period. They assumed that the Cdk/Cyclin cell cycle oscillator (CCO) is a main controller, based on their previous works (Aydogan et al., 2018, 2020; 2022). They determined the recruitment dynamics of the key mitotic PCM scaffolding proteins (Spd-2, Polo and Cnn) and PCM-client proteins (γ-tubulin, Msps, TACC, GFP, Grip75, Grip128 and Aurora A) in living embryos, and proposed that moderate levels of the CCO activity promote centrosome growth by stimulating Polo recruitment to centrosomes, while higher levels of activity subsequently inhibit centrosome growth by phosphorylating centrosome proteins, such as Spd-2, to decrease their centrosome recruitment and/or maintenance as the embryos enter mitosis.

      Experiments were cleverly designed and carefully executed. The results are nicely presented, the manuscript is clearly written, and their proposal draws a strong attention. However, in order to publish the manuscript in a prestigious journal, the authors may provide additional experimental evidence to support their proposal.

      • It is very significant that the centrosome levels of Spd-2-Cdk20A-NG is stronger than Spd-2-NG throughout the cell cycle (Figure 5B,C). However, this is only an experimental evidence to support that Cdk/Cyclins directly phosphorylate Spd-2 in the run-up to mitosis to help reduce Spd-2's centrosome recruitment and/or maintenance. As the authors confessed, recruitment of Spd-2-NG to the centrosomes in CycB1/2 embryos (Figure 5D,E) may be moderate or not significant at least in this reviewer's eyes. It is worth to perform the same experiments with a phospho-mimetic Spd2-Cdk20E-NG mutant.
      • The authors proposed that moderate levels of CCO activity promote centrosome growth by stimulating Polo recruitment to centrosomes. They provided an indirect evidence that centrosome levels of polo were strongly reduced in CycB1/2 embryos (Figure 4E,F). It is worth to determine the centrosome levels of Spd-2 in the Polo1/2 embryos and/or the centrosome levels of Polo phospho-resistant Spd-2 (Spd-2-Polo#A-NG).
      • TACC may be an ideal PCM-client protein, apart from its importance in spindle formation in comparison to γ-tubulin (Figure 4C,D). Therefore, it is worth to perform the Figure 7 experiments with TACC.

      Significance

      Experiments were cleverly designed and carefully executed. The results are nicely presented, the manuscript is clearly written, and their proposal draws a strong attention. However, in order to publish the manuscript in a prestigious journal, the authors may provide additional experimental evidence to support their proposal.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Control of organelle size has been an active field of research for many years for a large variety of cellular structures and in a range of experimental models. Here, Jordan Raff and colleagues examine the mechanisms underlying centrosome (PCM) size control in Drosophila syncytial embryos, building on their previous work (Wong, EMBOJ 2022) to propose a role for CDK in both promoting (at intermediate levels) and inhibiting (at high levels) PCM expansion.

      I found this a difficult manuscript to review, not only because the subject matter is complicated, but so is the writing. Having read and re-read the manuscript some clarity eventually emerges, but it shouldn't be that inaccessible. As for the authors' model I find it intriguing, but not fully supported by the data currently presented.

      Major points

      1. Central to the authors' model is the proposed dual function of Cdk (or CCO in the authors' terminology) in both promoting and inhibiting centrosomal protein accumulation. This the authors test by reducing the gene dosage of cyclin B and using putatively non-phosphorylatable versions of Spd-2 and Cnn. Both approaches to me appear quite problematic. The latter perturbation is hard to interpret given that whether these are indeed Cdk phosphosites that they have mutated is unknown and there are plenty of other possibilities how this might perturb protein function, as the authors' lack of success doing the same for gamma-tubulin illustrates. The former perturbation also lacks context. Does reducing cyclin B gene dosage reduce peak CDK activity or does it merely take longer to reach the same maximum, as appears to occur naturally as the cell cycle slows between embryonic cycles 11 and 13 (Edgar, Genes Dev 1994)? A more direct way to test their model would be to arrest the embryo in S phase (which in their model should lead to indefinite growth) or mitosis using suitable drugs/genetic perturbations. Is this not feasible in the fly system?
      2. Similarly critical is that centrosomal protein accumulation is accurately measured. I am not entirely convinced that this is so. If one takes their estimations of centrosome size at face value, then the space occupied by gamma-tubulin (slightly over 1 µm2 peak area according to Fig. S3) is significantly smaller than that occupied by Grip128 (4µm2). How is this possible if these form part of the same gamma-tubulin complex? This likely reflects the fact that the dynamics of many proteins is being assessed using transgenic reporters under the control of heterologous regulatory sequences (not all of which are fully functional, eg Polo), which could result in wildly inappropriate centrosomal protein levels. It may then not be a coincidence that the centrosomal domain for Grip128 (endogenously tagged) is larger than that for gamma-tubulin (transgene).
      3. Another concern is that centrosome size and integated signal intensity do not always match, as demonstrated by Grip71 (increasing as expected during centrosome maturation in cycle 13 based on fluorescence intensity but not area
      4. compare Figs. 1B and S1). A potential reason for this is that proteins are not uniformly distributed within centrosomes. For example, Polo and Spd2 are highly concentrated at centrioles. This impacts the ability to accurately measure protein accumulation based on 2D projections. Such inaccuracies likely will not affect estimation of when peak protein accumulation occurs, but may explain apparent differences in the kinetics of recruitment/dissociation of different components. Thus, the differences in the shape of the PCM client growth curves compared to those of Polo and Spd-2 (p6) may simply reflect the centriole concentration of the latter.

      Other points<br /> 4. In C. elegans much of Polo at centrosomes is apparently inactive, particularly in the vicinity of centrioles (Cabral, Dev Cell 2019). Knowing whether this is also the case in flies would seem like important information to have, particularly when comparing signal intensities across the cell cycle.<br /> 5. Is it clear that there is less Spd2/Cnn at centrosomes in Spd-2/Cnn 1/2 gene dosage embryos, as the authors assume?<br /> 6. Would it not be relevant to also examine Polo 1/2 dosage embryos?<br /> 7. Based on the authors model, Cdk phosphorylation first drives PCM accumulation, then at higher levels inhibits. Yet, their non-phosphorylatable Spd2 mutant exhibits not only a delayed decline in centrosomal levels, but also higher initial levels (Fig. 5B). If Cdk initially promotes Spd2 activity what is their explanation for this?

      Minor/discussion points

      1. p4 "In typical somatic cells the two mitotic centrosomes need to grow to approximately the same size, as mitotic centrosome size asymmetry can lead to asymmetric spindle assembly and so to defective chromosome segregation. How centrosome growth is regulated in somatic cells is unclear, but in early C. elegans embryos, mitotic centrosome size appears to be set by a limiting pool of the PCM-scaffolding protein SPD-2."<br /> The authors here conflate absolute and relative size. Relative size matters to avoid spindle asymmetries, and centriole involvement in PCM recruitment helps to prevent this (Zwicker et al., PNAS 2014). Absolute size, which is what the authors are concerned with in this manuscript, may be important for spindle scaling, but this is not the same thing.
      2. p5 "The centrosomal levels of Polo, Spd-2 and Cnn all started to increase at the start of S-phase, but whereas Cnn levels continued to rise and/or plateau as the embryos entered mitosis, the centrosomal levels of Polo and Spd-2 started to decrease before the entry into mitosis (Wong et al, 2021) (Figure 1A,B). Thus, the components of the mitotic PCM scaffold exhibit different growth kinetics, making it hard to use these proteins to define centrosome "size" at any particular point in the cell cycle."<br /> It is misleading and confusing for the reader to describe Polo and Spd2 as scaffold proteins as opposed to regulators of scaffold assembly. Presently Cnn is the only PCM protein demonstrated to have self-assembly/scaffolding properties based on the authors' own work (conduit, Dev Cell 2014; Feng, Cell 2017). There is little evidence that Polo and Spd2 form anything other than a nucleus for PCM growth.
      3. p7 "The centrosomal levels of Grip71, Grip75, Grip128, and Aurora A tended to increase steadily through most of NC13, whereas TACC, Msps and γ-tubulin exhibited a noticeable increase in their recruitment rate towards the end of S-phase, shortly before their recruitment levels peaked (compare NC13 graphs in Fig. 1B). This difference was also obvious if we used centrosome area as a measure of centrosome size (Fig. S1). We conclude that PCM client proteins can be recruited to centrosomes in at least two different ways."<br /> As discussed above apparent differences in kinetics may reflect limitations in the way protein accumulation is measured. It is hard to conceive of a reason why the Grips would display a different mode of protein accumulation from gamma-tubulin, nor is the idea of two different modes of protein accumulation picked up again later in the manuscript.
      4. Since the authors mention that the duration of S phase increases between cycles 11 and 13 (p9), are there any measures for the timing of the beginning/end of S phase in each cycle?
      5. One of the main findings in the landmark Woodruff paper from 2017 Cell paper was that PCM scaffold polymer could dynamically concentrate client proteins in the absence of any other factors, to an extent similar to that observed in vivo. This list did not include gamma-tubulin, which was later shown to require PLK1 phosphorylation of SPD-5 (Ohta, JCB 2021). However, it did include ZYG-9, the C. elegans ortholog of Msps. If client protein accumulation is an intrinsic property of the PCM scaffold, how do the authors explain that Msps departs prior to NEBD while Cnn continues to accumulate?
      6. p13 "The expression of the mutant proteins did not appear to dramatically perturb the centrosomal recruitment of γ-tubulin-GFP, except that the rate at which γ-tubulin-GFP left the centrosome as the embryos entered mitosis was reduced in both mutants compared to WT (Figure 7). This phenotype was subtle, but it was statistically significant, and it seems likely that the presence of large amounts of WT Spd-2 and Cnn in the mutant embryos (Figure 5A,F) would help to mask the potential severity of this phenotype."<br /> This does not quite make sense. Fig. 5 shows that Spd2 dissociation is significantly slowed in the mutant condition. If Spd2 drives gamma-tubulin accumulation (as Fig 6 shows), then the continued presence of Spd2 should prevent dissociation. Yet it apparently does not. Why?

      Other

      1. p3 and following. The reference for the authors' prior work on PCM recruitment (Wong et al, 2021) should probably be for the final, published article in EMBO J, not the 2021 preprint.
      2. Fig. 1. legend "Note that for technical reasons not all of the centrosome proteins could be followed for the full time period." Why not?
      3. Figs 4-6. Which cycle is being assessed here?
      4. Fig 6. Not plotted here is the rate of dissociation of gamma-tubulin, unlike eg in Fig 7. It is notable that both accumulation and dissociation appear to be slowed in the Spd2 1/2 gene dosage condition.
      5. Fig S1B. Some of the graphs in this figure are not labeled (based on Fig.1 presumably gamma-tubulin and Msps).
      6. Some of the data in the main figures, including the entirety of Figs. 2 and 3, could be moved to Supplemental to present a more crisp and accessible manuscript.
      7. While I sympathize with the authors needing to repeat entire sets of experiments I am not entirely sure it is appropriate to recycle entire sets of data from a previous publication of theirs (Cnn, Spd-2 and Polo recruitment kinetics, reproduced from Wong et al., EMBOJ 2022), since this manuscript is largely concerned with apparent differences between the kinetics of those components and the PCM client proteins now being analysed.

      Significance

      Control of organelle size has been an active field of research for many years for a large variety of cellular structures and in a range of experimental models. Here, Jordan Raff and colleagues examine the mechanisms underlying centrosome (PCM) size control in Drosophila syncytial embryos, building on their previous work (Wong, EMBOJ 2022) to propose a role for CDK in both promoting (at intermediate levels) and inhibiting (at high levels) PCM expansion.

      I found this a difficult manuscript to review, not only because the subject matter is complicated, but so is the writing. Having read and re-read the manuscript some clarity eventually emerges, but it shouldn't be that inaccessible. As for the authors' model I find it intriguing, but not fully supported by the data currently presented.

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      The manuscript by Wong et al. investigates how cells regulate the increase in the size of the centrosomes (more specifically the size of the pericentriolar material or PCM) that occurs during preparation for mitosis. They use the Drosophila syncytial embryo as a model, focusing on nuclear cycles 11-13, during which cell cycle progression gradually slows. The authors find that centrosomes grow to a consistent size at each cycle by adjusting to the slowed cell cycle, reducing the growth rate and increasing the growth period. This adjustment is proposed to be regulated by the Cdk/Cyclin cell cycle oscillator. Curiously, Cdk/Cyclin activity seems to both promote and inhibit the increase in centrosome size, depending on whether its activity is moderate or very high, respectively. Both effects are proposed to depend on the phosphorylation of centrosome proteins by Cdk/Cyclin.

      1. While being comprehensive in the number and type of markers that are being analyzed, there is no analysis of the centrosome's MTOC activity. In my opinion this is missing since centrosome size alone is not necessarily indicative of its MTOC activity, but MTOC activity is what ultimately matters for its role during mitosis. For example, it was observed that centrosome size declines already before mitotic entry, but it is possible that centrosome MTOC activity does not (similar to differences in the timing of the decline of PCM scaffold vs PCM client proteins). While not strictly related to size control, centrosome activity is biologically more relevant than solely size. I would consider it optional, if the authors decide to talk only about centrosome size, but then it should be made clear that size here may not be the most relevant factor.
      2. The authors say that during NC13 PCM client proteins can be recruited in "at least two different ways" (p. 7), including a way (rapid increase before peak) that does not resemble PCM scaffold recruitment (steady increase during NC13). How can these two different ways and kinetics be determined by the same Cdk/Cyclin oscillator?
      3. I am puzzled by the conclusion that Cdk/Cyclin directly phosphorylates Spd-2 or Cnn at the sites used for mutagenesis. This cannot be concluded based on the presented data.
      4. Fig. 6: Doesn't the data show that Cnn does not affect the initial rate of g-tub recruitment, but only the later rapid recruitment shortly before mitosis? In contrast Spd-2 seems to affect the initial phase. This should be described more precisely. Again, I am wondering how this is compatible with direct regulation by a single oscillator, as suggested by the authors (see also point 2 above.
      5. I don't find the proposed model very convincing and not fully supported by the presented data.<br /> First, the recruitment kinetics of different centrosome proteins are not all the same, arguing against a simple relationship based on phosphorylation by Cdk/Cyclin. For example, kinases (or phosphatases) may be recruited (or displaced) by Cdk/Cylclin at the centrosome and then locally regulate binding or maintenance of certain centrosome proteins. This could explain profiles that do not display a steady change over time, as would be expected by direct regulation by Cdk/Cyclin.<br /> Second, it is not clear from the description in the text or from Fig. 8 how moderate Cdk/Cyclin activity can promote recruitment and high activity induce loss of proteins at centrosomes. In fact, the experiments with Spd-2 and Cnn phospho-mutants suggest that phosphorylations at the mutated sites also reduce centrosome binding during S phase (at moderate activity) and not only shortly before mitosis (at high activity), since alanine mutants of both Spd-2 and Cnn are increased at centrosomes also during S phase. The model seems to ignore this observation. If these sites are already phosphorylated to decrease centrosome binding in S phase, then what triggers the rapid decrease shortly before mitosis?
      6. Can the authors identify and mutate CdK/Cyclin dependent phospho-sites in centrosome proteins that promote centrosome recruitment at moderate Cdk/Cyclin activity? As an alternative to the "protein availability" model for regulation of centrosome size, the proposed model needs to explain how a steadily increasing activity (Cdk/Cyclin) can first induce growth and then turn growth off, when the desired size is reached. This is obvious in the "protein availability" model, where the available protein steadily decreases as centrosomes grow, but this is not at all obvious for an oscillator that behaves in the opposite way during the same period and that can only phosphorylate sites that decrease centrosome binding.

      Minor:

      1. The authors observe differences in the intensity profiles for different subunits of the gamma-tubulin complex. How do they explain this? Are they not in the same complex? The authors should mention and comment on this.
      2. The authors refer at various points in the manuscript to an "inverse-linear" relationship between S phase length and centrosome growth rate, but according to the graphs the rate does not change linearly.

      Significance

      This is an interesting manuscript that reaches somewhat different conclusions regarding centrosome size control when compared to previous studies in other organisms. In particular, work in C. elegans has proposed that centrosome growth regulation is controlled by the limited cytoplasmic availability of PCM building blocks, whereas the current study proposes a different model based on the activity of a cell cycle oscillator. The model system and approaches are well presented and the data is of good quality. The authors monitor a large number of centrosome markers, each with detailed quantifications of intensity and distribution over time during the different cycles. They also employ two different ways of quantifying centrosome size with similar results, making their quantifications more robust. While the authors include phospho-mutants in their analyses that presumably cannot be phosphorylated by Cdk/Cyclin, the study is largely descriptive. Still, the authors present interesting observations and propose the "oscillator model" an alternative to the "limited availability model" for the regulation of centrosome size, and perhaps that of other organelles. Assuming the authors can clarify inconsistencies and/or provide additional data to support the proposed model, this could be an important finding that expands cell biologists' understanding of organellar size control.

      I have expertise in centrosome biology and the role of centrosomes as MTOCs, as well as more general expertise regarding the function of the microtubule cytoskeleton in cell division and differentiation.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity):

      In their manuscript „Live-cell super-resolution nanoscopy reveals modulation of cristae<br /> dynamics in bioenergetically compromised mitochondria", Golombek et al. tested the effects of different mitochondrial toxins on cristae dynamics. The main focus of their work lies on live STED imaging, which they use to visualize cristae merging and splitting. They found swelling of mitochondria and reduced cristae density in response to most toxins, but cristae dynamics remained largely unaffected. Depletion of the membrane potential by administration of CCCP increased cyristae dynamics, while inhibition of ANT had a negative effect on cristae dynamics at least in a subset of mitochondria.

      1. The authors state that the used concentrations of mitochondrial toxins commonly result in a change in oxygen consumption. While this is believable, it is not guaranteed that the specific chemicals used for the experiments were working properly (freeze/thawing or simply incorrect storage or aliquotation may have an effect on the compounds). This is even more important in the case of results where no significant change after the administration of the toxins is seen. In Figure 5, the authors report no change in membrane potential after oligomycin administration, this is unexpected. I therefore suggest to include a supplementary figure, in which the functionality of the compounds is verified. This could be done by respiratory measurements (e.g. Seahorse). A Mito Stress Test was performed for Figure 6, but this was done using the Seahorse kit chemicals, which were probably different from the chemicals used in the microscopy experiments.

      Response: We appreciate the valid concerns of the reviewer in this point.

      A) In order to show the functionality of compounds which were used for performing our experiments including STED imaging, we now performed respiratory measurements employing the concentrations of mitochondrial toxins (Oligomycin A, CCCP, rotenone/antimycin A) which were used during imaging conditions as well as commercially available mitochondrial toxins (Oligomycin A, FCCP, rotenone/antimycin A) with respective concentrations used as a standard for the Mito stress Kit. The new figures are included in Fig S1A & B. HeLa cells treated with seahorse compounds or those used during imaging conditions showed similar results including basal, maximal and spare respiratory capacity. Further, in order to overcome the inefficiency of mitochondrial toxins employed, due to freeze/thaw cycles, we used fresh aliquots (stored at -20°C) as a general strategy. This is clearly observed by a drastic reduction of ΔΨm upon treating HeLa cells with CCCP, antimycin A as well as rotenone (Fig S6A & B). A reduction of mitochondrial ATP levels was also observed upon employing rotenone, antimycin A and oligomycin A confirming that active mitochondrial toxins were used. These experiments demonstrate that the mitochondrial toxins employed throughout our manuscript are functional as expected.

      New Figure S1A & B

      B) The Fig 6 (now Fig 5 due to Reviewer # 2, Point 7) respirometry experiments which initially employed seahorse compounds and BKA has now been replaced with new experiments where we used mitochondrial toxins similar to STED imaging. Needless, to say, the results are similar to what were observed with seahorse compounds. The new figures are replaced in Fig 5A & 5B.

      New Figure 5A & B

      C) Oligomycin A inhibits ATP synthase which results in decreased ATP synthesis as observed (Fig 4A & B). Further, oligomycin A is expected to hyperpolarise mitochondria (2). In Fig S6, despite some cells having more ΔΨm, there was no overall significant change when compared to untreated cells. Previous publications also show that there is no significant difference in ΔΨm upon treatment with oligomycin (1) demonstrating that the ΔΨm depends on the concentration of oligomycin, treatment time and cell type.

      1. Figure 1 would benefit from a more detailed description of merging/splitting events. Maybe a cartoon plus a zoomed in image of an exemplary event?

      Response: Thank you for the suggestion. In order to clearly explain/simplify the understanding of cristae merging and splitting events, we added a cartoon in Fig 1B. The green and magenta arrows show sites of imminent merging and splitting with the green and magenta asterisks representing them respectively in the subsequent frames. The zoomed in images in Fig1A (leftmost panel) are shown to the right as time-lapse images.

      New Figure 1B

      1. Could the reduced cristae density be an effect of mitochondrial swelling? It is curious that all toxins appear to have the same effect on mitochondrial architecture. What is the fait of an enlarged mitochondrion over time? Mitophagy? And does the percentage of enlarged mitochondria change with increasing treatment time?

      Response: Thank you for the comment.

      A) We agree that the reduced cristae density is due to mitochondrial swelling. We added the relevant text in the results section ‘Cristae structure is altered in a subset of mammalian cells treated with mitochondrial toxins’. Treatment of HeLa cells, with all the mitochondrial toxins mentioned, uniformly result around 50 % of mitochondria undergoing enlargement (Fig 2B). In enlarged mitochondria where the mitochondrial width is ≥ 650 nm, there is no change in cristae area occupied per mitochondria (Fig S3C & D) and as a result reduced cristae density (Fig 2H). Therefore, it indicates that reduced cristae density occurs due to mitochondrial enlargement.

      Figure 2B-F

      Figure S3C and D

      B) In order to address the fate of mitochondria with increasing time upon treatment with various mitochondrial toxins, we treated the HeLa cells for 4 hrs with mitochondrial toxins. Untreated cells maintained normal mitochondrial morphology while cells treated with various mitochondrial toxins displayed fragmented and swollen mitochondrial morphology. The new Fig S5 is included in the supplementary. Cristae morphology was abnormal displaying interconnected cristae in swollen mitochondria. Since mitochondrial fragmentation is already observed at 4 hours and accompanied by interconnected cristae, the number of cristae merging and splitting were severely reduced.

      Our imaging performed within 30 mins of addition of respective toxins overcomes the additional aberrancy of mitochondrial fragmentation which would not allow a reliable analysis of cristae dynamics as too few cristae would be visible within one mitochondrion.

      New Figure S5

      1. Figure 4C: How was the mitochondrial width determined in the LSM images? Especially in the perinuclear area it will be difficult to determine this parameter without the super-resolution provided by STED. Was this parameter determined manually for selected mitochondria? In the methods part it says that only a maximum of two mitochondria per cell were analyzed. How were these chosen? Was the process blinded?

      Response: Thank you for the comment. We could imagine the reason for the ambiguity in understanding.

      A) For LSM confocal images involving FRET-based microscopy to determine the ATP levels, we calculated the cell population as belonging to either normal or enlarged category. The confocal images of HeLa cells displayed clear separation of mitochondria even in the perinuclear area (representative images are shown in Fig 4A) and thus it was possible to measure the width of individual mitochondria. The methods section ‘FRET-based microscopy to measure ATP levels’ describes that ‘the cut off for swollen mitochondria was set to 650 nm in congruence with STED SR nanoscopy. If 85% of the mitochondrial population featured enlarged mitochondria, the cells were designated as swollen. Similarly, if 85% of the mitochondrial population featured mitochondria whose width was less than 650 nm, the cell was considered as having normal mitochondria’.

      Figure 4A

      B) The cristae morphology of various mitochondria is fairly uniform in individual cells. Thus, the mitochondria are representative of the individual cells. Therefore, in order to increase the coverage of various cells, we considered a maximum of two mitochondria from each cell which were randomly chosen. This part is modified in the methods section ‘Quantification of various parameters related to cristae morphology’ to make it clear. Thus, while the quantification of various parameters including dynamics involved individual mitochondria, various cells were classified as belonging to normal or enlarged category while measuring ATP levels.

      1. What is the average size of all mitochondria per cell? Is this addressed in Figure 2B or are only analyzed mitochondria included? Please carify. Were the mitochondria chosen for analysis representative for the respective cell?

      Response: The data obtained by super-resolution imaging of mitochondria is used for quantifying cristae dynamics which is a very challenging and time-consuming method done in a blind-manner. As mentioned in response 4B, the cristae morphology is fairly uniform in individual cells, therefore, we only included the mitochondria which were analysed for various cristae parameters in our analysis which are really huge data-sets already. Thus, the average size of individual mitochondria per cell are not represented while analysing images obtained with STED SR imaging. Please also check response 4B.

      1. explain the mt-Go-AT team2, what is GFP (green fluorescent protein) and OTP (?)

      Response: GFP is Green Fluorescent Protein and OFP is Orange Fluorescent protein and included in the revised text.

      1. the graphs show in principle, e.g. Fig.1B, 3B-E show events/mitochondrion as far as I understand, not per cristae.

      Response: Thank you for pointing this out. It is actually the average number of events per cristae per mitochondria. We have changed the Y-axis to events/cristae/mito in Fig 1C (previous 1B), Fig 3B-E and wherever applicable for other figures throughout the manuscript.

      Figure 1C

      Figure 3B-E

      1. I would recommend changing the legend of the x-axis of Fig.2B-F to mito-width (y-axis could be probability density function, PDF).

      Response: We have now changed the X-Axis to mito width (originally width) in Fig 2B-F. The Y-axis are still retained as percentage mitochondria where cells treated with few mitochondrial toxins do not show a gaussian distribution of mitochondrial width.

      Figure 2B-F

      Referees cross-commenting

      both expert opinions address similar concerns and therefore a revision should be requested

      Reviewer #1 (Significance):

      The study is thorough and the experiments and results are well described. Overall, however, it remains a descriptive study and does not provide mechanisms. There is also no discussion of how MMP-dependent proteins, such as Opa1, which was previously studied by the Reichert group, might be affected. For swelling mechanisms, the opening of the mitochondrial permeability transition pore was discussed. This could be tested using inhibitors, but perhaps not within the scope of this publication. Nevertheless, the information provided by the study is of interest to the bioenergetics community and should be made available.

      Response: Thank you for the overall inputs.

      We tested the processing of OPA1 forms and found that after 30 mins, only CCCP treatment led to the processing of long isoforms to short forms (Fig S6C). We now included in the discussion that it is possible that short OPA1-forms are correlative to increased cristae merging as well as splitting events upon treatment with CCCP.

      New Figure S6C

      Reviewer #2 (Evidence, reproducibility and clarity):

      Summary:<br /> The authors investigated cristae merging and splitting events using ultra-resolution STED. The goal was to test if cristae membrane remodeling is dependent on OXPHOS complexes, mitochondrial membrane potential (ΔΨm), and the ADP/ATP nucleotide translocator. To do this the authors utilized several mitochondrial toxins with known mechanisms of action. Interestingly, many changed overall cristae density but did not change the cristae remodeling events. Inhibition of ANT did change cristae morphology and cristae dynamics.

      Major Concerns

      1. Many conclusions and concepts need more clarification. For example, a major take home from the abstract is that various ETC inhibitors and protonophores reduce cristae density but not did not change cristae remodeling events. If cristae density is reduced, how can this occur without cristae remodeling events? Remodeling events need to be clearly defined in the introduction and abstract.

      Response: Thank you for pointing out this lack of sharpness in our terminology which indeed can cause a misunderstanding. To avoid this, we have now included ‘changes in cristae morphology’ as well as ‘dynamic merging and splitting events of cristae’ under the broader term cristae remodelling. Thus, we had changed the wording ‘cristae remodeling’ to cristae dynamics in the abstract and wherever appropriate in the manuscript text.

      The cristae morphology analysis showed no change in cristae area (Fig S3C) which was accompanied by mitochondrial enlargement. Therefore, cristae density was reduced. For the purpose of clarity, we added a sentence in the introduction section while giving a peek into our results that ‘cristae dynamic events are ongoing despite reduced cristae density’. In addition, we have now included in the results section the following statement: ‘Cristae membrane remodeling has been used to describe cristae dynamic events (i.e. cristae merging and splitting) as well as overall changes in cristae morphology within a single mitochondrion in this manuscript’.

      Figure S3C and D

      1. Other interpretations are also unclear such as how ETC inhibitors which reduce ATP levels did not impact cristate remodeling events, yet inhibiting ATP/ADP exchange did greatly impact this phenomenon. It seems likely that the inhibition of ANT has nothing to do with ATP/ADP exchange since most of the ETC inhibitors no doubt greatly impact overall ATP/ADP exchange. This interpretation needs clarification.

      Response: We agree that further clarification is needed, in particular to explain why ATP/ADP exchange is actually ongoing even when OXPHOS inhibitors are applied and to explain why reduced ATP levels do not mean that there is no ATP/ADP exchange occuring. Treatment of HeLa cells with various mitochondrial toxins inhibiting the function of OXPHOS complexes leads to decreased ATP levels due to ongoing ATP consumption within the cell (Fig 4). One should also consider that two things can and do happen when most of these toxins are applied regarding ATP exchange. First, the ATPase can act in reverse mode which is a (partial) compensatory mechanism to restore ΔΨm and which will further decrease ATP levels (Note: not in the presence of oligomycin). Second, under these conditions ADP/ATP exchange is still ongoing in order to transport ATP derived from glycolysis in the cytosol to the mitochondrial matrix which also causes an (partial) compensatory increase in membrane potential. After ATP import ATP is hydrolysed to ADP for reverse proton pumping via the F1FO-ATPase or alternatively by the F1-part alone without proton pumping. In all these cases it is essential and possible to exchange ADP with ATP constantly. Therefore, the overall exchange of ADP and ATP is not necessarily grossly expected to be different when compared to untreated cells (due to compensatory glycolysis and subsequent ATP import and hydrolysis in the matrix). On the other hand, BKA treatment which clearly impairs the exchange of ADP and ATP will lead to a completely different situation compared to only treating with OXPHOS inhibitors. With BKA the mitochondrial matrix cannot anymore be resupplemented with ATP derived from glycolysis and metabolite flux is grossly hampered. Consistent with this a strong reduction in ΔΨm and oxygen consumption is accompanied with BKA treatment (Fig. 5AB & SFig 7F). Thus, w.r.t cristae dynamic events, in the time-frame we used for imaging, a reduction of ATP levels does not impede occurrence of cristae merging and splitting events while BKA treatment does (Fig S7). We discuss this indeed interesting and unexpected finding in the discussion section. We propose that rather ongoing metabolite flux (ATP/ADP exchange) is critical for maintaining cristae dynamics and blocking it is detrimental for it. We adapted the discussion in this direction to make it more clear.

      Figure S7A, B and D

      1. Why did the authors wait 30 min to image after the addition of mitochondrial toxins? I would have guessed there is a more rapid change in response to these inhibitors. Is there is a chance he authors missed the most dramatic events?

      Response: Since we were inclined to observe early responses, cells were imaged within the first 30 mins after addition of the respective mitochondrial toxins (Please see methods ‘cell culture transfection and mitochondrial toxin treatment’). Thus, to answer this question we want to emphasize that we did not wait 30 minutes but we restricted our time frame of analysis to 30 min. Therefore, we think that we did not miss out on any rapid changes occurring early on. Regarding this point, Reviewer #1 (Query 3) asked for responses at a later time-point. Please read the Reviewer #1, response 3B.

      1. How do these mitochondrial toxins that are known to cause mitochondrial swelling not induce changes in cristate density?

      Response: Thank you for the question. Probably, there is a misunderstanding. In Fig S3E, we clearly show that as the mitochondrial width increases in cells after treatment with mitochondrial toxins, there is a clear decrease in cristae density. In fact, the reduced cristae density is observed exclusively in enlarged mitochondria. Figure S3E-I

      5. It's interesting that inhibition of the ANT translocator by BKA treatment led to increased percentage of mitochondria with abnormal cristae morphology. It's accepted that inhibition of ANT profoundly reduces mitochondrial swelling. Do the authors have any data suggesting that abnormal cristae morphology actually is a mechanism for reducing cell death events such as permeability transition? Did the authors utilize cyclosporin A concomitantly with any of the mitochondrial toxins?

      Response: This is a very interesting question! As the reviewer might be aware, there is evidence connecting cristae remodelling to induction of apoptosis (3). Cristae transitioned to a highly interconnected state after tBID treatment within minutes. However, it is unclear what is the contribution of cristae dynamics in this regard. Within 30 mins, there were no visual signs of cell death in our experiments as observed under a microscope. Hence, we did not use cyclosporin A in our experiments. In our opinion, this question will form part of a very interesting future study and is currently beyond the scope of this manuscript.

      1. Are the authors confident in the data given many of the experiments utilized quantification of 10-20 mitochondria? How are you sure this sampling is sufficient for phenomenon being studied?

      Response: Please see Reviewer 1, Response 4B. As pointed in the response to reviewer #1, the cristae morphology is fairly uniform in individual cells. Therefore, in order to maximise the cell population covered, we randomly used a maximum of two mitochondria from each cell. In addition, we included cristae analysis from at least three biological replicates in order to observe the reproducibility of the data. Taking these factors into consideration, we are confident that our results reflect a sufficient sample size. Further, we would like to point out while our group performs STED super-resolution imaging routinely, the quantification of cristae merging and splitting events done in a blind yet manual manner is a really laborious and time-consuming process. In the future, we are also looking to optimise this at least in a semi-automated manner.

      1. Figure 4 and 5 merely confirm current dogma and don't really contribute to the overall conclusions and can be moved to supplemental data.

      Response: We agree that Fig 5 is confirming to the current dogma. Therefore, we moved it to Fig S6. Regarding Fig 4, we would like to highlight that there is a decrease of ATP levels before mitochondria enlarge. Thus, we would like to retain it as part of the main figure.

      1. It's interesting that BKA dose dependently decreased ATP-linked respiration and all doses limited maximal respiratory capacity. It would be interesting to know if the BKA normal vs. abnormal mitochondria have differential membrane potential?

      Response: Thank you for the interesting question. Overall, BKA treatment leads to a significant decrease of ΔΨm in the whole cell population (Fig S7). Further, the abnormal cristae morphology is only seen in one-third of the population of mitochondria (Fig shown in Response 2). Thus, a drop in ΔΨm seems to be a very early response upon exposure to BKA and independent of cristae morphology. An ideal experiment to address this question would be to image cristae dynamics and ΔΨm using super-resolution imaging which is challenging according to the state-of-art and available chemicals.

      Figure S7E and F

      1. Overall, this is an interesting study and seems appropriately performed but the results and conclusions are unclear. More discussion should include physiological relevance and impact and how this data influences previous work. Some physiological perturbations beyond the mitochondrial toxins and or utilization of genetic models would strengthen the interpretation and overall impact.

      Response: Thank you. We added an OPA1 blot showing the different L-OPA1 and S-OPA1. (Reviewer #1, response in significance section) where we observed that S-OPA1cleavage is selectively enhanced in CCCP-treated cells which could be correlated with enhanced cristae dynamics. We also included these results in the main text.

      New Figure S6C

      Referees cross-commenting

      Yes, I conclude that given the significant overlap in reviwer comments and general need for clarification of concepts and data that a revision is in order.

      Reviewer #2 (Significance):

      Overall, a highly specialized study with audience limited to mitochondriacs. Although, I'll note tis is a hot area of study and there is high interest in the field. Some of the data interpretation is difficult to understand and overall more context is needed to explain the results, impact and relevance. Defining exactly what a cristae remodeling event is and how this differs from cristae density and how the two aren't directly connected is unclear.

      Review by a mitochondrial biologist specializing in mitochondrial signaling and connection to physiology.

      References:

      1. Baker MJ, Lampe PA, Stojanovski D, Korwitz A, Anand R, et al. 2014. Stress-induced OMA1 activation and autocatalytic turnover regulate OPA1-dependent mitochondrial dynamics. EMBO J 33: 578-93
      2. Farkas DL, Wei MD, Febbroriello P, Carson JH, Loew LM. 1989. Simultaneous imaging of cell and mitochondrial membrane potentials. Biophys J 56: 1053-69
      3. Scorrano L, Ashiya M, Buttle K, Weiler S, Oakes SA, et al. 2002. A distinct pathway remodels mitochondrial cristae and mobilizes cytochrome c during apoptosis. Dev Cell 2: 55-67
    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary:

      The authors investigated cristae merging and splitting events using ultra-resolution STED. The goal was to test if cristae membrane remodeling is dependent on OXPHOS complexes, mitochondrial membrane potential (ΔΨm), and the ADP/ATP nucleotide translocator. To do this the authors utilized several mitochondrial toxins with known mechanisms of action. Interestingly, many changed overall cristae density but did not change the cristae remodeling events. Inhibition of ANT did change cristae morphology and cristae dynamics.

      Major Concerns

      1. Many conclusions and concepts need more clarification. For example, a major take home from the abstract is that various ETC inhibitors and protonophores reduce cristae density but not did not change cristae remodeling events. If cristae density is reduced, how can this occur without cristae remodeling events? Remodeling events need to be clearly defined in the introduction and abstract.
      2. Other interpretations are also unclear such as how ETC inhibitors which reduce ATP levels did not impact cristate remodeling events, yet inhibiting ATP/ADP exchange did greatly impact this phenomenon. It seems likely that the inhibition of ANT has nothing to do with ATP/ADP exchange since most of the ETC inhibitors no doubt greatly impact overall ATP/ADP exchange. This interpretation needs clarification.
      3. Why did the authors wait 30 min to image after the addition of mitochondrial toxins? I would have guessed there is a more rapid change in response to these inhibitors. Is there is a chance he authors missed the most dramatic events?
      4. How do these mitochondrial toxins that are known to cause mitochondrial swelling not induce changes in cristate density?
      5. It's interesting that inhibition of the ANT translocator by BKA treatment led to increased percentage of mitochondria with abnormal cristae morphology. It's accepted that inhibition of ANT profoundly reduces mitochondrial swelling. Do the authors have any data suggesting that abnormal cristae morphology actually is a mechanism for reducing cell death events such as permeability transition? Did the authors utilize cyclosporin A concomitantly with any of the mitochondrial toxins?
      6. Are the authors confident in the data given many of the experiments utilized quantification of 10-20 mitochondria? How are you sure this sampling is sufficient for phenomenon being studied?
      7. Figure 4 and 5 merely confirm current dogma and don't really contribute to the overall conclusions and can be moved to supplemental data.
      8. It's interesting that BKA dose dependently decreased ATP-linked respiration and all doses limited maximal respiratory capacity. It would be interesting to know if the BKA normal vs. abnormal mitochondria have differential membrane potential?
      9. Overall, this is an interesting study and seems appropriately performed but the results and conclusions are unclear. More discussion should include physiological relevance and impact and how this data influences previous work. Some physiological perturbations beyond the mitochondrial toxins and or utilization of genetic models would strengthen the interpretation and overall impact.

      Referees cross-commenting

      Yes, I conclude that given the significant overlap in reviewer comments and general need for clarification of concepts and data that a revision is in order.

      Significance

      Overall, a highly specialized study with audience limited to mitochondriacs. Although, I'll note tis is a hot area of study and there is high interest in the field. Some of the data interpretation is difficult to understand and overall more context is needed to explain the results, impact and relevance. Defining exactly what a cristae remodeling event is and how this differs from cristae density and how the two aren't directly connected is unclear.

      Review by a mitochondrial biologist specializing in mitochondrial signaling and connection to physiology.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      In their manuscript „Live-cell super-resolution nanoscopy reveals modulation of cristae<br /> dynamics in bioenergetically compromised mitochondria", Golombek et al. tested the effects of different mitochondrial toxins on cristae dynamics. The main focus of their work lies on live STED imaging, which they use to visualize cristae merging and splitting. They found swelling of mitochondria and reduced cristae density in response to most toxins, but cristae dynamics remained largely unaffected. Depletion of the membrane potential by administration of CCCP increased cyristae dynamics, while inhibition of ANT had a negative effect on cristae dynamics at least in a subset of mitochondria.

      Major comments

      • The authors state that the used concentrations of mitochondrial toxins commonly result in a change in oxygen consumption. While this is believable, it is not guaranteed that the specific chemicals used for the experiments were working properly (freeze/thawing or simply incorrect storage or aliquotation may have an effect on the compounds). This is even more important in the case of results where no significant change after the administration of the toxins is seen. In Figure 5, the authors report no change in membrane potential after oligomycin administration, this is unexpected. I therefore suggest to include a supplementary figure, in which the functionality of the compounds is verified. This could be done by respiratory measurements (e.g. Seahorse). A Mito Stress Test was performed for Figure 6, but this was done using the Seahorse kit chemicals, which were probably different from the chemicals used in the microscopy experiments.
      • Figure 1 would benefit from a more detailed description of merging/splitting events. Maybe a cartoon plus a zoomed in image of an exemplary event?
      • Could the reduced cristae density be an effect of mitochondrial swelling? It is curious that all toxins appear to have the same effect on mitochondrial architecture. What is the fait of an enlarged mitochondrion over time? Mitophagy? And does the percentage of enlarged mitochondria change with increasing treatment time?
      • Figure 4C: How was the mitochondrial width determined in the LSM images? Especially in the perinuclear area it will be difficult to determine this parameter without the super-resolution provided by STED. Was this parameter determined manually for selected mitochondria? In the methods part it says that only a maximum of two mitochondria per cell were analyzed. How were these chosen? Was the process blinded?
      • What is the average size of all mitochondria per cell? Is this addressed in Figure 2B or are only analyzed mitochondria included? Please carify. Were the mitochondria chosen for analysis representative for the respective cell?

      Minor comments

      1. explain the mt-Go-AT team2, what is GFP (green fluorescent protein) and OTP (?)
      2. the graphs show in principle, e.g. Fig.1B, 3B-E show events/mitochondrion as far as I understand, not per cristae.
      3. I would recommend changing the legend of the x-axis of Fig.2B-F to mito-width (y-axis could be probability density function, PDF).

      Referees cross-commenting

      both expert opinions address similar concerns and therefore a revision should be requested

      Significance

      The study is thorough and the experiments and results are well described. Overall, however, it remains a descriptive study and does not provide mechanisms. There is also no discussion of how MMP-dependent proteins, such as Opa1, which was previously studied by the Reichert group, might be affected. For swelling mechanisms, the opening of the mitochondrial permeability transition pore was discussed. This could be tested using inhibitors, but perhaps not within the scope of this publication. Nevertheless, the information provided by the study is of interest to the bioenergetics community and should be made available.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity):

      Major comments<br /> In the paper "Microtubules under mechanical pressure can breach dense actin networks", the authors showed clear evidence that pressure plays an important role in microtubule breaching into dense actin networks using elegant in vitro reconstitution assays. They have argued that the pressure results from polymerization force of microtubules, which builds up when microtubules are immobilized in the opposite end of breaching, by the means of actin microtubule crosslinking factor Tau.

      Authors answer:

      We thank the reviewer for his/her positive comments on our manuscript.

      It would definitely be interesting to see lack of breaching in the presence of crosslinking deficient Tau construct in order to rule out the off -target effect of Tau on microtubule and actin architecture which may possibly facilitate breaching.

      Authors answer:

      This is an interesting suggestion. Unfortunately, we do not have in hand such crosslinking deficient Tau construct. However, please note that we showed two independent ways to demonstrate the role of pressure. One is indeed by crosslinking microtubule to actin bundle with Tau, but the other is by blocking the two opposite ends of microtubules with two dense actin networks. So, we think our conclusion about the role of pressure is solid.

      The authors have also observed microtubule breaching into dense actin networks in living cells. However, in Figure 1C, better cell/ image processing might have been chosen to increase the visibility of actin structures that microtubules encounter on their way to breaching. In Figure S1D, for example, the similar actin structures in lamellipodia are very nicely visible.

      Authors answer:

      We apologize but we don’t understand reviewer’s comment. In figure 1C images of actin networks are shown in black and white and are more visible than in figure S1D where they are shown in magenta and overlaid with microtubules. In any case, we increased the contrast of images to make fine actin structures at the cell edge clearer.

      It is also interesting that on Figure 6A, actin bundles look different than the rest of the figures on the paper. It almost looks like actin bundles become branched, whereas in the other Figures actin bundles are either singular or two-three bundles joined together at the point very close to the edge of micropatterned lipid bilayer.

      Authors answer:

      This is correct. In this experiment several bundles co-aligned. As mentioned by the reviewer this could also be visible in other conditions without Tau (such as in Figure 4E), and, as shown below, this structure of bundle was not visible in all fields we looked at. So we don’t think this structure is responsible for the changes we measured in the ability of microtubules to penetrate the actin network in the presence of Tau.

      Minor comments<br /> In the legend of Figure 4E, it should be written "white arrow" instead of "yellow arrow".<br /> In the Results section "crosslinking between microtubules and actin bundles increase piercing frequency", in the sentence number 7, it should be written "backwards" instead of "reaward".

      Authors answer: We modified the text and legend according to the reviewer suggestions.

      Reviewer #1 (Significance):

      The experimental setup of the paper is quite significant in the field, given the difficulty of observing dynamics of dense cytoskeletal structures in living cells. Moreover, the paper gives insight into how microtubule behavior can vary depending on different morphological states of actin network.

      Authors answer: We thank the reviewer for his/her overall very positive feedback on our manuscript.

      Reviewer #2 (Evidence, reproducibility and clarity):

      The authors developed a novel in vitro system to investigate the interaction of dynamic microtubules with the F-actin network. While this system does produce some interesting results, it is unclear how exactly this replicates or explains what might happen near a cell's leading edge. There is a limited characterization of the produced F-actin networks. For example, it is unclear to what extent the F-actin networks are similar or different to cell lamellipodial networks. What is the density / expected mesh size of these networks and could that be varied / manipulated? The bottomline observation that microtubules can grow into F-actin networks if they have nowhere else to go does not seem particularly ground-breaking, and the discussion is very shallow. Overall writing could be improved; there are lots of typos and grammatical inconsistencies. The second paragraph of the introduction is a bit convoluted.

      Authors answer:

      We thank the reviewer for his/her comments. Figure 1 was used to illustrate the behavior of microtubules encountering actin networks in cells and the fact that they struggle to penetrate actin network. This is only a way to argue that the penetration of actin network is a relevant question, that cannot be easily addressed in cells. However, it is correct that our in vitro systems, as it is the case for all in vitro reconstituted systems, cannot tend exactly to reproduce a lamellipodial cellular network. But it offers a better way to modulate actin network architecture. We have used in vitro systems to characterize the different behavior of microtubules when they encounter dense actin networks in different conditions, guided or not by actin bundles, constraint or not at the two ends.

      The observation that microtubule can penetrate actin network when pressurized might not be “ground breaking”, still it contradicts previous works showing that microtubule under pressure tend to depolymerize (Janson et al, J Cell Biol, 2003), which would obviously prevent them from penetrating actin networks. So, our conclusion was somehow unexpected.

      We found important to discuss the fact that although the microtubule polymerizing forces is sufficient to breach dense actin network, it must be counteracted by another mechanism immobilizing microtubules. This means that in cells, expression level of actin-microtubule crosslinker modulate the penetration of microtubule into the lamellipodium.

      However, we agree that the second paragraph of the introduction is not absolutely necessary and removed it.

      Specific comments:

      Fig. 1 seems a bit anecdotal. The authors revisit an observation that has been made before. I can see how it is used as rationale for the in vitro system, but not sure that this adds much to the overall story. Clearly different cell types are different, but without some sort of quantification this remains meaningless. It should also be noted in the discussion maybe that there are large differences between cells in 2D and 3D. Microtubules much more frequently grow to the cell edge compared with 2D (see Akhmanova SLAIN2 paper from some years ago).

      Authors answer:

      We agree with these comments. Indeed, Figure 1 is used only as an illustration of the behavior of microtubules encountering actin network in cells. As the reviewer said, microtubule penetration and actin architectures will both vary a lot from one cell type to another. So we believe that quantification for these particular cases will not extend the illustrative purpose of this figure where it is already clear that some microtubules can penetrate and other can’t.

      Fig. 2: While Arp2/3 certainly promotes branched F-actin networks, from the data provided it is not clear to me to what extent the produced F-actin networks replicate F-actin organization at the cell edge. If this a the point the authors are trying to make, the ultrastructure of their in vitro networks needs some additional characterization. As far as it is possible to discern from the data provided, the F-actin meshwork on the stripes in E looks pretty much identical in both panels (and not really like a dendritic network that in a cell also would have a certain polarity with barbed ends facing out), and the bundles on the left don't look like anything that normally occurs in a cell.

      Authors answer:

      We also agree with these comments. The networks we assembled are not lamellipodial-like networks, there are branched network of various densities, with or without bundles. It is true that bundles of filaments do not grow out of lamellipodial network in cells. However, bundles of aligned and linear filaments exist in cells, in the form of radial fibers or transverse arcs, along which microtubule tend to align. And these structures might guide microtubules toward cell protrusions, as it is the case in growth cone for example.

      Fig. 4 It is unclear what is going on here. Given that without F-actin bundles, polymerizing microtubules are freely moving around, it does not come as a surprise that they would never penetrate the F-actin network because as the authors correctly state the growing end will push back from the barrier. So, then why do they sometimes penetrate when bundles are present? In 4A it appears that microtubule growth into f-actin only happens once the microtubule minus ends gets stuck between F-actin bundles on the other side. 4D is the same as 4A; so that makes me think this really does not occur that often. Does the microtubule plus end only penetrate the F-actin meshwork when the minus end gets stuck on the other side? This seems important and also means microtubule penetration may not have anything to do with the F-actin network architecture at the plus end. This needs to be quantified.

      Authors answer:

      This is perfectly correct. In figure 4 the two actin networks are distant, and the microtubules only rarely penetrate them because they are rarely in contact with them at both ends. This occurs only when bundles orient microtubules perpendicular to the edges of the actin network, since in this configuration the distance between the two actin networks is shorter. Hence our motivation to bring actin networks closer to each other in figure 5.

      Fig. 5 I guess that sort of solves my confusion with Fig. 4. The quantification graphs in 5B and 5C are flipped with respect to the figure legend (?).

      Authors answer:

      Indeed, in this figure we distinguished the role of pressure (when both microtubule ends are in contact with actin networks) and the role of alignment with actin bundles. And found that the presence of bundles is useless and that only pressure matters.

      I understand the rationale for not considering microtubules that grow at a shallow angle, but there does not seem to be that much of a difference between 5B and 5D. Wouldn't a better quantification simply compare microtubules that contact F-actin at both ends compared with microtubules were the minus end is free. In this case, I would expect a very large difference in penetration.

      Authors answer:

      This is also correct. The difference is so important that when one end is free the microtubule never penetrate. We mention it in the text but did not plot these data. This is why we measured only microtubule with both ends contacting an actin network and did not consider the one at shallow angles.

      We added the illustration of the condition with short distance and actin bundles (shown below) to make this more clear in the figure.

      The small difference between 5B and 5D shows that by eliminating those microtubules there is no more difference between the conditions with or without bundles. And thus that their contribution in favoring microtubule penetration was to favor optimal orientation to get pressurized at the two ends rather than offering a sort of favorable network organization at their base. However, we agree with the reviewer that the absence of difference between the two populations, with or without actin bundle, when considering only microtubule interacting with actin at angles higher than 30° is not quite striking. We tested all angles (see below) and found that actually the absence of difference is more obvious when considering microtubules interacting with more than 60°. And the analysis of angle distribution, now reported in Figure 5D, showed that in both conditions most microtubules interact with more than 60°, so we only exclude few outliers by considering those that interact with more than 60°. So we changed the presentation of our data in Figure 5C by changing the threshold from 30 to 60°.

      Do microtubules under pressure ever bend/buckle in this in vitro situation. As the authors state, in cells, that happens frequently. This difference is interesting. Why?

      In vitro microtubules buckle homogeneously between their two ends. These long buckling wavelengths are not very spectacular. In cells, microtubules are crosslinked to actin filaments or other structures over shorter distances (see quantification below). This leads to buckling with shorter wavelength, which is more striking.

      It is customary to refer to polymerized actin as F-actin.

      The supplementary videos are not referenced in the manuscript.

      Authors answer:

      We apologize and have now referenced the supplementary video in the manuscript.

      Reviewer #2 (Significance):

      The manuscript describes results from a novel assay to study interactions between F-actin networks and dynamic microtubules in vitro. While of interest to a specialized audience, the overall finding that microtubules can grow into an F-actin meshwork is somewhat incremental especially because of the limited characterization of the F-actin networks used. It remains unclear to what extent this is relevant to a physiological context in cells.

      My field of expertise is related to cytoskeleton dynamics and quantitative microscopy in live cells.

      Authors answer:

      Although intuitive, the demonstration that the density of actin network can prevent microtubule penetration is novel. More importantly, the demonstration that anchoring of microtubule is sufficient to increase the pressure to such a point that microtubule can then penetrate those networks is also novel and significant to appreciate when and how they do so in cells.

      Reviewer #3 (Evidence, reproducibility and clarity):

      In this paper, the authors present an in vitro assay designed to explore the dynamic interaction between growing microtubules and pre-existing actin networks. Notably, the presence of linear actin bundles facilitated the movement of polymerizing microtubules along actin filaments. When microtubules were immobilized to two spatially separated actin networks, they exhibited the ability to breach and penetrate dense actin meshworks. This penetration was attributed to the mechanical pressure generated by microtubule polymerization. The authors tested tau as a microtubule-actin crosslinking protein in this process and found that tau promoted microtubule penetration into dense actin meshwork. Although the findings in this paper are potentially significant, the work is still in its preliminary stage and the scope is limited.

      Authors answer:

      We thank the reviewer to summarize properly the main findings of our manuscript.

      1. The authors observed that the inclusion of tau, a microtubule-associated protein known for its role in promoting microtubule polymerization, significantly facilitated microtubule penetration into dense actin meshworks. This enhancement is likely attributed to tau's ability to promote microtubule polymerization, generating stronger forces within the microtubules that enable them to breach the actin meshworks. To validate the involvement of the crosslinking function in the process, the authors should explore the effects of other microtubule-actin crosslinking proteins in their assay.

      Authors answer:

      We thank the reviewer for this interesting suggestion regarding the role of Tau in our experiments. To address this comment, we have analyzed the rate of growth in our experiments in presence and absence of Tau (see quantification below). We found that the construction of Tau we used reduced microtubule growth rate. Therefore, we believe that microtubule growth was not responsible for the improved penetration of microtubule in dense actin networks in our assay, and that it was rather the crosslinking ability of Tau that played a significant role.

      1. The paper highlights the importance of anchoring both ends of microtubules to two adjacent actin networks for successful penetration into the actin meshworks. However, the precise mechanisms by which these microtubule ends are anchored to actin filaments are not elaborated upon. Providing detailed insights into this anchoring process would enhance the readers' comprehension of the experimental setup and its relevance to the observed results.

      Authors answer:

      We apologize for this lack of clarity. We don’t think that microtubule ends are “anchored” to the actin network. They are simply embedded into it. This embedding prevents them from moving rearward and thus lead to pressure increase as they polymerize.

      1. Additional information on the experimental methods is warranted to improve the reproducibility and clarity of the study. Specifically, the authors should elucidate the process through which nucleation-promoting factors were grafted onto lipid bilayers. This detail is crucial for researchers seeking to replicate or build upon the study's findings.

      Authors answer:

      We apologize for this lack of clarity. There was indeed an error in our description of SUV preparation with lipid-biotin. We have now revised our material and method section. In particular we have described more accurately the various steps we used to micropattern WA-streptavidin onto lipid-biotin.

      1. In Fig. 5D, the authors observed no significant difference in the breaching probability between microtubules that contacted the actin meshwork at an angle higher than 30°, with or without actin bundles. To ensure a better comparison, it is advisable to focus on quantifying the microtubules that are contacting two actin meshworks at both ends (the immobilized microtubules), as they would have similar probabilities of being pressurized by their growth. Moreover, further justification is required to explain the choice of 30° as the threshold angle and its significance in the context of microtubule behavior.

      Authors answer:

      We thank the reviewer for this comment. We apologize for the confusion. The quantification we made is precisely the one described by the reviewer. We made this more clear by adding further illustration of the two conditions and the measurement made.

      1. Fig. 5C appears to depict the "Distribution of the angle of the interaction of microtubules in the presence (10nM of Arp2/3 complex) or absence (100 nM of Arp2/3 complex) of actin bundles" instead of the "proportion of microtubules piercing the branched actin network." The alphabet labels in the figure should be updated accordingly. Additionally, the authors should clarify whether a comparison was conducted between the means of the angles in the two conditions and whether any observed differences were statistically significant.

      Authors answer:

      We apologize for this confusion. We updated the figure legend in which 5C and 5D were inverted.

      1. Investigating the potential significant difference in the mean interaction angles between the absence and presence of actin bundles would be intriguing. The presence of actin bundles might indeed influence the interaction angle or contact position, potentially increasing penetration frequency. This insight would further enrich the findings and provide valuable context for understanding the interplay between microtubules and actin networks.

      Authors answer:

      We apologize for this confusion. We now report the statistical difference. And indeed, it accounts for the difference it the penetration frequency, as shown by the absence of difference when we consider only microtubules that are more or less perpendicular to the network. This is indeed one of the most significant conclusion of our work. We added some schematics to make this clearer.

      1. More comprehensive information about the statistical analyses should be provided. This'd be important for the validity and reliability of the study's conclusions.

      Authors answer:

      We apologize for this lack of clarity. The statistical analysis we performed were not described in the Materials and Methods section but in each figure legend.

      Reviewer #3 (Significance):

      The work represents an advance in understanding the mechanism by which microtubules navigate dense actin meshworks.

      Authors answer:

      We thank the reviewer for this positive evaluation of our work.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In this paper, the authors present an in vitro assay designed to explore the dynamic interaction between growing microtubules and pre-existing actin networks. Notably, the presence of linear actin bundles facilitated the movement of polymerizing microtubules along actin filaments. When microtubules were immobilized to two spatially separated actin networks, they exhibited the ability to breach and penetrate dense actin meshworks. This penetration was attributed to the mechanical pressure generated by microtubule polymerization. The authors tested tau as a microtubule-actin crosslinking protein in this process and found that tau promoted microtubule penetration into dense actin meshwork. Although the findings in this paper are potentially significant, the work is still in its preliminary stage and the scope is limited.

      1. The authors observed that the inclusion of tau, a microtubule-associated protein known for its role in promoting microtubule polymerization, significantly facilitated microtubule penetration into dense actin meshworks. This enhancement is likely attributed to tau's ability to promote microtubule polymerization, generating stronger forces within the microtubules that enable them to breach the actin meshworks. To validate the involvement of the crosslinking function in the process, the authors should explore the effects of other microtubule-actin crosslinking proteins in their assay.
      2. The paper highlights the importance of anchoring both ends of microtubules to two adjacent actin networks for successful penetration into the actin meshworks. However, the precise mechanisms by which these microtubule ends are anchored to actin filaments are not elaborated upon. Providing detailed insights into this anchoring process would enhance the readers' comprehension of the experimental setup and its relevance to the observed results.
      3. Additional information on the experimental methods is warranted to improve the reproducibility and clarity of the study. Specifically, the authors should elucidate the process through which nucleation-promoting factors were grafted onto lipid bilayers. This detail is crucial for researchers seeking to replicate or build upon the study's findings.
      4. In Fig. 5D, the authors observed no significant difference in the breaching probability between microtubules that contacted the actin meshwork at an angle higher than 30{degree sign}, with or without actin bundles. To ensure a better comparison, it is advisable to focus on quantifying the microtubules that are contacting two actin meshworks at both ends (the immobilized microtubules), as they would have similar probabilities of being pressurized by their growth. Moreover, further justification is required to explain the choice of 30{degree sign} as the threshold angle and its significance in the context of microtubule behavior.
      5. Fig. 5C appears to depict the "Distribution of the angle of the interaction of microtubules in the presence (10nM of Arp2/3 complex) or absence (100 nM of Arp2/3 complex) of actin bundles" instead of the "proportion of microtubules piercing the branched actin network." The alphabet labels in the figure should be updated accordingly. Additionally, the authors should clarify whether a comparison was conducted between the means of the angles in the two conditions and whether any observed differences were statistically significant.
      6. Investigating the potential significant difference in the mean interaction angles between the absence and presence of actin bundles would be intriguing. The presence of actin bundles might indeed influence the interaction angle or contact position, potentially increasing penetration frequency. This insight would further enrich the findings and provide valuable context for understanding the interplay between microtubules and actin networks.
      7. More comprehensive information about the statistical analyses should be provided. This'd be important for the validity and reliability of the study's conclusions.

      Significance

      The work represents an advance in understanding the mechanism by which microtubules navigate dense actin meshworks.