- Jul 2024
-
www.sciencedirect.com www.sciencedirect.com
-
AB_2562553
DOI: 10.1016/j.celrep.2024.114532
Resource: (BioLegend Cat# 100228, RRID:AB_2562553)
Curator: @scibot
SciCrunch record: RRID:AB_2562553
-
AB_2934050
DOI: 10.1016/j.celrep.2024.114532
Resource: (Bio X Cell Cat# BP0101, RRID:AB_2934050)
Curator: @scibot
SciCrunch record: RRID:AB_2934050
-
RRID:IMSR_JAX:022974
DOI: 10.1016/j.celrep.2024.114532
Resource: (IMSR Cat# JAX_022974,RRID:IMSR_JAX:022974)
Curator: @scibot
SciCrunch record: RRID:IMSR_JAX:022974
-
RRID:IMSR_JAX:001800
DOI: 10.1016/j.celrep.2024.114532
Resource: (IMSR Cat# JAX_001800,RRID:IMSR_JAX:001800)
Curator: @scibot
SciCrunch record: RRID:IMSR_JAX:001800
-
RRID:IMSR_JAX:000651
DOI: 10.1016/j.celrep.2024.114532
Resource: (IMSR Cat# JAX_000651,RRID:IMSR_JAX:000651)
Curator: @scibot
SciCrunch record: RRID:IMSR_JAX:000651
-
RRID:CVCL_5998
DOI: 10.1016/j.celrep.2024.114532
Resource: (RRID:CVCL_5998)
Curator: @scibot
SciCrunch record: RRID:CVCL_5998
-
RRID:CVCL_0125
DOI: 10.1016/j.celrep.2024.114532
Resource: (ATCC Cat# CRL-2539, RRID:CVCL_0125)
Curator: @scibot
SciCrunch record: RRID:CVCL_0125
-
-
www.sciencedirect.com www.sciencedirect.com
-
AB_2100412
DOI: 10.1016/j.stem.2024.06.015
Resource: (R and D Systems Cat# PP-H6705-00, RRID:AB_2100412)
Curator: @scibot
SciCrunch record: RRID:AB_2100412
-
AB_2940888
DOI: 10.1016/j.stem.2024.06.015
Resource: AB_2940888
Curator: @scibot
SciCrunch record: RRID:AB_2940888
-
AB_10011593
DOI: 10.1016/j.stem.2024.06.015
Resource: (Novus Cat# NBP1-49538, RRID:AB_10011593)
Curator: @scibot
SciCrunch record: RRID:AB_10011593
-
RRID:SCR_011867
DOI: 10.1016/j.stem.2024.06.015
Resource: htseq-count (RRID:SCR_011867)
Curator: @scibot
SciCrunch record: RRID:SCR_011867
-
RRID:SCR_013035
DOI: 10.1016/j.stem.2024.06.015
Resource: TopHat (RRID:SCR_013035)
Curator: @scibot
SciCrunch record: RRID:SCR_013035
-
RRID:SCR_003302
DOI: 10.1016/j.stem.2024.06.015
Resource: Weighted Gene Co-expression Network Analysis (RRID:SCR_003302)
Curator: @scibot
SciCrunch record: RRID:SCR_003302
-
RRID:SCR_009803
DOI: 10.1016/j.stem.2024.06.015
Resource: Subread (RRID:SCR_009803)
Curator: @scibot
SciCrunch record: RRID:SCR_009803
-
RRID:SCR_004463
DOI: 10.1016/j.stem.2024.06.015
Resource: rna-star (RRID:SCR_004463)
Curator: @scibot
SciCrunch record: RRID:SCR_004463
-
RRID:SCR_017048
DOI: 10.1016/j.stem.2024.06.015
Resource: UMI-tools (RRID:SCR_017048)
Curator: @scibot
SciCrunch record: RRID:SCR_017048
-
RRID:SCR_015687
DOI: 10.1016/j.stem.2024.06.015
Resource: DESeq2 (RRID:SCR_015687)
Curator: @scibot
SciCrunch record: RRID:SCR_015687
-
RRID:SCR_016341
DOI: 10.1016/j.stem.2024.06.015
Resource: Seurat (RRID:SCR_016341)
Curator: @scibot
SciCrunch record: RRID:SCR_016341
-
RRID:SCR_002285
DOI: 10.1016/j.stem.2024.06.015
Resource: Fiji (RRID:SCR_002285)
Curator: @scibot
SciCrunch record: RRID:SCR_002285
-
RRID:SCR_015052
DOI: 10.1016/j.stem.2024.06.015
Resource: SnapGene (RRID:SCR_015052)
Curator: @scibot
SciCrunch record: RRID:SCR_015052
-
-
www.sciencedirect.com www.sciencedirect.com
-
AB_355728
DOI: 10.1016/j.celrep.2024.114527
Resource: (R and D Systems Cat# AF941, RRID:AB_355728)
Curator: @scibot
SciCrunch record: RRID:AB_355728
-
AB_10861912
DOI: 10.1016/j.celrep.2024.114527
Resource: AB_10861912
Curator: @scibot
SciCrunch record: RRID:AB_10861912
-
AB_2799337
DOI: 10.1016/j.celrep.2024.114527
Resource: (Cell Signaling Technology Cat# 48367, RRID:AB_2799337)
Curator: @scibot
SciCrunch record: RRID:AB_2799337
-
AB_2336031
DOI: 10.1016/j.celrep.2024.114527
Resource: AB_2334835
Curator: @scibot
SciCrunch record: RRID:AB_2334835
-
AB_2142367
DOI: 10.1016/j.celrep.2024.114527
Resource: (Agilent Cat# M7240, RRID:AB_2142367)
Curator: @scibot
SciCrunch record: RRID:AB_2142367
-
AB_354736
DOI: 10.1016/j.celrep.2024.114527
Resource: (R and D Systems Cat# AF1329, RRID:AB_354736)
Curator: @scibot
SciCrunch record: RRID:AB_354736
-
AB_1563968
DOI: 10.1016/j.celrep.2024.114527
Resource: (Santa Cruz Biotechnology Cat# sc-1496, RRID:AB_1563968)
Curator: @scibot
SciCrunch record: RRID:AB_1563968
-
AB_632611
DOI: 10.1016/j.celrep.2024.114527
Resource: (Santa Cruz Biotechnology Cat# sc-192, RRID:AB_632611)
Curator: @scibot
SciCrunch record: RRID:AB_632611
-
AB_2315192
DOI: 10.1016/j.celrep.2024.114527
Resource: (Agilent Cat# A0098, RRID:AB_2315192)
Curator: @scibot
SciCrunch record: RRID:AB_2315192
-
AB_631470
DOI: 10.1016/j.celrep.2024.114527
Resource: (Santa Cruz Biotechnology Cat# sc-542, RRID:AB_631470)
Curator: @scibot
SciCrunch record: RRID:AB_631470
-
RRID:SCR_019874
DOI: 10.1016/j.celrep.2024.114527
Resource: Essen Incucyte Incucyte (RRID:SCR_019874)
Curator: @scibot
SciCrunch record: RRID:SCR_019874
-
RRID:SCR_003070
DOI: 10.1016/j.celrep.2024.114527
Resource: ImageJ (RRID:SCR_003070)
Curator: @scibot
SciCrunch record: RRID:SCR_003070
-
RRID:SCR_001905
DOI: 10.1016/j.celrep.2024.114527
Resource: R Project for Statistical Computing (RRID:SCR_001905)
Curator: @scibot
SciCrunch record: RRID:SCR_001905
-
RRID:SCR_002798
DOI: 10.1016/j.celrep.2024.114527
Resource: GraphPad Prism (RRID:SCR_002798)
Curator: @scibot
SciCrunch record: RRID:SCR_002798
-
-
www.sciencedirect.com www.sciencedirect.com
-
RRID:IMSR_JAX:028288
DOI: 10.1016/j.celrep.2024.114542
Resource: (IMSR Cat# JAX_028288,RRID:IMSR_JAX:028288)
Curator: @scibot
SciCrunch record: RRID:IMSR_JAX:028288
-
AB_313683
DOI: 10.1016/j.celrep.2024.114542
Resource: (BioLegend Cat# 115904, RRID:AB_313683)
Curator: @scibot
SciCrunch record: RRID:AB_313683
-
RRID:IMSR_JAX:037115
DOI: 10.1016/j.celrep.2024.114542
Resource: IMSR_JAX:037115
Curator: @scibot
SciCrunch record: RRID:IMSR_JAX:037115
-
RRID:IMSR_JAX:028288
DOI: 10.1016/j.celrep.2024.114542
Resource: (IMSR Cat# JAX_028288,RRID:IMSR_JAX:028288)
Curator: @scibot
SciCrunch record: RRID:IMSR_JAX:028288
-
RRID:IMSR_JAX:004781
DOI: 10.1016/j.celrep.2024.114542
Resource: (IMSR Cat# JAX_004781,RRID:IMSR_JAX:004781)
Curator: @scibot
SciCrunch record: RRID:IMSR_JAX:004781
-
RRID:IMSR_JAX:037115
DOI: 10.1016/j.celrep.2024.114542
Resource: IMSR_JAX:037115
Curator: @scibot
SciCrunch record: RRID:IMSR_JAX:037115
-
RRID:IMSR_JAX:008610
DOI: 10.1016/j.celrep.2024.114542
Resource: (IMSR Cat# JAX_008610,RRID:IMSR_JAX:008610)
Curator: @scibot
SciCrunch record: RRID:IMSR_JAX:008610
-
RRID:IMSR_JAX:004781
DOI: 10.1016/j.celrep.2024.114542
Resource: (IMSR Cat# JAX_004781,RRID:IMSR_JAX:004781)
Curator: @scibot
SciCrunch record: RRID:IMSR_JAX:004781
-
RRID:IMSR_JAX:008610
DOI: 10.1016/j.celrep.2024.114542
Resource: (IMSR Cat# JAX_008610,RRID:IMSR_JAX:008610)
Curator: @scibot
SciCrunch record: RRID:IMSR_JAX:008610
-
RRID:IMSR_JAX:006965
DOI: 10.1016/j.celrep.2024.114542
Resource: (IMSR Cat# JAX_006965,RRID:IMSR_JAX:006965)
Curator: @scibot
SciCrunch record: RRID:IMSR_JAX:006965
-
-
www.sciencedirect.com www.sciencedirect.com
-
BDSC:40907
DOI: 10.1016/j.devcel.2024.06.022
Resource: RRID:BDSC_40907
Curator: @scibot
SciCrunch record: RRID:BDSC_40907
-
BDSC:14670
DOI: 10.1016/j.devcel.2024.06.022
Resource: RRID:BDSC_14670
Curator: @scibot
SciCrunch record: RRID:BDSC_14670
-
BDSC:81118
DOI: 10.1016/j.devcel.2024.06.022
Resource: RRID:BDSC_81118
Curator: @scibot
SciCrunch record: RRID:BDSC_81118
-
BDSC:62216
DOI: 10.1016/j.devcel.2024.06.022
Resource: RRID:BDSC_62216
Curator: @scibot
SciCrunch record: RRID:BDSC_62216
-
BDSC:40845
DOI: 10.1016/j.devcel.2024.06.022
Resource: RRID:BDSC_40845
Curator: @scibot
SciCrunch record: RRID:BDSC_40845
-
BDSC:40846
DOI: 10.1016/j.devcel.2024.06.022
Resource: RRID:BDSC_40846
Curator: @scibot
SciCrunch record: RRID:BDSC_40846
-
RRID:AB_321239
DOI: 10.1016/j.devcel.2024.06.022
Resource: AB_321239
Curator: @scibot
SciCrunch record: RRID:AB_321239
-
RRID:AB_528203
DOI: 10.1016/j.devcel.2024.06.022
Resource: (DSHB Cat# 4F3 anti-discs large, RRID:AB_528203)
Curator: @scibot
SciCrunch record: RRID:AB_528203
-
RRID:AB_259989
DOI: 10.1016/j.devcel.2024.06.022
Resource: (Sigma-Aldrich Cat# G9282, RRID:AB_259989)
Curator: @scibot
SciCrunch record: RRID:AB_259989
-
RRID:AB_430864
DOI: 10.1016/j.devcel.2024.06.022
Resource: (Promega Cat# V7931, RRID:AB_430864)
Curator: @scibot
SciCrunch record: RRID:AB_430864
-
RRID:AB_10950495
DOI: 10.1016/j.devcel.2024.06.022
Resource: (Cell Signaling Technology Cat# 8146, RRID:AB_10950495)
Curator: @scibot
SciCrunch record: RRID:AB_10950495
-
RRID:AB_439701
DOI: 10.1016/j.devcel.2024.06.022
Resource: (Sigma-Aldrich Cat# F4049, RRID:AB_439701)
Curator: @scibot
SciCrunch record: RRID:AB_439701
-
RRID:AB_2721060
DOI: 10.1016/j.devcel.2024.06.022
Resource: (Cell Signaling Technology Cat# 9578, RRID:AB_2721060)
Curator: @scibot
SciCrunch record: RRID:AB_2721060
-
-
www.sciencedirect.com www.sciencedirect.com
-
AB_2118291
DOI: 10.1016/j.immuni.2024.06.015
Resource: (Abcam Cat# ab4729, RRID:AB_2118291)
Curator: @scibot
SciCrunch record: RRID:AB_2118291
-
AB_11217883
DOI: 10.1016/j.immuni.2024.06.015
Resource: AB_11217883
Curator: @scibot
SciCrunch record: RRID:AB_11217883
-
AB_326513
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 400407, RRID:AB_326513)
Curator: @scibot
SciCrunch record: RRID:AB_326513
-
AB_2940825
DOI: 10.1016/j.immuni.2024.06.015
Resource: (Bioss Cat# bs-0295G-AF594, RRID:AB_2940825)
Curator: @scibot
SciCrunch record: RRID:AB_2940825
-
AB_10562581
DOI: 10.1016/j.immuni.2024.06.015
Resource: (Molecular Probes Cat# A-21244, RRID:AB_2535812)
Curator: @scibot
SciCrunch record: RRID:AB_2535812
-
AB_2869560
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BD Biosciences Cat# 564293, RRID:AB_2869560)
Curator: @scibot
SciCrunch record: RRID:AB_2869560
-
AB_2658239
DOI: 10.1016/j.immuni.2024.06.015
Resource: AB_2658239
Curator: @scibot
SciCrunch record: RRID:AB_2658239
-
AB_2873123
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BD Biosciences Cat# 748719, RRID:AB_2873123)
Curator: @scibot
SciCrunch record: RRID:AB_2873123
-
AB_571945
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 317416, RRID:AB_571945)
Curator: @scibot
SciCrunch record: RRID:AB_571945
-
AB_2562910
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 302636, RRID:AB_2562910)
Curator: @scibot
SciCrunch record: RRID:AB_2562910
-
AB_2873697
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BD Biosciences Cat# 749323, RRID:AB_2873697)
Curator: @scibot
SciCrunch record: RRID:AB_2873697
-
AB_2137788
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 116223, RRID:AB_2137788)
Curator: @scibot
SciCrunch record: RRID:AB_2137788
-
AB_2629563
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 109241, RRID:AB_2629563)
Curator: @scibot
SciCrunch record: RRID:AB_2629563
-
AB_11219388
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 644817, RRID:AB_11219388)
Curator: @scibot
SciCrunch record: RRID:AB_11219388
-
AB_2561447
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 135218, RRID:AB_2561447)
Curator: @scibot
SciCrunch record: RRID:AB_2561447
-
AB_830870
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 108723, RRID:AB_830870)
Curator: @scibot
SciCrunch record: RRID:AB_830870
-
AB_10640819
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 127624, RRID:AB_10640819)
Curator: @scibot
SciCrunch record: RRID:AB_10640819
-
AB_10640120
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 128026, RRID:AB_10640120)
Curator: @scibot
SciCrunch record: RRID:AB_10640120
-
AB_2629721
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 138427, RRID:AB_2629721)
Curator: @scibot
SciCrunch record: RRID:AB_2629721
-
AB_2564050
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 138423, RRID:AB_2564050)
Curator: @scibot
SciCrunch record: RRID:AB_2564050
-
AB_2563005
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 646404, RRID:AB_2563005)
Curator: @scibot
SciCrunch record: RRID:AB_2563005
-
AB_493727
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 107622, RRID:AB_493727)
Curator: @scibot
SciCrunch record: RRID:AB_493727
-
AB_1659252
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 107627, RRID:AB_1659252)
Curator: @scibot
SciCrunch record: RRID:AB_1659252
-
AB_763561
DOI: 10.1016/j.immuni.2024.06.015
Resource: (Thermo Fisher Scientific Cat# 12-7133-81, RRID:AB_763561)
Curator: @scibot
SciCrunch record: RRID:AB_763561
-
AB_11220280
DOI: 10.1016/j.immuni.2024.06.015
Resource: (Thermo Fisher Scientific Cat# 50-7177-82, RRID:AB_11220280)
Curator: @scibot
SciCrunch record: RRID:AB_11220280
-
AB_2573530
DOI: 10.1016/j.immuni.2024.06.015
Resource: (Thermo Fisher Scientific Cat# 25-7133-82, RRID:AB_2573530)
Curator: @scibot
SciCrunch record: RRID:AB_2573530
-
AB_315318
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 504104, RRID:AB_315318)
Curator: @scibot
SciCrunch record: RRID:AB_315318
-
AB_11219588
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 505835, RRID:AB_11219588)
Curator: @scibot
SciCrunch record: RRID:AB_11219588
-
AB_2565990
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 137236, RRID:AB_2565990)
Curator: @scibot
SciCrunch record: RRID:AB_2565990
-
AB_2563221
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 653814, RRID:AB_2563221)
Curator: @scibot
SciCrunch record: RRID:AB_2563221
-
AB_763537
DOI: 10.1016/j.immuni.2024.06.015
Resource: (Thermo Fisher Scientific Cat# 53-5773-82, RRID:AB_763537)
Curator: @scibot
SciCrunch record: RRID:AB_763537
-
AB_893477
DOI: 10.1016/j.immuni.2024.06.015
Resource: (BioLegend Cat# 123118, RRID:AB_893477)
Curator: @scibot
SciCrunch record: RRID:AB_893477
Tags
- RRID:AB_2561447
- RRID:AB_893477
- RRID:AB_2564050
- RRID:AB_1659252
- RRID:AB_2629721
- RRID:AB_10640120
- RRID:AB_2563221
- RRID:AB_326513
- RRID:AB_571945
- RRID:AB_763561
- RRID:AB_2869560
- RRID:AB_763537
- RRID:AB_2658239
- RRID:AB_830870
- RRID:AB_11219588
- RRID:AB_11217883
- RRID:AB_2118291
- RRID:AB_2940825
- RRID:AB_2535812
- RRID:AB_2873697
- RRID:AB_2873123
- RRID:AB_2562910
- RRID:AB_11219388
- RRID:AB_2563005
- RRID:AB_11220280
- RRID:AB_2573530
- RRID:AB_2565990
- RRID:AB_10640819
- RRID:AB_315318
- RRID:AB_2629563
- RRID:AB_493727
- RRID:AB_2137788
Annotators
URL
-
-
www.sciencedirect.com www.sciencedirect.com
-
BDSC# 38637
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_38637
Curator: @scibot
SciCrunch record: RRID:BDSC_38637
-
BDSC# 68156
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_68156
Curator: @scibot
SciCrunch record: RRID:BDSC_68156
-
BDSC# 37749
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_37749
Curator: @scibot
SciCrunch record: RRID:BDSC_37749
-
BDSC# 3605
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_3605
Curator: @scibot
SciCrunch record: RRID:BDSC_3605
-
BDSC:6657
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_6657
Curator: @scibot
SciCrunch record: RRID:BDSC_6657
-
BDSC:38637
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_38637
Curator: @scibot
SciCrunch record: RRID:BDSC_38637
-
BDSC:31902
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_31902
Curator: @scibot
SciCrunch record: RRID:BDSC_31902
-
BDSC:68156
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_68156
Curator: @scibot
SciCrunch record: RRID:BDSC_68156
-
BDSC:77932
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_77932
Curator: @scibot
SciCrunch record: RRID:BDSC_77932
-
BDSC:37749
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_37749
Curator: @scibot
SciCrunch record: RRID:BDSC_37749
-
BDSC:28881
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_28881
Curator: @scibot
SciCrunch record: RRID:BDSC_28881
-
BDSC:8529
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_8529
Curator: @scibot
SciCrunch record: RRID:BDSC_8529
-
BDSC:3605
DOI: 10.1016/j.devcel.2024.06.020
Resource: RRID:BDSC_3605
Curator: @scibot
SciCrunch record: RRID:BDSC_3605
-
AB_2534096
DOI: 10.1016/j.devcel.2024.06.020
Resource: (Thermo Fisher Scientific Cat# A-11039, RRID:AB_2534096)
Curator: @scibot
SciCrunch record: RRID:AB_2534096
-
AB_143157
DOI: 10.1016/j.devcel.2024.06.020
Resource: (Molecular Probes Cat# A-11011, RRID:AB_143157)
Curator: @scibot
SciCrunch record: RRID:AB_143157
-
-
www.sciencedirect.com www.sciencedirect.com
-
Plasmid_108681
DOI: 10.1016/j.cell.2024.06.039
Resource: Addgene_108681
Curator: @scibot
SciCrunch record: RRID:Addgene_108681
-
-
www.ncbi.nlm.nih.gov www.ncbi.nlm.nih.gov
-
Jackson Laboratory Cat_022071
DOI: 10.1016/j.isci.2024.110290
Resource: (IMSR Cat# JAX_022071,RRID:IMSR_JAX:022071)
Curator: @evieth
SciCrunch record: RRID:IMSR_JAX:022071
-
Jackson Laboratory Cat_006148
DOI: 10.1016/j.isci.2024.110290
Resource: (IMSR Cat# JAX_006148,RRID:IMSR_JAX:006148)
Curator: @evieth
SciCrunch record: RRID:IMSR_JAX:006148
-
Jackson Laboratory Cat_007001
DOI: 10.1016/j.isci.2024.110290
Resource: (IMSR Cat# JAX_007001,RRID:IMSR_JAX:007001)
Curator: @evieth
SciCrunch record: RRID:IMSR_JAX:007001
-
Jackson Laboratory Cat_016617
DOI: 10.1016/j.isci.2024.110290
Resource: (IMSR Cat# JAX_016617,RRID:IMSR_JAX:016617)
Curator: @evieth
SciCrunch record: RRID:IMSR_JAX:016617
-
Jackson Laboratory Cat_002014
DOI: 10.1016/j.isci.2024.110290
Resource: (IMSR Cat# JAX_002014,RRID:IMSR_JAX:002014)
Curator: @evieth
SciCrunch record: RRID:IMSR_JAX:002014
-
Jackson Laboratory Cat_000664
DOI: 10.1016/j.isci.2024.110290
Resource: (IMSR Cat# JAX_000664,RRID:IMSR_JAX:000664)
Curator: @evieth
SciCrunch record: RRID:IMSR_JAX:000664
-
-
www.sciencedirect.com www.sciencedirect.com
-
RRID:IMSR_JAX
DOI: 10.1016/j.devcel.2024.06.016
Resource: (IMSR Cat# JAX_000664,RRID:IMSR_JAX:000664)
Curator: @vtello
SciCrunch record: RRID:IMSR_JAX:000664
-
-
52.53.155.43 52.53.155.43
-
RRID:Addgene_649
DOI: 10.1016/j.isci.2024.110560
Resource: RRID:Addgene_64992
Curator: @vtello
SciCrunch record: RRID:Addgene_64992
-
-
www.sciencedirect.com www.sciencedirect.com
-
RRID:12-370
DOI: 10.1016/j.molcel.2024.06.032
Resource: (Millipore Cat# 12-370, RRID:AB_145841)
Curator: @vtello
SciCrunch record: RRID:AB_145841
-
-
www.sciencedirect.com www.sciencedirect.com
-
RRID:SCR_0011626
DOI: 10.1016/j.celrep.2024.114416
Resource: Shiny (RRID:SCR_001626)
Curator: @vtello
SciCrunch record: RRID:SCR_001626
-
-
www.sciencedirect.com www.sciencedirect.com
-
AB_2861198273
DOI: 10.1016/j.immuni.2024.06.014
Resource: (BD Biosciences Cat# 742164, RRID:AB_2861198)
Curator: @vtello
SciCrunch record: RRID:AB_2861198
-
-
www.sciencedirect.com www.sciencedirect.com
-
Jackson Laboratory Cat_017586
DOI: 10.1016/j.immuni.2024.06.016
Resource: (IMSR Cat# JAX_017586,RRID:IMSR_JAX:017586)
Curator: @vtello
SciCrunch record: RRID:IMSR_JAX:017586
-
Jackson Laboratory Cat_005693
DOI: 10.1016/j.immuni.2024.06.016
Resource: IMSR_JAX:00569
Curator: @vtello
SciCrunch record: RRID:IMSR_JAX:00569
-
-
www.sciencedirect.com www.sciencedirect.com
-
RRID:IMSR_JAX
DOI: 10.1016/j.neuint.2024.105809
Resource: (IMSR Cat# JAX_004947,RRID:IMSR_JAX:004947)
Curator: @vtello
SciCrunch record: RRID:IMSR_JAX:004947
-
-
www.sciencedirect.com www.sciencedirect.com
-
RRID:IMSR_JAX
DOI: 10.1016/j.xcrm.2024.101658
Resource: (IMSR Cat# JAX_030201,RRID:IMSR_JAX:030201)
Curator: @vtello
SciCrunch record: RRID:IMSR_JAX:030201
-
-
www.sciencedirect.com www.sciencedirect.com
-
AB_281528
DOI: 10.1016/j.celrep.2024.114506
Resource: AB_2815281
Curator: @vtello
SciCrunch record: RRID:AB_2815281
-
-
www.ncbi.nlm.nih.gov www.ncbi.nlm.nih.gov
-
RRID:AB_2314867
DOI: 10.1101/2023.01.17.524447
Resource: (DSHB Cat# nc82, RRID:AB_2314866)
Curator: @bandrow
SciCrunch record: RRID:AB_2314866
-
-
www.youtube.com www.youtube.com
-
how to SOUNDPROOF a typewriter by [[Just My Typewriter]]
She uses piano felt to restore the original felt rests of a Smith-Corona Skyriter. Technically not soundproofing, but restoration. We get the point.
-
-
www.youtube.com www.youtube.com
-
Mr. Sinister- Remington All New Typewriter- Custom Painted and Typing Like a Dream by [[The HotRod Typewriter Co.]]
Tags
Annotators
URL
-
-
emmarshall.github.io emmarshall.github.io
-
opponent-process theory
-
The three types of cones are each receptive to one of the colors.
-
-
emmarshall.github.io emmarshall.github.io
-
Lucid dreams are dreams in which certain aspects of wakefulness are maintained during a dream state. In a lucid dream, a person becomes aware of the fact that they are dreaming, and as such, they can control the dream’s content
This fact is very troubling to me because I absolutely hate these dreams and they are so funky to me. When I wake up from a dream like this I feel like I was in a different universe and I am very confused when I wake up.
-
-
emmarshall.github.io emmarshall.github.io
-
Sleep is also associated with the secretion and regulation of a number of hormones from several endocrine glands including: melatonin, follicle stimulating hormone (FSH), luteinizing hormone (LH), and growth hormone
This is a very interesting fact to know that sleep can affect the hormones we produce. I know sleep can cause and contribute to many things however i did not know this was also caused by it.
-
-
emmarshall.github.io emmarshall.github.io
-
The suprachiasmatic nucleus (SCN) serves as the brain’s clock mechanism. The clock sets itself with light information received through projections from the retina.
This was a surprising fact for me. I never knew how this all worked for us. I am curious about our brain's clock when waking up especially when the sun has not come up yet. I always thought our bodies naturally got tired after a certain amount of time.
-
Some research suggests that sleep deprivation affects cognitive and motor function as much as, if not more than, alcohol intoxication
I think this is very troubling. There is a lot of education we get about avoiding drunk driving and there are a lot of people who feel very strongly against it. It is scary to think that being fatigued can be even more dangerous, when I feel like it may be more common than intoxicated driving. There is also a lot less of a public opinion about sleep deprived driving and sleep deprived people could be on the road any time of the day.
-
-
www.sec.gov www.sec.gov
-
Mizuho Markets Americas LLC
mizuho
-
-
opentext.uoregon.edu opentext.uoregon.edu
-
When
Question for Rayne about font size.
-
-
openurl.ebsco.com openurl.ebsco.com
-
Staff Statement
Staff Indonesian Government
-
-
ps.zoethical.org ps.zoethical.org
-
je ne comprends pas cet article qui ne cite pas le document source. dans la stratégie horizon europe 2025-2027 NGI est bien cité
-
-
runestone.academy runestone.academy
-
%
one way to think about it " if divide x by y, what is the remainder?"
-
-
www.estadao.com.br www.estadao.com.br
-
Segundo os executivos, a inteligência artificial funciona agora como um facilitador para as pessoas criarem valores inéditos juntas. Mas, para isso, as empresas precisam reorganizar seus modelos operacionais para dar autonomia e flexibilidade aos profissionais. Devem também ampliar sua educação para usos conscientes dos dados e da IA. Por fim, precisam distribuir autoridade e responsabilidade para que todos atuem com um propósito bem definido, em todos os níveis da
Ao contrário do que muitos pensam e receiam, a inteligência artificial não substitui e nunca substituirá o trabalho humanos, afinal, como o trecho destacado afirma, a IA é uma ferramenta facilitadora que pode ser usada em diversas atividades e ramos. Quando bem utilizada, pode potencializar a capacidade criativa de profissionais e estudantes, e por isso é tão importante uma educação para o uso adequado da IA.
-
-
-
Next Generation Internet Fun
removed in 2025? https://pad.public.cat/lettre-NCP-NGI?both
-
-
pluralistic.net pluralistic.net
-
Daily links from Cory Doctorow by [[Cory Doctorow]] 2024-02-19
-
-
www.open.edu www.open.edu
-
Woman has ovaries and a uterus; such are the particular conditions that lock her in her subjectivity; some even say she thinks with her hormones. Man vainly forgets that his anatomy also includes hormones and testicles. He grasps his body as a direct and normal link with the world that he believes he apprehends in all objectivity, whereas he considers woman’s body an obstacle, a prison, burdened by everything that particularises it. ‘The female is female by virtue of a certain lack of qualities,’ Aristotle said. ‘We should regard women’s nature as suffering from natural defectiveness.’ And St Thomas in his turn decreed that woman was an ‘incomplete man’, an ‘incidental’ being. This is what the Genesis story symbolises, where Eve appears as if drawn from Adam’s ‘supernumerary’ bone, in Bossuet’s words. Humanity is male, and man defines woman, not in herself, but in relation to himself; she is not considered an autonomous being.
to be a woman is to be other; the idea of a woman is a a male concept
-
-
danallosso.substack.com danallosso.substack.com
-
I've felt guilty in the past that often we don't directly discuss the book and what it says, but since we've each individually had our own "conversations with the author", our sessions then become a method of taking those extant (hidden discussions) and bringing them to a group to have not only discussions with each other, but extend those discussions with other books we've read and connecting them with reading, watching, listening we've done with other sources. In some sense, we're creating connections (conversations) with all the other things rather than necessarily discussing the exact thing at hand. This is a different form of work than the work of the initial discussion we individually have with the author (in this case Adrian Johns) and this is something many book groups don't go past.
I don't feel so guilty about it anymore...
-
https://danallosso.substack.com/p/science-of-reading-meeting-1<br /> Science of Reading, Meeting 1
-
-
www.biorxiv.org www.biorxiv.org
-
Abstract
I enjoyed this paper! I'm excited to try detecting tyrosine phosphorylation using Raman in my own work. I have a couple of general suggestions: one is to use color (or add clearer keys) in the figures to differentiate between HER2+ and HER2- cell types, so that it is easier to understand the results. I also think this paper could use another round of general copyediting - Grammarly offers a free version of their software that can make this step very fast.
-
No ligands for HER2 have yet been identified yet. 21 22 and dimerization with any of the other three subdomains is considered to activate HER2. 23 The dimerization in the extracellular region of HER2 induces intracellular conformational changes that trigger tyrosine kinase activation.
This sentence is included verbatim in the introduction.
-
Fig. 9 shows average normalized Raman intensity at 1618 cm-1 at membranes (A,B) and mitochondria (B) in breast cancer cells: triple-positive MCF-7 (B), (HTB-30) and AU-565 (C) overexpressing HER2, the normal cells (MCF-10A) (HER2 at the normal level) and triple - negative aggressive breast cancer (MDA-MB-231)
I'm not sure what the letters in parentheses refer to here.
-
One can see that that the highest concentration of cytochrome c represented by the vibration at 1584 cm-1 is located in mitochondria and support the results reported recently1
The link for this citation is missing, but I would like to read it!
-
Raman spectra of a typical breast cancer cell (HTB-30) for the cell organelles (nucleus (red), endoplasmic reticulum (blue), lipid droplets (orange), cytoplasm (green), mitochondria (magenta), membrane (light grey).
For Figs 5 and 6, it would be helpful to include descriptions of each panel in the description & reference them directly in the text.
-
The presented in Fig. 7 cells have HER2 protein expression on the surface of the cell that belongs to a family of receptor tyrosine kinases (RTKs) and consists of an extracellular domain that includes four subdomains (I-IV) [16], a single helix transmembrane lipophilic segment and an intracellular region that contains a tyrosine kinase domain (TKD).
I'm not sure why this is mentioned here, it is established in the introduction. Unless this is implying that you can acquire all of this info directly from the Raman spectra?
-
Fig. 5C shows the Raman bands of cytochrome c at 1582 cm-1 and amide I at 1656 cm-1 of a typical breast cancer cell (HTB-30).
I believe this sentence is actually referencing Fig 5B.
-
As it is well known these processes regulate efficiency of the oxidative phosphorylation and is directly related to many human diseases, including cancer, through a lack of energy, ROS production, cytochrome c release, and activation of apoptosis.
I think this sentence may also have a typo - there is no follow up phrase to "As it is well known that X..." What did this knowledge lead you to?
-
It has been proposed that reversible phosphorylation of cytochrome c mediated by cell signaling pathways is primary regulatory mechanism in living species that determines mitochondrial respiration, electron transport chain (ETC) flux, proton gradient ΔΨm, ATP production, and ROS generation
Proposed by who? I think this claim could use a citation so that readers can look further into the evidence supporting it.
-
Our data demonstrate that Raman based methods for HER2 quantitation of HER2 may offer significant progress in patient selection for HER2 targeted therapy over conventional HER2 identification.
I think this sentence may have a typo - it says "HER2 quantitation of HER2," rather than just "quantitation of HER2" or "HER2 quantitation."
-
-
en.wikipedia.org en.wikipedia.org
-
Thermouthis
@JOE HAHA
-
-
en.wikipedia.org en.wikipedia.org
-
because chatGPT said it was "El and the Royal Navy of Australia"
((( literally, literally, literally, that is how I read, and when I read things, it's important, because this is all about
Arnutet
which you might call Ultima Thule, or Elseum or ... "Far Points Station;" or if you are up on the new lingo, you might be calling it the military outpost related to the Venutian Alexandria, which I apparently have still failed to sell rights of name to from Jessup to Virgin, or we'd be calling it the Virgin Alexandria by now.
Who is Nathan Jessup?
Alex?
[
Ernutet Crater - Enhanced Color - Jet Propulsion Laboratory
NASA Jet Propulsion Laboratory (.gov)
https://www.jpl.nasa.gov › images › pia21419-ernutet-c...
](https://www.jpl.nasa.gov/images/pia21419-ernutet-crater-enhanced-color)
[
](https://www.jpl.nasa.gov/images/pia21419-ernutet-crater-enhanced-color)
Feb 16, 2017 --- ... aboard NASA's Dawn spacecraft, shows the area around Ernutet crater. The bright red portions appear redder with respect to the rest of Ceres.
Missing: ~~arnutet~~ | Show results with: arnutet
People also ask
Why does Ceres have bright spots?
What is the structure and composition of Ceres?
Feedback
[
Organics on Ceres may be more abundant than originally ...
Brown University
https://www.brown.edu › news › ceres
](https://www.brown.edu/news/2018-06-13/ceres)
[
](https://www.brown.edu/news/2018-06-13/ceres)
Jun 13, 2018 --- A new analysis of data from NASA's Dawn mission suggests that organic matter may exist in surprisingly high concentrations on the dwarf ...
Missing: ~~arnutet~~ | Show results with: arnutet
[
Scientists dig into the origin of organics on Ceres
https://phys.org › Astronomy & Space › Space Exploration
](https://phys.org/news/2017-10-scientists-ceres.html)
[
](https://phys.org/news/2017-10-scientists-ceres.html)
Oct 18, 2017 --- "The discovery of a locally high concentration of organics close to the Ernutet crater poses an interesting conundrum," said Dr. Simone Marchi, ...
Missing: ~~arnutet~~ | Show results with: arnutet
[
The composition and structure of Ceres' interior
https://www.sciencedirect.com › article › abs › pii
](https://www.sciencedirect.com/science/article/abs/pii/S0019103519300508)
by MY Zolotov - 2020 - Cited by 21 --- Ceres is modeled as a chemically uniform mixture of CI-type carbonaceous chondritic rocks and 12--29 vol% of macromolecular organic matter. Water ...
Missing: ~~arnutet~~ | Show results with: arnutet
[
Organic Material on Ceres: Insights from Visible and ...
MDPI
https://www.mdpi.com › ...
](https://www.mdpi.com/2075-1729/11/1/9)
by A Raponi - 2020 - Cited by 19 --- In the present work, we focus on the average spectrum of Ceres. We also revise local spectra from the Ernutet and Occator crater regions, where ...
[
Ceres Community Project
Ceres Community Project
](https://www.ceresproject.org/)
[
](https://www.ceresproject.org/)
Ceres client enjoying meal. We provide beautiful, delicious and medically tailored meals made with love for those facing a serious illness like cancer ...
Contact - Ceres Volunteer - Meals for Myself or a Loved One - Job Openings
Missing: ~~arnutet~~ | Show results with: arnutet
[
Ernutet Crater - Enhanced Color
Jet Propulsion Laboratory - NASA
](https://www.jpl.nasa.gov/images/pia21419-ernutet-crater-enhanced-color)
[
Organics on Ceres may be more abundant than originally ...
Brown University
](https://www.brown.edu/news/2018-06-13/ceres)
[
Scientists dig into the origin of organics on Ceres
](https://phys.org/news/2017-10-scientists-ceres.html)
Feedback
6 more images
[
Home | Ceres: Sustainability is the bottom line
[
Ceres Accelerator for Sustainable Capital Markets. Our center for excellence within Ceres aims to transform the practices and policies that govern capital ...
About - Support Ceres - Ceres Accelerator - Investor Network
Missing: ~~arnutet~~ | Show results with: arnutet
[
Ceres (mythology)
Wikipedia
https://en.wikipedia.org › wiki › Ceres_(mythology)
](https://en.wikipedia.org/wiki/Ceres_(mythology))
She is usually depicted as a mature woman. Ceres. Goddess of agriculture, fertility, grains, the harvest, motherhood, the earth, and cultivated crops.
Missing: ~~arnutet~~ | Show results with: arnutet
[
Ceres Imaging: Risk insights for sustainable agriculture
Ceres Imaging
](https://www.ceresimaging.net/)
Ceres Imaging is the world's most advanced data analytics platform for agriculture.
Careers - About us - Ceres for sustainability - Ceres for agribusiness
Missing: ~~arnutet~~ | Show results with: arnutet
Elizabeth Rosa Landau is an American science writer and communicator. She is a Senior Communications Specialist at NASA Headquarters.^[1]^ She was a Senior Storyteller at the NASA Jet Propulsion Laboratory previously.
Education
Landau grew up in Bryn Mawr, Pennsylvania. As a child, she watched Carl Sagan's TV series Cosmos, which helped inspire her love of space.^[2]^
She earned a bachelor's degree in anthropology at Princeton University (magna cum laude) in 2006. As a Princeton student, she completed study-abroad programs at University of Seville and Universidad de León.^[3]^ During her junior year in Princeton, she was the editor-in-chief of Innovation, the university's student science magazine.^[2]^ In the summer of 2004, she became a production intern at CNN en Español in New York.^[3]^ She earned a master's in journalism from Columbia University, where she focused on politics.^[4]^
Career
Landau began to write and produce for CNN's website in 2007 as a Master's Fellow, and returned full-time in 2008.^[5]^ Here she co-founded the CNN science blog, Light Years.^[6]^ She covered a variety of topics including Pi Day.^[7]^^[8]^^[9]^ In 2012, Landau interviewed Scott Maxwell about the Curiosity rover at the NASA Jet Propulsion Laboratory.^[10]^
NASA career
In 2014, she became a media relations specialist at the NASA Jet Propulsion Laboratory, where she led media strategy for Dawn (spacecraft), Voyager, Spitzer, NuSTAR, WISE, Planck and Hershel.^[11]^^[12]^^[13]^^[14]^^[15]^^[16]^ She led NASA's effort to share the TRAPPIST-1 exoplanet system with the world on February 22, 2017.^[17]^^[18]^ In January 2018, she was appointed a Senior Storyteller at the Jet Propulsion Laboratory.^[2]^ In February 2020, she became a Senior Communications Specialist at NASA Headquarters.^[1]^
-
-
indieweb.org indieweb.orgPuPuPu1
-
learn-us-east-1-prod-fleet02-xythos.content.blackboardcdn.com learn-us-east-1-prod-fleet02-xythos.content.blackboardcdn.com
-
town lay in the midst of a checker-board of prosperous farms, with fields of grain and hillsides of orchards where,in spring, white clouds of bloom drifted above the green fields
farming terrain similair to the mid west
-
-
-
multi-day
multi-day or multiday?
-
-
bellahabip.com bellahabip.com
-
violence in the root of this sense-makin
你觉得转喻的基础是暴力啊。是一种否定性没错,但它不等于暴力。
-
-
blog.eladgil.com blog.eladgil.com
-
The ~$10B OpenAI investment by Microsoft is roughly 6 weeks of Azure revenue. AI is having a big impact on Azure revenue revently. Indeed Azure grew 6 percentage points in Q2 2024 from AI - which would put it at an annualized increase of $5-6B (or 50% of its investment in OpenAI! Per year!).
MSFT invested ~$10B in OpenAI.
MSFT Azure grew 6% in Q2 2024 from AI — an annualized increase of $5-6B (or 50% of its investment in OpenAI in one year alone)
-
-
-
www.repubblica.it www.repubblica.it
-
Die extreme Trockenheit in Sizilien hält inzwischen seit12 Monaten an. In.ä
-
-
facultyecommons.com facultyecommons.com
-
Furthermore, Wu and Hiltz (2004) reported that students liked online discussion and believed they enhanced their learning.
If you consider half of the students who bothered to respond to the survey had a positive view of asynchronous discussions a success...sure.
-
see next page for example
???
-
Group students weekly in order to collaborate and post several questions. Reassign these groups weekly to allow interactions with other students.
Little opportunity to build group dynamics. Questionable advice.
-
-
www.derstandard.at www.derstandard.at
-
Russland verkauft große mengen Öl über die Türkei nach Europa. Dadurch werdenwerden die EU sanktionen umgangen. Allein 2023 hat die Türkei für 5,5 Milliarden Dollar öl aus russland gekauft, das zu einem großen teil nach europa weiter geliefert wurde'
-
-
www.linkedin.com www.linkedin.com
-
deep sea mining could start domino effects of which we are entirely unaware.
for - progress trap - deep sea metallic nodes produce oxygen - deep sea mining can disrupt
-
-
www.biorxiv.org www.biorxiv.org
-
Note: This response was posted by the corresponding author to Review Commons. The content has not been altered except for formatting.
Learn more at Review Commons
Reply to the reviewers
Manuscript number: RC-2024-02394
Corresponding author(s): Altman, Brian J
1. General Statements [optional]
We thank all three Reviewers for their insightful and helpful feedback and suggestions. We strongly believe that addressing these comments has now resulted in a much-improved manuscript. We appreciate that the Reviewers found the manuscript "interesting" with "valuable insights and... obvious novelty", "an important study that is well-done", and "an important understanding of the crosstalk between cancer cells and immune cells as well as the understanding of how the TME disrupts circadian rhythms". All three Reviewers requested a significant revision, which we provide here. We carefully and completely responded to each Reviewer question or suggestion, in most cases with new experiments and text, and in a very few cases with changes or additions to the Discussion section. This includes new data in seven of the original Figures and Supplementary Figures, and one new main Figure and three new Supplementary Figures. Highlights of these new data include testing the role of low pH in cancer cell supernatant on macrophage rhythms, and analysis of single-cell RNA-sequencing data for heterogeneity in macrophage circadian gene expression. Additional experiments were also performed that were not included in the manuscript, and these data are presented in this Response. A detailed point-by-point response to each comment is included below with excerpts of the data and updated text for the reviewers. Please note that the PDF version of this Response includes images of the new Figures inserted in to the manuscript.
2. Point-by-point description of the revisions
__Reviewer #1 __
Evidence, reproducibility and clarity
The manuscript by Knudsen-Clark et al. investigates the novel topic of circadian rhythms in macrophages and their role in tumorigenesis. The authors explore how circadian rhythms of macrophages may be influenced by the tumor microenvironment (TME). They utilize a system of bone marrow-derived macrophages obtained from transgenic mice carrying PER2-Luciferase (PER2-Luc), a trackable marker of rhythmic activity. The study evaluates how conditions associated with the TME, such as polarizing stimuli (to M1 or M2 subtype), acidic pH, and elevated lactate, can each alter circadian rhythms in macrophages. The authors employ several approaches to explore macrophage functions in cancer-related settings. While the manuscript presents interesting findings and may be the first to demonstrate that tumor stimuli alter circadian rhythms in macrophages and impact tumor growth, it lacks a clear conclusion regarding the role of altered circadian rhythms in suppressing tumor growth. Several discrepancies need to be addressed before publication, therefore, the manuscript requires revision before publication, addressing the following comments:
We thank Reviewer #1 for the comments regarding the quality of our work and are pleased that the Reviewer finds that this manuscript "presents interesting findings and may be the first to demonstrate that tumor stimuli alter circadian rhythms in macrophages and impact tumor growth". We have addressed all comments and critiques from Reviewer #1 below. To summarize, we added new data on how different macrophage polarization states affect media pH (Supplementary Figure 4), further characterized gene expression in our distinct macrophage populations (Supplementary Figure 1), provided clarity in the data and text on the universal nature of Clock Correlation Distance (CCD) across macrophage populations (Figure 6), included human tumor-associated macrophage (TAM) data for CCD (Figure 7) analyzed single-cell RNA-sequencing data of TAMs to demonstrate heterogeneity in circadian gene expression (Figure 9), and used tumor-conditioned media to show that low pH still affects macrophage rhythms in this context *Supplementary Figure 5". Thanks to the helpful suggestions of the Reviewer, we also made numerous clarifications and fixed a critical referencing error that the Reviewer identified.
Major comments: 1. It is well known that pro-inflammatory macrophages primarily rely on glycolysis during inflammation, exhibiting dysregulated tricarboxylic acid (TCA) cycle activity. These pro-inflammatory macrophages are commonly referred to as 'M1' or pro-inflammatory, as noted in the manuscript. In contrast, M2 macrophages, or pro-resolution macrophages, are highly dependent on active mitochondrial respiration and oxidative phosphorylation (OXPHOS). Given that M1 macrophages favor glycolysis, they create an acidic environment due to elevated lactate levels and other acidifying metabolites. However, the study does not address this effect. The authors' hypothesis revolves around the acidic environment created by glycolytic tumors, yet they overlook the self-induced acidification of media when culturing M1 macrophages. This raises the question of how the authors explain the reduced circadian rhythms observed in pro-inflammatory macrophages in their study, while low pH and higher lactate levels enhance the amplitude of circadian rhythms. I would encourage the authors to incorporate the glycolytic activity of pro-inflammatory macrophages into their experimental setup. Otherwise the data look contradictory and misleading in some extent.
We appreciate the important point Reviewer #1 made that macrophages polarized toward a pro-inflammatory phenotype such as those stimulated with IFNγ and LPS (M1 macrophages) prioritize metabolic pathways that enhance glycolytic flux, resulting in increased release of protons and lactate as waste products from the glycolysis pathway. In this way, polarization of macrophages toward the pro-inflammatory phenotype can lead to acidification of the media, which may influence our observations given that we are studying the effect of extracellular pH on rhythms in macrophages. To address this point, we have performed additional experiments in which we measured pH of the media to capture changes in media pH that occur during the time in which we observe changes in rhythms of pro-inflammatory macrophages.
In line with the documented enhanced glycolytic activity of pro-inflammatory macrophages, the media of pro-inflammatory macrophages is acidified over time, in contrast to media of unstimulated or pro-resolution macrophages. Notably, while pH decreased over time in the pro-inflammatory group, the pH differential between the pH7.4, pH6.8, and pH6.5 sample groups was maintained over the period in which we observe and measure changes in circadian rhythms of pro-inflammatory macrophages. Additionally, media that began at pH 7.4 was acidified only to pH 7 by day 2, above the acidic pH of 6.8 or 6.5. As a result, there remained a difference in pH between the two groups (pH 7.4 and pH 6.5) out to 2 days consistent with the changes in rhythms that we observe between these two groups. This indicates that the difference in circadian rhythms observed in pro-inflammatory macrophages cultured at pH 7.4 compared to pH 6.5 were indeed due to the difference in extracellular pH between the two conditions. We have incorporated these data, shown below, into Supplementary Figure 4 and added the following discussion of these data to the Results section:
"In line with their documented enhanced glycolytic capacity, pro-inflammatory macrophages acidified the media over time (Supplementary Figure 4C). Notably, while pH of the media the pro-inflammatory macrophages were cultured in decreased over time pH, the pH differential between the pH 7.4, pH 6.8, and pH 6.5 samples groups of pro-inflammatory macrophages was maintained out to 2 days, consistent with the changes in rhythms that we observe and measure between these groups."
The article examines the role of circadian rhythms in tumor-associated macrophages, yet it lacks sufficient compelling data to support this assertion. Two figures, Figure 7 and Figure 9, are presented in relation to cancer. In Figure 7, gene expression analysis of Arg1 (an M2 marker) and Crem (a potential circadian clock gene) is conducted in wild-type macrophages, BMAL1-knockout macrophages with dysregulated circadian rhythms, and using publicly available data on tumor-associated macrophages from a study referenced as 83. However, it is noted that this referenced study is actually a review article by Geeraerts et al. (2017) titled "Macrophage Metabolism as Therapeutic Target for Cancer, Atherosclerosis, and Obesity" published in Frontiers in Immunology. This raises concerns about the reliability of the results. Furthermore, comparing peritoneal macrophages from healthy mice with macrophages isolated from lung tumors is deemed inaccurate. It is suggested that lung macrophages from healthy mice and those from mice with lung tumors should be isolated separately for a more appropriate comparison. Consequently, Figure 7B is further questioned regarding how the authors could compare genes from the circadian rhythm pathway between these non-identical groups. As a result, the conclusion drawn from these data, suggesting that tumor-associated macrophages exhibit a gene expression pattern similar to BMAL1-KO macrophages, is deemed incorrect, affecting the interpretation of the data presented in Figure 8.
We thank Reviewer #1 for pointing out our error in the reference provided as the source of the TAM data used for CCD in Figure 7. While we took care to provide the GEO ID for the data set (GSE188549) in the Methods section, we mistakenly cited Geeraerts (2017) Front Immunol when we should have cited Geeraerts (2021) Cell Rep. We have corrected this citation error in the main text.
We also appreciate Reviewer #1's concern that we are comparing circadian gene expression of peritoneal macrophages to tumor-associated macrophages derived from LLC tumors, which are grown ectopically in the flank for the experiment from which the data set was produced. To ensure an accurate comparison of gene expression, we downloaded the raw FASTQ files from each dataset and processed them in identical pipelines. Our main comparison between these cell types is Clock Correlation Distance (CCD), which compares the pattern of co-expression of circadian genes (Shilts et al PeerJ 2018). CCD was built from multiple mouse and human tissues to be a "universal" tool to compare circadian rhythms, and designed to compare between different tissues and cell types. Each sample is compared to a reference control built from these multiple tissues. To better convey this concept to readers to give confidence the suitability of CCD for comparing data sets across different tissues, we have added the reference control to Figure 7 (now Figure 6B), We have also expanded our analysis to include bone marrow-derived macrophages, to further demonstrate that the organization of clock gene co-expression is not specific to peritoneal macrophages; we have added this data to Figure 7 (now Figure 6C,D). Finally, we have included an abbreviated explanation of the points made above in the results section.
Due to the universal nature of the CCD tool, we disagree with Reviewer #1's assertion that "the conclusion drawn from these data, suggesting that tumor-associated macrophages exhibit a gene expression pattern similar to BMAL1-KO macrophages, is deemed incorrect". Indeed, this finding mirrors findings in the original CCD paper, which showed that tumor tissues universally exhibit a disordered molecular clock as compared to normal tissue. Notably, the original CCD paper also compared across cell and tumor types.
As an additional note to the review, we would like to clarify that nowhere in the manuscript do we propose that Crem is a potential circadian clock gene. We are clear throughout the manuscript that we are using Crem as a previously established biomarker for acidic pH-sensing in macrophages. Please see below for the modified Figure and text.
"To understand the status of the circadian clock in TAMs, we performed clock correlation distance (CCD) analysis. This analysis has previously been used to assess functionality of the circadian clock in whole tumor and in normal tissue[102]. As the circadian clock is comprised of a series of transcription/translation feedback loops, gene expression is highly organized in a functional, intact clock, with core clock genes existing in levels relative to each other irrespective of the time of day. In a synchronized population of cells, this ordered relationship is maintained at the population level, which can be visualized in a heatmap. CCD is designed to compare circadian clock gene co-expression patterns between different tissues and cell types. To accomplish this, CCD was built using datasets from multiple different healthy tissues from mouse and human to be a universal tool to compare circadian rhythms. Each sample is compared to a reference control built from these multiple tissues (Figure 6B)[102]. To validate the use of this analysis for assessing circadian disorder in macrophages, we performed CCD analysis using publicly available RNA-sequencing data from bone marrow-derived macrophages and wild type peritoneal macrophages, as a healthy control for functional rhythms in a synchronized cell population, and BMAL1 KO peritoneal macrophages, as a positive control for circadian disorder[44]."
And in the Discussion:
"Interestingly, analysis of TAMs by clock correlation distance (CCD) presents evidence that rhythms are disordered in bulk TAMs compared to other macrophage populations (Figure 6). CCD is one of the most practical tools currently available to assess circadian rhythms due to its ability to assess rhythms independent of time of day and without the need for a circadian time series, which is often not available in publicly available data from mice and humans[102]."
If the authors aim to draw a clear conclusion regarding the circadian rhythms of tumor-associated macrophages (TAMs), they may need to analyze single-sorted macrophages from tumors and corresponding healthy tissues. Such data are publicly available (of course not in #83)
We agree with Reviewer #1 that while our interpretation of the data is that there may be heterogeneity in circadian rhythms of tumor-associated macrophages, we cannot prove this without assessing circadian rhythms at the single cell level. While single-cell RNA-sequencing data of freshly isolated tumor associated macrophages of sufficient read depth for circadian gene expression analysis has historically been unavailable, fortunately a dataset was released recently (May 2024) which we were able to use to address this point. We have analyzed publicly available single-cell RNAseq data of tumor-associated macrophages (GSE260641, Wang 2024 Cell) to determine whether there are differences in expression of circadian clock genes between different TAM populations. We have added these data as a new Figure 9. Please see the figure and updated text below.
"Tumor-associated macrophages exhibit heterogeneity in circadian clock gene expression.
__ Our findings suggested that heterogeneity of the circadian clock may lead to disorder in bulk macrophage populations, but did not reveal if specific gene expression changes exist in tumor-associated macrophages at the single-cell level. To determine whether heterogeneity exists within the expression of circadian clock genes of the tumor-associated macrophage population, we analyzed publicly available single-cell RNA sequencing data of macrophages isolated from B16-F10 tumors[107]. To capture the heterogeneity of macrophage subsets within the TAM population, we performed unbiased clustering (Figure 9A). We then performed differential gene expression to determine if circadian clock genes were differentially expressed within the TAM subpopulations. The circadian clock genes Bhlhe40 (DEC1), Bhlhe41 (DEC2), Nfil3 (E4BP4), Rora (RORα), Dbp (DBP), and Nr1d2 (REV-ERBβ) were significantly (adj.p We next sought to determine whether differences in circadian clock gene expression between TAM subpopulations were associated with exposure to acidic pH in the TME. To this end, we first assessed Crem expression in the TAM subpopulations that were identified by unbiased clustering. Crem expression was significantly higher in TAM clusters 4, 5, and 6 compared to TAM clusters 1-3 and 7-9 (Figure 9C). Clusters were subset based on Crem expression into Crem high (clusters 4-6) and Crem low (clusters 1-3, 7-9) (Figure 9D), and differential gene expression analysis was performed. The circadian clock genes Nfil3, Rora, Bhlhe40, and Cry1 (CRY1) were significantly (adj.p __And in the Discussion:
"Supporting the notion that population-level disorder may exist in TAMs, we used scRNA-sequencing data and found evidence of heterogeneity between the expression of circadian clock genes in different TAM subpopulations (Figure 9A, B). Phenotypic heterogeneity of TAMs in various types of cancer has previously been shown[20, 21, 125, 126], and we have identified distinct TAM subpopulations by unbiased clustering (Figure 9A). Within those TAM subpopulations, we identified differential expression of circadian clock genes encoding transcription factors that bind to different consensus sequences: DEC1 and DEC2 bind to E-boxes, NFIL3 and DBP binds to D-boxes, and RORα and REV-ERBβ binds to retinoic acid-related orphan receptor elements (ROREs)[127, 128]. While little is known about regulation of macrophages by E-box and D-box elements beyond the circadian clock, aspects of macrophage function have been shown to be subject to transcriptional regulation through ROREs[129, 130]. Thus, we speculate that variations in these transcription factors may exert influence on expression of genes to drive diversity between TAM subpopulations. Differential expression of circadian clock genes between TAM subpopulations was also associated with Crem expression (Figure 9C-E), suggesting that exposure of TAMs to acidic pH within the TME can alter the circadian clock. However, there remained significant variation in expression of circadian clock genes within the Crem high and Crem low groups (Figure 9B), suggesting that acidic pH is not the only factor in the TME that can alter the circadian clock. Together, these data implicate the TME in driving heterogeneity in TAM circadian rhythms just as it drives heterogeneity in TAM phenotype.
Interestingly, in contrast to our observations of circadian disorder in TAMs isolated from LLC tumors (Figure 6), rhythmicity in expression of circadian genes was observed in bulk TAMs isolated from B16 tumors[107]. This suggests that circadian rhythms of TAMs are maintained differently in different types of cancer. Notably, both of these observations were at the population level. Upon separation of the B16 TAM population into subsets by unbiased clustering of single-cell RNA sequencing data, we measured differences in expression of circadian clock genes between TAM subpopulations (Figure 9A,B). This suggests that even within a rhythmic TAM population, there is heterogeneity in the circadian clock of TAM subpopulations."
Additionally, it is widely acknowledged that human and mouse macrophages exhibit distinct gene expression profiles, both in vitro and in vivo. While assuming that genes involved in circadian rhythms are conserved across species, the authors could consider extending their funding to include analyses of single-sorted macrophages from cancer patients, such as those with lung cancer or pancreatic ductal adenocarcinoma (PDAC). These experiments would provide relevant insights into TAM biology.
We agree that with Reviewer #1 that ultimately, being able to relate findings in mice to humans is critical. It is important to assess if circadian disorder is observed in TAMs in human cancers as it is for LLC tumor-derived macrophages in mice. To address this point, we have performed CCD using a human data set (GSE116946; Garrido 2020 J Immunother Cancer) suitable for use with CCD (wherein macrophages were isolated from bulk tumor in humans, with a high enough samples size, and not cultured prior to sequencing). We have added these data as a new Figure 7, shown below. Please see the added data and updated text below.
"We next assessed the status of the circadian clock in human TAMs from NSCLC patients. We performed CCD with publicly available RNA-seq data of tumor-adjacent macrophages and tumor-associated macrophages from NSCLC patients, using alveolar macrophages from healthy donors as a control[104, 105]. To assess the contribution of the acidic TME to circadian disorder, we subset TAM NSCLC patient samples into groups (Crem high TAMs and Crem low TAMs) based on median Crem expression. Notably, in macrophages from human NSCLC there was a trend toward disorder in Crem low but not Crem high TAM samples (Figure 7A,B). Additionally, the co-variance among core clock genes observed in alveolar macrophages from healthy donors was absent within Crem low and Crem high TAM samples (Figure 7C). In all, these data indicate that there is population-level disorder in the circadian rhythms of tumor-associated macrophages in humans and mice, suggesting that circadian rhythms are indeed altered in macrophages within the TME."
And in the Discussion:
"Indeed, we observed differences in the circadian clock of Crem low human TAM samples compared to Crem high human TAM samples, suggesting that acidic pH influences circadian disorder in TAMs (Figure 7). Interestingly, Crem low TAM samples exhibited a trend toward disorder while Crem high TAM samples did not. This is of particular interest, as we have observed that acidic pH can enhance circadian rhythms in macrophages, raising the question of whether acidic pH promotes or protects against circadian disorder."
Minor comments: 1. Figure 2C needs clarification. It's unclear why pro-inflammatory macrophages treated with lactic acid would have a shorter amplitude and period, while acidic pH would increase amplitude and period in M2 macrophages.
We thank Reviewer #1 for this important observation. Based on the comment, it is our understanding that the Reviewer is referring to the data in Figure 2 (low pH) compared to Figure 4 (lactate). We also find it very interesting that lactate alters rhythms in a manner distinct from the way in which acidic pH alters rhythms. Reviewer 3 asked for clarification on how lactate affected circadian gene expression in pH 7.4 or 6.5. We have added these data as Figure 4C (data and text below). It is notable that lactate opposing effects on circadian gene expression in pH 6.5, enhancing the effects of low pH in some cases (Nr1d1) while blunting them in other cases (Cry1). This is mentioned in the text.
"Lactate was also observed to alter expression of the circadian clock genes Per2, Cry1, and Nr1d1 over time in BMDMs cultured at pH 6.5, while having more subtle effects at pH 7.4 (Figure 4C). Notably, lactate blunted the effect of pH 6.5 on Cry1 expression, while enhancing the effect of low pH on Nr1d1 expression."
Why these two stimuli alter rhythms differently remains an open question that is discussed in the Discussion section and is prime to be a topic of future investigation. We have added to the Discussion section potential reasons why these conditions may alter rhythms differently, such as the different pathways downstream of sensing these two different conditions. Please see the updated text, below.
"Although lactate polarizes macrophages toward a pro-resolution phenotype similar to acidic pH[30, 93], exposure to lactate had different effects on circadian rhythms - and in some cases, circadian clock gene expression - than exposure to acidic pH (Figure 4). Sensing of lactate occurs through different pathways than acid-sensing, which may contribute to the different ways in which these two stimuli modulate circadian rhythms of macrophages[111]. One previously published finding that may offer mechanistic insight into how phenotype can influence circadian rhythms is the suppression of Bmal1 by LPS-inducible miR-155[54]. It has also been observed that RORα-mediated activation of Bmal1 transcription is enhanced by PPARγ co-activation[112]. In macrophages, PPARγ expression is induced upon stimulation with IL-4 and plays a key role in alternative activation of macrophages, promoting a pro-resolution macrophage phenotype, and supporting resolution of inflammation[113-115]. Such observations prompt the question of whether there are yet-unidentified factors induced downstream of various polarizing stimuli that can modulate expression of circadian genes at the transcriptional and protein levels. Further work is required to understand the interplay between macrophage phenotype and circadian rhythms."
The scale in Figure 2C should be equal for all conditions (e.g., -200).
We appreciate Reviewer #1's preference for the axes to be scaled similarly to enable cross-comparison between graphs. However, due to the different amplitude of pro-inflammatory macrophages compared to the others, we feel that making all axes the same will make it hard to see the rhythms of pro-inflammatory macrophages, hindering the reader's ability to observe the data. Thus, we have put the matched-axis plots, shown below, in Supplementary Figure 4A.
Absolute values of amplitude, damping, and period differ between Figure 1 and Figure 2A, B, C. The authors should explain these discrepancies.
As with many experimental approaches, there is slight variation in absolute values between independent experiments, which Reviewer #1 correctly notes. However, while the absolute values vary slightly, the relationship between the values in each of these conditions remains the same across the panels mentioned by Reviewer #1.
The authors should consider modulating the acidic environment of macrophages in settings more representative of cancer. For example, by adding conditioned media from tumor cells with pronounced glycolysis.
We appreciate Reviewer #1's desire to more closely mimic the tumor microenvironment. To address Reviewer #1's point, we cultured macrophages in RPMI or cancer cell (KCKO) supernatant at pH 6.5 or pH-adjusted to pH 7.4 and assessed rhythms by measuring rhythmic activity of Per2-Luc with LumiCycle analysis. We then compared changes in rhythms between macrophages cultured normal media to cancer cell supernatant in pH-matched conditions to assess how cancer cell-conditioned media may influence circadian rhythms of macrophages, and the contribution of acidic pH. We have added these data, shown below, as a new Supplementary Figure 5, and included a discussion of these data in the manuscript. Please see the new Figure and updated text below.
"Cancer cell supernatant alters circadian rhythms in macrophages in a manner partially reversed by neutralization of pH.
We have observed that polarizing stimuli, acidic pH, and lactate can alter circadian rhythms. However, the tumor microenvironment is complex. Cancer cells secrete a variety of factors and deplete nutrients in the environment. To model this, we cultured BMDMs in RPMI or supernatant collected from KCKO cells, which are a murine model of pancreatic ductal adenocarcinoma (PDAC)[94, 95], at pH 6.5 or neutralized to pH 7.4 (Supplementary Figure 5). Circadian rhythms of BMDMs cultured in cancer cell supernatant at pH 7.4 or pH 6.5 exhibited increased amplitude and lengthened period compared to RPMI control at pH 7.4 or 6.5, respectively, indicating that cancer cell supernatant contains factors that can alter circadian rhythms of BMDMs. Notably, BMDMs cultured in cancer cell supernatant at pH 6.5 had increased amplitude and shortened period compared to BMDMs cultured in cancer cell-conditioned media at pH7.4, indicating that pH-driven changes in rhythms were maintained in BMDMs cultured in cancer cell supernatant. When the pH of cancer cell supernatant was neutralized to pH7.4, the increased amplitude was decreased, and the shortened period was lengthened, indicating that neutralizing acidic pH partially reverses the changes in rhythms observed in macrophages cultured in cancer cell supernatant at pH 6.5. These data further support our observations that acidic pH can alter circadian rhythms of macrophages both alone and in combination with various factors in the TME."
And, in the Discussion:
"We have shown that various stimuli can alter rhythms of macrophages in a complex and contributing manner, including polarizing stimuli, acidic pH, and lactate. TGFβ is produced by a variety of cells within the TME, and was recently identified as a signal that can modulate circadian rhythms[123, 124]. Additionally, when we exposed macrophages to cancer cell-conditioned media, rhythms were modulated in a manner distinct from acidic pH or lactate, with these changes in rhythms partially reversed by neutralization of the cancer cell-conditioned media pH (Supplementary Figure 5). It is conceivable that, in addition to acidic pH, other stimuli in the TME are influencing circadian rhythms to drive population-level disorder that we observed by CCD."
Arg1 alone is not sufficient as an M2 polarization marker. The authors should include additional markers.
We thank Reviewer #1 for bringing up this critical point in experimental rigor. While Arg1 is a commonly-used marker for M2 polarization, Reviewer #1 points out that polarization of macrophages is typically assessed by a full panel of markers characteristic of the M2 state. To address this point, we have expanded our panel to include several other markers of M2 polarization in mice such as Retnla, Ym1, MGL1, and CD206. In response to Reviewer 2's major point 2 and Reviewer 3's major point 4 below, we have also expanded our panel of markers used to assess the M1 polarization state with Tnfa, Il1b. and Il6. We have added these data, shown below, to Supplementary Figure 1 and updated the text appropriately. Please see the new Figure and updated text below.
"Consistent with previous studies, we found that genes associated with anti-inflammatory and pro-resolution programming characteristic of IL-4 and IL-13-stimulated macrophages such as Arg1, Retnla, Chil3 (Ym1), Clec10a (MGL1), and Mrc1 (CD206) were induced in IL-4 and IL-13-stimulated macrophages, but not IFNγ and LPS-stimulated macrophages. In contrast, genes associated with pro-inflammatory activity characteristic of IFNγ and LPS-stimulated macrophages such as Nos2 (iNOS), Tnfa, Il1b, and Il6 were induced in IFNγ and LPS-stimulated macrophages, but not IL-4 and IL-13-stimulated macrophages (Supplementary Figure 1)[28, 30, 65, 71, 74, 75]. This indicates that macrophages stimulated with IL-4 and IL-13 were polarized toward a pro-resolution phenotype, while macrophages stimulated with IFNγ and LPS were polarized toward a pro-inflammatory phenotype."
__ Significance__
While the manuscript provides valuable insights and has obvious novelty, it requires a significant revision
We thank Reviewer #1 for their deep read of our manuscript, and their helpful feedback and suggestions. As shown by the comments above, we are confident we have fully addressed each of the points that were made to result in a much-improved revised manuscript.
__ Reviewer #2 __
Evidence, reproducibility and clarity
Knudsen-Clark et al. showed that the circadian rhythm of bone marrow-derived macrophages (BMDM) can be affected by polarization stimuli, pH of the microenvironment, and by the presence of sodium-lactate. Mechanistically, the acidic pH of cell microenvironment is partly regulated by intracellular cAMP-mediated signaling events in BMDM. The authors also showed that the circadian clock of peritoneal macrophages is also modified by the pH of the cell microenvironment. Using publicly available data, the authors showed that the circadian rhythm of tumor-associated macrophages is similar to that of Bmal1-KO peritoneal macrophages. In a murine model of pancreatic cancer, the authors showed that the tumor growth is accelerated in C57BL/6 mice co-injected with cancer cells and Bmal1-KO BMDM as compared to mice co-injected with cancer cell and wild type BMDM.
We thank Reviewer #2 for their insightful and helpful comments and feedback. Their Review guided key clarifying experiments and additions to the Discussion and Methods. To summarize, we added new data to Supplementary Figure 1 to characterize distinct gene expression in our different polarized macrophage populations, showed in Supplementary Figure 2 that serum shock independently induces cAMP and Icer, discussed the limitations of the artificial polarization models more clearly, and updated our Methods to better explain how macrophages were isolated from the peritoneum. We also quantified multiple immunoblots of pCREB, provided clarity in the Methods and Reviewer-only data on how our protein-extraction protocol isolates nuclear protein, better introduced the BMAL1-KO mouse model, and showed in Supplementary Figure 6 that low pH can induce oscillations in the absence of a serum shock.
Major points of criticism: 1. Nine main figures include different experimental models on a non-systematic manner in the manuscript, and only literature-based correlation is used to link the results each other. The authors used in vitro BMDM and peritoneal cell-based model systems to study the effects of IL4+IL13, IFNg+LPS, low pH, sodium-lactate, adenylate cyclase inhibitors on the circadian clock of macrophages. The link between these microenvironment conditions of the cells is still correlative with the tumor microenvironment: publicly available data were used to correlate the increased expression level of cAMP-activated signaling events with the presence of acidic pH of tumor microenvironment. Notably, the cell signaling messenger molecule cAMP is produced by not only low extracellular pH by activated GPCRs, but also starvation of the cell. The starvation is also relevant to this study, since the BMDM used in the in vitro culture system were starving for 24 hours before the measurement of Per2-Luc expression to monitor circadian rhythm.
We agree with the important point that Reviewer #2 makes that our synchronization protocol of serum starvation followed by serum shock can impact the cAMP signaling pathway. Indeed, it has previously been shown that serum shock induces phosphorylation of CREM in rat fibroblasts, which is indicative of signaling through the cAMP pathway. To address this point, we have added a schematic of our synchronization protocol to Supplementary Figure 2B for additional clarity. We have also performed additional experiments to test whether cAMP signaling is induced in macrophages by our synchronization protocol. For this, we assessed downstream targets of the cAMP signaling pathway, Icer and pCREB, after serum starvation but before serum shock, and at several time points post-treatment with serum shock (Supplementary Figures 2D,E). We observed that Icer and phosphorylation of Creb are induced rapidly in macrophages upon exposure to serum shock, as early as 10 minutes for pCREB and 1 hour post-exposure for Icer. Notably, this signaling is transient and rapidly returns to baseline, with pCREB levels fully returned to baseline by 2 hours post-treatment, at which time media is replaced and the experiment begins (CT 0). These data, shown below, have been added to Supplementary Figure 2 and a discussion of these data has been added to the manuscript - please see the modified text below.
"The synchronization protocol we use to study circadian rhythms in BMDMs involves a 24-hour period of serum starvation followed by 2 hours of serum shock. It has previously been shown that serum shock can induce signaling through the cAMP pathway in rat fibroblasts[98]. To determine whether the synchronization protocol impacts cAMP signaling in macrophages, we harvested macrophages before and after serum shock. We then assessed Icer expression and phosphorylation of cyclic AMP-response element binding protein (CREB), which occur downstream of cAMP and have been used as readouts to assess induction of cAMP signaling in macrophages[29, 96, 100]. Serum shock of macrophages following serum starvation led to rapid phosphorylation of CREB and Icer expression that quickly returned to baseline (Supplementary Figure 2D,E). This indicates that serum starvation followed by serum shock in the synchronization protocol we use to study circadian rhythms in BMDMs induces transient signaling through the cAMP signaling pathway. "
The definition of pre-resolution macrophages (MF) used across the manuscript could be argued. The authors defined BMDM polarized with IL-4 and IL-13 as pre-resolution MF. Resolution is followed by inflammation, but the IL-4 secretion does not occur in every inflammatory setting. Moreover, IL-4 and IL-13 are secreted during specific tissue environment and immunological settings involving type 2 inflammation or during germinal center reactions of the lymph nodes. • What are the characteristics of pre-resolution macrophages (MF)? The authors indicated that IL-4 and IL-13 cytokines were used to model the pre-resolution macrophages. In which pathological context are these cytokines produced and induce pre-resolution macrophages? IL-4 polarized BMDM can also produce pro-inflammatory protein and lipid mediators as compared to LPS-stimulated BMDM, and IL-4 polarized BMDM still have potent capacity to recruit immune cells and to establish type 2 inflammation.
-
The authors showed Arg1 and Vegfa qPCR data from BMDM only. Based on the literature, these MFs are anti-inflammatory cells particularly. Resolution-related MFs followed by acute inflammation are a specific subset of MFs, and the phenotype of pre-resolution MF should be described, referred, and measured specifically.
We thank Reviewer #2 for bringing up this important point that clarity is required in describing our in vitro macrophage models. We chose the most commonly used models of in vitro macrophage polarization in the tumor immunology field, M2 (IL-4+IL-13) and M1 (IFNγ+LPS). These polarization conditions have been used for over two decades in the field, and have been well-characterized to drive a pro-inflammatory (for M1) and pro-resolution or anti-inflammatory (for M2) macrophage phenotype (Murray 2017 Annu Rev Phys). Each of these cell states have similarities in phenotype to pro-inflammatory and pro-resolution (pro-tumorigenic) macrophages found in tumors. In fact, in the literature, pro-inflammatory and pro-resolution TAMs will frequently be categorized as "M1" or "M2", respectively, even though this is a gross oversimplification (Ding 2019 J Immunol, Garrido-Martin 2020 J Immunother Cancer).
As Reviewer #2 points out, IL-4 and IL-13 play a role in inflammatory settings, mediating protective responses to parasites and pathological responses to allergens. Importantly, IL-4 and IL-13 are also key regulators and effectors of resolution and wound repair (Allen 2023 Annu Rev Immunol). In line with this, M2 macrophages show many of the characteristics of pro-resolution programming in their gene expression profile, expressing genes associated with wound healing (ex. Vegf) and immunoregulation (ex. Arg1) (Mantovani 2013 J Pathol). These cells have frequently been used as a model for studying TAMs in vitro, due to the similarity in pro-resolution programming that is dysregulated/hijacked in TAMs (Biswas 2006 Blood). M2 macrophages have also been referred to as anti-inflammatory, and this is in line with their role in the type 2 response driven by IL-4 and IL-13, as this is primarily a response induced by allergy or parasites where tissue damage drives an anti-inflammatory and pro-resolution phenotype in macrophages (Pesce 2009 Plos Pathogens and Allen 2023 Annu Rev Immunol).
We do not assert that these in vitro models recapitulate the macrophage polarization cycle that Reviewer #2 astutely describes, and indeed, stimuli polarizing macrophages in tumor are much more diverse and complex (Laviron 2022 Cell Rep). We also fully agree with Reviewer #2 that, while IL4 and IL13 may exist in the tumor and be secreted by Th2 CD4 T cells (see Shiao 2015 Cancer Immunol Res), there may be multiple reasons why macrophages may be polarized to a pro-resolution, M2-like state in a tumor (in fact, exposure to low pH and lactate each independently do this, as we show in Supplementary Figure 2 and Figure 4, and was previously shown in Jiang 2021 J Immunol and Colegio 2014 Nature). Nonetheless, using the well-described M1 and M2 in vitro models allows our findings to be directly comparable to the vast literature that also uses these models, and to understand how distinct polarization states respond to low pH.
We fully agree with Reviewer #2 that these cells must be defined more clearly in the text. We have taken care to discuss the limitations of using in vitro polarization models to study macrophages in our Limitations of the Study section. To better address Reviewer #2's concern, we have more thoroughly introduced the M2 macrophages as a model, and are clear that that these are type 2-driven macrophages that share characteristics of pro-resolution macrophages. We have also added additional citations to the manuscript, including those highlighted above in our response. Finally, we have expanded our panel to better characterize the IL-4/IL-13 stimulated macrophages using more markers that have been characterized in the literature, in line with both Reviewer #2's comments and that of Reviewer #1 and Reviewer #3. Please see the updated data and text, below.
"As macrophages are a phenotypically heterogeneous population in the TME, we first sought to understand whether diversity in macrophage phenotype could translate to diversity in circadian rhythms of macrophages. To this end, we used two well-established in vitro polarization models to study distinct macrophage phenotypes[5, 60-63]. For a model of pro-inflammatory macrophages, we stimulated macrophages with IFNγ (interferon γ) and LPS (lipopolysaccharide) to elicit a pro-inflammatory phenotype[60, 64]. These macrophages are often referred to as 'M1' and are broadly viewed as anti-tumorigenic, and we will refer to them throughout this paper as pro-inflammatory macrophages[65, 66]. For a model at the opposite end of the phenotypic spectrum, we stimulated macrophages with IL-4 and IL-13[60, 67]. While these type 2 stimuli play a role in the response to parasites and allergy, they are also major drivers of wound healing; in line with this, IL-4 and IL-13-stimulated macrophages have been well-characterized to adopt gene expression profiles associated with wound-healing and anti-inflammatory macrophage phenotypes[68-71]. As such, these macrophages are often used as a model to study pro-tumorigenic macrophages in vitro and are often referred to as 'M2' macrophages; throughout this paper, we will refer to IL-4 and IL-13-stimulated macrophages as pro-resolution macrophages[66, 72, 73]. Consistent with previous studies, we found that genes associated with anti-inflammatory and pro-resolution programming characteristic of IL-4 and IL-13-stimulated macrophages such as Arg1, Retnla, Chil3 (Ym1), Clec10a (MGL1), and Mrc1 (CD206) were induced in IL-4 and IL-13-stimulated macrophages, but not IFNγ and LPS-stimulated macrophages. In contrast, genes associated with pro-inflammatory activity characteristic of IFNγ and LPS-stimulated macrophages such as Nos2 (iNOS), Tnfa, Il1b, and Il6 were induced in IFNγ and LPS-stimulated macrophages, but not IL-4 and IL-13-stimulated macrophages (Supplementary Figure 1)[28, 30, 65, 71, 74, 75]. This indicates that macrophages stimulated with IL-4 and IL-13 were polarized toward a pro-resolution phenotype, while macrophages stimulated with IFNγ and LPS were polarized toward a pro-inflammatory phenotype.
In the Limitations of the Study section, we now write the following:
"Our observations of rhythms in macrophages of different phenotypes are limited by in vitro polarization models. It is important to note that while our data suggest that pro-inflammatory macrophages have suppressed rhythms and increased rate of desynchrony, it remains unclear the extent to which these findings apply to the range of pro-inflammatory macrophages found in vivo. We use IFNγ and LPS co-treatment in vitro to model a pro-inflammatory macrophage phenotype that is commonly referred to as 'M1', but under inflammatory conditions in vivo, macrophages are exposed to a variety of stimuli that result in a spectrum of phenotypes, each highly context-dependent. The same is true for for 'M2'; different tissue microenvironment are different and pro-resolution macrophages exist in a spectrum."
The authors used IFNg and LPS, or IL-4 and IL-13 and co-treatments to polarize BMDM in to type 1 (referred as pro-inflammatory MF) and type 2 (referred as pre-resolution MF) activation state. The comparison between these BMDM populations has limitations, since LPS induces a potent inflammatory response in MF. The single treatment with MF-polarizing cytokines enable a more relevant comparison to study the circadian clock in classically and alternatively activated MF.
We thank Reviewer #2 for bringing up this important point to provide additional clarity on our polarization conditions. The use of IFNγ and LPS to polarize macrophages toward a pro-inflammatory, M1 phenotype, and the use of IL-4 an IL-13 to polarize macrophages toward a pro-resolution, M2 phenotype have been commonly used for over two decades, and thus are well-characterized in the literature (please see Murray 2017 Annu Rev Phys for an extensive review on the history of these polarization models, as well as Hörhold 2020 PLOS Computational Biology, Binger 2015 JCI, McWhorter 2013 PNAS, Ying 2013 J Vis Exp for more recent studies using these models). The use of LPS alone or in combination with IFNγ, and IL-13 along with IL-4, was introduced in 1998 (Munder 1998 J Immunol). This approach was originally designed to mimic what could happen when macrophages were exposed to CD4+ Th1 cells, which produce IFNγ, or Th2 cells, which produce IL-4 and IL-13 (Munder 1998 J Immunol, Murray 2017 Annu Rev Phys). As Reviewer #2 points out, these stimuli induce potent responses, driving macrophages to adopt pro-inflammatory or pro-resolution/anti-inflammatory phenotypes that are two extremes at opposite ends of the spectrum of macrophage phenotypes (Mosser 2008 Nat Rev Immunol). Since our goal was to study rhythms of distinct macrophage phenotypes in vitro, and how TME-associated conditions such as acidic pH and lactate affect their rhythms, these cell states were appropriate for our questions. Thus, the polarization models used in this paper allowed us to achieve this goal. We include a section in the Discussion on the limitations of in vitro polarization models.
"A critical question in understanding the role of circadian rhythms in macrophage biology is determining how different polarization states of macrophages affect their internal circadian rhythms. This is especially important considering that tumor-associated macrophages are a highly heterogeneous population. Our data indicate that compared to unstimulated macrophages, rhythms are enhanced in pro-resolution macrophages, characterized by increased amplitude and improved ability to maintain synchrony; in contrast, rhythms are suppressed in pro-inflammatory macrophages, characterized by decreased amplitude and impaired ability to maintain synchrony (Figure 1). These agree with previously published work showing that polarizing stimuli alone and in combination with each other can alter rhythms differently in macrophages[80, 81]. In a tumor, macrophages exist along a continuum of polarization states and phenotypes[18-21, 24]. Thus, while our characterizations of rhythms in in vitro-polarized macrophages provide a foundation for understanding how phenotype affects circadian rhythms of macrophages, further experiments will be needed to assess macrophages across the full spectrum of phenotypes. Indeed, alteration of rhythms may be just as highly variable and context-dependent as phenotype itself."
There are missing links between the results of showing the circadian rhythm of polarized BMDM, sodium-lactate treated BMDM, and tumor growth. Specifically, do the used pancreatic ductal adenocarcinoma cells produce IL-4 and sodium-lactate? In the LLC-based experimental in silico analysis of tumors, the LLC do not produce IL-4.
Reviewer #2 raises important points about the source of lactate and IL-4 in tumors as relevance for our investigation of how these factors can alter rhythms in macrophages. Tumor-infiltrating Th2 CD4 T cells are potential sources of IL-4 and IL-13 in the tumor (see Shiao 2015 Cancer Immunol Res). Various cells in the tumor can produce lactate. We discuss this in both the Introduction and the Results: poor vascularization of tumors results in hypoxia areas, where cells are pushed toward glycolysis to survive and thus secrete increased glycolytic waste products such as protons and lactate. As lactate is lactic acid, ionized it is sodium l-lactate.
How can the circadian rhythm affect the function of BMDM? The Authors should provide evidence that circadian rhythm affects the function of polarized MF.
We agree with Reviewer #2 that the next step is to determine how altered rhythms influence function of macrophages. This will be the topic of future work, but is outside the scope of this paper. Our contribution with this paper is providing the first evidence that rhythms are altered in the TME and the TME-associated conditions can alter rhythms in macrophages. We have added what is currently known about how circadian rhythms influence macrophages function to the discussion section to facilitate a conversation about this important future direction. Please see the updated text below.
"Considering our observations that conditions associated with the TME can alter circadian rhythms in macrophages, it becomes increasingly important to understand the relevance of macrophage rhythms to their function in tumors. It has been shown that acidic pH and lactate can each drive functional polarization of macrophages toward a phenotype that promotes tumor growth, with acidic pH modulating phagocytosis and suppressing inflammatory cytokine secretion and cytotoxicity[28, 30, 93]. However, how the changes in circadian rhythms of macrophages driven by these conditions contributes to their altered function remains unknown. Current evidence suggests that circadian rhythms confer a time-of-day-dependency on macrophage function by gating the macrophage response to inflammatory stimuli based on time-of-day. As such, responses to inflammatory stimuli such as LPS or bacteria are heightened during the active phase while the inflammatory response is suppressed during the inactive phase. An important future direction will be to determine how changes in circadian rhythms of macrophages, such as those observed under acidic pH or high lactate, influences the circadian gating of their function."
In Figure 3, the authors show data from peritoneal cells. The isolated peritoneal cells are not pure macrophage populations. Based on the referred article in the manuscript, the peritoneal cavity contains more then 50% of lymphocytes, and the myeloid compartment contains 80% macrophages.
Reviewer #2 raises important concerns about the purity of the peritoneal population used in our experiments. We enrich for peritoneal macrophages from the peritoneal exudate cells by removing non-adherent cells in culture. This is described in our Methods section and is a method of isolation that is commonly used in the field, as lymphocytes are non-adherent. In addition to the source cited in the paper within our Methods section (Goncalves 2015 Curr Prot Immunol), please see Layoun 2015 J Vis Exp, de Jesus 2022 STAR Protocols, and Harvard HLA Lab protocol - macrophages enriched in this manner have been shown to be over 90% pure. We have modified our Methods section to make this clear, and added the additional references in this response to this section of our Methods. Please see the modified text below.
"Peritoneal exudate cells were harvested from mice as previously published[137]. To isolate peritoneal macrophages, peritoneal exudate cells were seeded at 1.2*106 cells/mL in RPMI/10% HI FBS supplemented with 100U/mL Penicillin-Streptomycin and left at 37⁰C for 1 hour, after which non-adherent cells were rinsed off[136]. Isolation of peritoneal macrophages using this method has been shown to yield a population that is over 90% in purity[138, 139]. Peritoneal macrophages were then cultured in Atmospheric Media at pH 7.4 or 6.5 with 100μM D-luciferin, and kept at 37⁰C in atmospheric conditions."
The figure legend of Figure 3 describes the effects of pH on the circadian rhythm of bone marrow-derived macrophages ex vivo. Peritoneal macrophages involve tissue resident peritoneal macrophages with yolk sac and fetal liver origin, and also involve small peritoneal MF with bone marrow origin. The altered description of results and figure legends makes confusion.
We are very grateful to Reviewer #2 for pointing out our typo. We have fixed the caption of Figure 3 to properly describe the data as "peritoneal macrophages ex vivo".
In Figure 6C, one single Western blot is shown with any quantification. The authors should provide data of the relative protein level of p-CREB from at least 3 independent experiments. In the Western-blot part of the methods, the authors described that the pellet was discarded after cell lysis. The p-CREB is the activated form of the transcription factor CREB and there is increased binding to the chromatin to regulate gene expression. By discarding the pellet after cell lysis, the chromatin-bond p-CREB could be also removed at the same time.
We thank Reviewer 2 for bringing up this point. We agree that quantification is an important aspect of western blot. We have repeated the experiment again for n=3 and provide quantification of pCREB normalized to total protein. We have added these data, shown below, to Figure 5.
Reviewer #2 also expressed concern that we may not be capturing all of the CREB due to nuclear localization and chromatin binding. We specifically chose the lysis buffer M-Per, which is formulated to lyse the nucleus and solubilize nuclear and chromatin-bound proteins. To demonstrate this, we show in the below Figure to the Reviewer that the nuclear protein p85 is solubilized and readily detectable by western blot using our protein extraction method.
We have also added an additional sentence in the Methods section for clarity - please see the modified text below.
"Cells were lysed using the M-Per lysis reagent (Thermo Scientific, CAT#78501), supplemented with protease and phosphatase inhibitor cocktail (1:100; Sigma, CAT#PPC1010) and phosphatase inhibitor cocktail 2 (1:50; Sigma, CAT#P5726), with 200μM deferoxamine (Sigma, CAT#D9533). M-Per is formulated to lyse the nucleus and solubilize nuclear and chromatin-bound proteins, allowing isolation of nuclear proteins as well as cytosolic proteins. Lysates were incubated on ice for 1 hour, then centrifuged at 17,000 xg to pellet out debris; supernatant was collected."
It is confusing that adenylate-cyclase inhibitor MDL-12 elevated the phospho-CREB levels in BMDM. How can the authors exclude any other inducers of CREB phosphorylation?
We agree with Reviewer #2 that it is surprising pCREB was elevated with MDL-12 treatment alone, and we do indeed think that there are other pathways contributing to this. We have addressed this point in the Discussion - please see the text below.
"The mechanism through which acidic pH can modulate the circadian clock in macrophages remains unclear. Evidence in the literature suggests that acidic pH promotes a pro-resolution phenotype in macrophages by driving signaling through the cAMP pathway[29]. It has previously been shown that cAMP signaling can modulate the circadian clock[99]. However, our data indicated that cAMP signaling was not fully sufficient to confer pH-mediated changes in circadian rhythms of macrophages (Figure 5A,B). Treatment with MDL-12, commonly known as an inhibitor of adenylyl cyclase[29, 117], resulted in suppression of pH-induced changes in amplitude of circadian rhythms but did not inhibit signaling through the cAMP signaling pathway (Figure 5C,D). While MDL-12 is commonly used as an adenylyl cyclase inhibitor, it has also been documented to have inhibitory activity toward phosphodiesterases (PDEs) and the import of calcium into the cytosol through various mechanisms[118, 119]. This is of particular interest, as calcium signaling has also been shown to be capable of modulating the circadian clock[120]. Furthermore, while acid-sensing through GPCRs have been the most well-characterized pathways in macrophages, there remain additional ways in which acidic pH can be sensed by macrophages such as acid-sensing ion channels[121, 122]. Further work is required to understand the signaling pathways through which pH can influence macrophage phenotype and circadian rhythms."
It is described in the methods that BMDM were starving for 24 hours in serum-free culture media followed by serum shock (50% FBS). The cAMP production can be induced during cell starvation which should be considered for the data representation.
We appreciate that Reviewer #2 points out that our synchronization protocol of serum starvation followed by serum shock may impact the cAMP signaling pathway in macrophages, as serum shock has been shown to induce pCREB, a downstream mediator of cAMP signaling, in rat fibroblasts. Indeed, we show in additional experiments performed (in response to Reviewer #2's major comment 1) evidence that cAMP signaling is induced in macrophages following the serum shock phase of our synchronization protocol, as indicated by elevation of Icer and pCREB. As we note above, this induction is transient and returns to baseline by 2 hours post-serum shock, the time at which we replace media and begin our experiments (CT 0).
Despite the transient nature of cAMP induction by our synchronization protocol, we agree wholeheartedly with Reviewer #2 that this must be considered in light of our experimental system in which we are studying the effect of acidic pH on circadian rhythms of macrophages, which in itself induces signaling through the cAMP signaling pathway. To address Reviewer #2's point, we have performed experiments in which we culture unstimulated BMDMs in neutral pH 7.4 or acidic pH 6.5, without prior serum starvation and serum shock (i.e. we do not submit these BMDMs to the synchronization protocol). We then observed circadian rhythms of Per2-Luc by LumiCycle to determine whether acidic pH alters circadian rhythms of BMDMs in the absence of prior serum starvation followed by serum shock. Similar to our observations in Figure 2, circadian rhythms of macrophages at pH 6.5 had increased amplitude and shortened period compared to rhythms of macrophages at pH 7.4. This indicates that pH-driven changes in circadian rhythms observed in our system are not due to the synchronization protocol. The data, shown below, have been placed in a new Supplementary Figure 6, and a discussion of these results has been added to the Results section - please see the updated text below.
"As acidic pH induces signaling through the cAMP pathway, we sought to determine whether acidic pH independently contributed to the pH-driven changes in circadian rhythms we observe in BMDMs. To test this, we omitted the synchronization step and observed BMDM rhythms by LumiCycle when cultured in neutral pH 7.4 or acidic pH 6.8 or pH 6.5 (Supplementary Figure 6). Circadian rhythms of BMDMs cultured at pH 6.5 exhibited similar changes as previously observed, with enhanced amplitude and shortened period relative to BMDMs at pH 7.4. This indicates pH-driven changes observed in circadian rhythms of BMDMs occur in the absence of prior serum starvation and serum shock. "As acidic pH independently induces signaling through the cAMP pathway, we sought to determine whether acid pH could also independently contribute to the pH-driven changes in circadian rhythms we observe in BMDMs. To test this, we omitted the synchronization step and observed BMDM rhythms by LumiCycle when cultured in neutral pH 7.4 or acidic pH 6.8 or pH 6.5 (Supplementary Figure 6). Circadian rhythms of BMDMs cultured at pH 6.5 exhibited similar changes as previously observed, with enhanced amplitude and shortened period relative to BMDMs at pH 7.4. This indicates pH-driven changes observed in circadian rhythms of BMDMs occur in the absence of prior serum starvation and serum shock."
How can the authors explain and prove that the wild type and Bmal1-KO BMDM co-injected with pancreatic cancer cells subcutaneously survive, present, and have effector functions at the same extent in the subcutaneous tissue, before and during tumor growth (Figure 9)? In other words, what kind of MF-derived parameters could be modified by disrupting the circadian rhythm of MF during tumor development? The production of MF-derived regulatory enzymes, cytokines, growth factors are affected by the disrupted circadian clock in MF?
Review #2 poses the very important question of why we see differences in tumor growth in our co-injection model, and what might be driving it. Of note, co-injection models of tumor growth are commonly used to determine macrophage-specific roles in tumor growth (Colegio 2014 Nature, Mills 2019 Cell Rep, Lee 2018 Nat Comm). We observed that tumor growth is altered when macrophages with disrupted circadian rhythms (BMAL1 KO) are co-injected compared to when macrophages with intact circadian rhythms (WT) are co-injected in a murine model of pancreatic cancer using KCKO cells. Our observation is supported by a previously published paper in which they used a co-injection model of melanoma, which we cite in the manuscript(Alexander 2020 eLife). What drives this difference in tumor growth remains an open question that is the subject of future work and is outside the scope of this paper, which focuses on our discovery that factors associated with the tumor microenvironment can alter circadian rhythms in macrophages. We have included a discussion on what is currently known about how circadian rhythms alter macrophage function, acknowledging that we have yet to answer these important questions and identifying it as interest for future work. Please see the text below.
"Considering our observations that conditions associated with the TME can alter circadian rhythms in macrophages, it becomes increasingly important to understand the relevance of macrophage rhythms to their function in tumors. It has been shown that acidic pH and lactate can each drive functional polarization of macrophages toward a phenotype that promotes tumor growth, with acidic pH modulating phagocytosis and suppressing inflammatory cytokine secretion and cytotoxicity[28, 30, 93]. However, how the changes in circadian rhythms of macrophages driven by these conditions contributes to their altered function remains unknown. Current evidence suggests that circadian rhythms confer a time-of-day-dependency on macrophage function by gating the macrophage response to inflammatory stimuli based on time-of-day. As such, responses to inflammatory stimuli such as LPS or bacteria are heightened during the active phase while the inflammatory response is suppressed during the inactive phase. An important future direction will be to determine how changes in circadian rhythms of macrophages, such as those observed under acidic pH or high lactate, influences the circadian gating of their function. Data from our lab and others suggest that disruption of the macrophage-intrinsic circadian clock accelerates tumor growth, indicating that circadian regulation of macrophages is tumor-suppressive in models of PDAC (our work) and melanoma [109]. This agrees with complementary findings that behavioral disruption of circadian rhythms in mice (through chronic jetlag) disrupts tumor macrophage circadian rhythms and accelerates tumor growth[56]. It remains unclear whether this is through the pro-tumorigenic functions of macrophages such as extracellular matrix remodeling or angiogenesis, through suppression of the anti-tumor immune response, or a combination of both functions. Further work will be needed to tease apart these distinctions."
Minor points of criticism: 1. The figure legends of the graphs and diagrams are missing in Figure 2D,E,F
We thank Reviewer #2 for pointing out that figure legends were missing. We have added legends for Figure 2D,E,F.
The BMAL1-based in vivo murine model of circadian rhythm is not introduced in the manuscript.
We thank Reviewer #2 for bringing to our attention that the BMAL1 KO macrophage model was not well-introduced in the manuscript. To address this point, we have modified the text to better introduce this model. Please see the modified text below.
"As a positive control for circadian clock disruption, we used data from BMAL1 KO peritoneal macrophages [44]. BMAL1 KO macrophages have a genetic disruption of the circadian clock due to the loss of Bmal1, the central clock gene. As a result, circadian rhythms of BMAL1 KO macrophages are disrupted, lacking rhythmicity and downstream circadian regulation of macrophage function (Supplementary Figure 8)[45, 54]. "As a positive control for circadian clock disruption, we used data from BMAL1 KO peritoneal macrophages [44]. BMAL1 KO macrophages have a genetic disruption of the circadian clock due to the loss of Bmal1, the central clock gene. As a result, circadian rhythms of BMAL1 KO macrophages are disrupted, lacking rhythmicity and downstream circadian regulation of macrophage function (Supplementary Figure 8)[45, 54]."__ __
Significance
Knudsen-Clark et al. showed that the circadian rhythm of bone marrow-derived macrophages (BMDM) can be affected by polarization stimuli, pH of the microenvironment, and by the presence of sodium-lactate. Mechanistically, the acidic pH of cell microenvironment is partly regulated by intracellular cAMP-mediated signaling events in BMDM. The authors also showed that the circadian clock of peritoneal macrophages is also modified by the pH of the cell microenvironment. Using publicly available data, the authors showed that the circadian rhythm of tumor-associated macrophages is similar to that of Bmal1-KO peritoneal macrophages. In a murine model of pancreatic cancer, the authors showed that the tumor growth is accelerated in C57BL/6 mice co-injected with cancer cells and Bmal1-KO BMDM as compared to mice co-injected with cancer cell and wild type BMDM.
We are grateful to Reviewer #2 for their very helpful comments and suggestions, which we believe have greatly enhanced the clarity and reproducibility of this manuscript.
__Reviewer #3 (Evidence, reproducibility and clarity (Required)): __
Review for Knudsen-Clark et al.
"Circadian rhythms of macrophages are altered by the acidic pH of the tumor microenvironment"
Knudsen-Clark and colleagues explore the impact of TME alterations on macrophage circadian rhythms. The authors find that both acidic pH and lactate modulate circadian rhythms which alter macrophage phenotype. Importantly, they define circadian disruption of tumor-associated macrophages within the TME and show that circadian disruption in macrophages promotes tumor growth using a PDAC line. This represents an important understanding of the crosstalk between cancer cells and immune cells as well as the understanding of how the TME disrupts circadian rhythms. The study is well-done, however, authors need to address several important points below.
We thank Reviewer #3 for their in-depth and insightful comments and suggestions, which have resulted in a much-improved manuscript. We were pleased that Reviewer #3 found the work to be "an important study that is well-done" and that it "represents an important understanding of the crosstalk between cancer cells and immune cells as well as the understanding of how the TME disrupts circadian rhythms.". In response to Reviewer #3's comments, we have added several new key experiments and changes to the text. To summarize, we added new data to Supplementary Figure 1 to better characterize our macrophage polarization states, showed in Figure 3 that low pH affects peritoneal macrophage circadian gene expression in a similar fashion as bone marrow-derived macrophages, added new data in Figure 4 to show how lactate and low pH affect circadian gene expression over time, and new computational analysis to Figures 6, 7, and Supplementary Figure 9 to probe circadian gene covariance from publicly available data. We also made several key additions to the Discussion to discuss the functional implications of macrophage circadian rhythm disruption by low pH and potential mechanisms of this disruption. Finally, at the request of Reviewer #3, we consolidated several existing Figures and added new data, where appropriate, to existing figures, and we worked to describe new findings succinctly.
Major comments:
-
In Figures 3 and 4, the authors can include additional clock genes that can be run by qPCR. This was done in Figure 2 and was a nice addition to the data.
We agree with Reviewer #3's suggestion that an analysis of clock gene expression at the mRNA level would enhance our data in Figures 3 and 4. To address this point, we have performed short time course experiments to assess circadian clock gene expression over time in BMDMs cultured with or without lactate at neutral or acidic pH (for Figure 4). In line with the difference in circadian rhythms of Per2-Luc levels between BMDMs cultured in the presence or absence of lactate which we observed by Lumicycle analysis, we measured changes in expression of the circadian clock genes Per2, Nr1d1, and Cry1 between macrophages cultured with 25 mM sodium-L-lactate compared to those cultured with 0 mM sodium-L-lactate at pH 6.5. We have added these data, shown below, to Figure 4, and updated the manuscript accordingly to discuss these results. Please see below for the new Figure Panel and modified text.
"Lactate was also observed to alter expression of the circadian clock genes Per2, Cry1, and Nr1d1 over time in BMDMs cultured at pH 6.5, while having more subtle effects at pH 7.4 (Figure 4C). Notably, lactate blunted the effect of pH 6.5 on Cry1 expression, while enhancing the effect of low pH on Nr1d1 expression. In all, these data indicate that concentration of lactate similar to that present in the TME can influence circadian rhythms and circadian clock gene expression of macrophages."
As an additional measure to address Reviewer #3's point about Figure 3 (peritoneal macrophages), we have compared expression of circadian clock genes in peritoneal macrophages cultured at neutral pH 7.4 or acidic pH 6.8 for 24 hours using a publicly available RNA-seq data set from Jiang 2021 J Immunol (GSE164697). In line with previous observations in macrophages cultured under acidic compared to neutral pH conditions, including the clock gene expression data from Figure 2 in BMDMs and the Per2-Luc levels observed in peritoneal macrophages in Figure 3, we found that peritoneal macrophages exhibited differences in expression of circadian clock genes when cultured at acidic pH 6.8 compared to neutral pH 7.4. We have added these data, shown below, as Figure 3B, and have updated the manuscript accordingly - please see below for the new Figure panel and modified text.
"To test whether pH-driven changes in circadian rhythms of peritoneal macrophages were reflected at the mRNA level, we compared expression of circadian clock genes in peritoneal macrophages cultured at neutral pH 7.4 or acidic pH 6.8 for 24 hours using publicly available RNA-sequencing data [30]. In line with altered circadian rhythms observed by Lumicycle, peritoneal macrophages cultured at pH 6.8 expressed different levels of circadian clock genes than peritoneal macrophages culture at pH 7.4 (Figure 3B). The trends in changes of gene expression in peritoneal macrophages cultured at pH 6.8 matched what we observed in BMDMs, where low pH generally led to higher levels of circadian clock gene expression (Figure 2D-F). These data support our observations by LumiCycle and indicate that acidic pH drives transcriptional changes in multiple components of the circadian clock. In all, these data are evidence that pH-dependent changes in circadian rhythms are relevant to in vivo-differentiated macrophages."
We have also updated the Methods section appropriately
"FASTQ files from a previously published analysis of peritoneal macrophages cultured under neutral pH 7.4 or acidic pH 6.8 conditions were downloaded from NCBI GEO (accession #GSE164697) [30]."
2) There are far too many figures with minimal data in each. Please consolidate the figures. For example, Figures 1-3 can be fully combined, Figures 4-6 can be combined, and Figures 7-8 can be combined. Additionally, it is unclear if Figure 5 needs to be in the main, it can be moved to the supplement.
We appreciate the preference of Reviewer #3 to see some of the figures consolidated. We have combined Figures 5 and 6 into a single new Figure 5. Additionally, we have added new data from revisions to current figures to increase the amount of data in each figure and minimize the amount of new figures generated. In all, despite the large amount of new data added to the paper in response to Reviewer comments and suggestions (including additional data in Figure 4 and new Figures 6 and 8), our manuscript now contains 10 main Figures, only one more than the initial submission.
3) The observation that conditions like pH and lactate alter macrophage phenotype and rhythmicity are important. However, macrophage phenotype via gene expression does not always correlate to function. It is important for authors to demonstrate the effect of pH or lactate on macrophage function. This can be done using co-culture assays with cancer cells. If these experiments cannot be performed, it is suggested that authors discuss these limitations and consideration in the discussion.
Reviewer #3 correctly points out that changes in phenotype does not always correlate to changes in function. Others have shown that acidic pH and lactate can each alter macrophage phenotype, and also alter macrophage function and the ability to promote tumor growth (please see El-Kenawi 2019 Br J Cancer, Jiang 2021 J Immunol, Colegio 2014 Nature). How changes in rhythms influence macrophage function remains unknown and we agree with Reviewer #3 that this is an important future direction, We have added a section in the Discussion to facilitate the discussion of this important future direction. Please see the text below.
"Considering our observations that conditions associated with the TME can alter circadian rhythms in macrophages, it becomes increasingly important to understand the relevance of macrophage rhythms to their function in tumors. It has been shown that acidic pH and lactate can each drive functional polarization of macrophages toward a phenotype that promotes tumor growth, with acidic pH modulating phagocytosis and suppressing inflammatory cytokine secretion and cytotoxicity[28, 30, 93]. However, how the changes in circadian rhythms of macrophages driven by these conditions contributes to their altered function remains unknown. Current evidence suggests that circadian rhythms confer a time-of-day-dependency on macrophage function by gating the macrophage response to inflammatory stimuli based on time-of-day. As such, responses to inflammatory stimuli such as LPS or bacteria are heightened during the active phase while the inflammatory response is suppressed during the inactive phase. An important future direction will be to determine how changes in circadian rhythms of macrophages, such as those observed under acidic pH or high lactate, influences the circadian gating of their function."
4) On line 119-122, authors describe a method for polarization of macrophages. They then reference one gene to confirm each macrophage polarization state. To more definitively corroborate proper macrophage polarization, authors should perform qPCR for additional target genes that are associated with each phenotype. For example, Socs3, CD68, or CD80 for M1, and CD163 or VEGF for M2. Alternatively, the authors should cite previous literature validating this in vitro polarization model.
We appreciate Reviewer #3's suggestion to better the phenotypic identity of our polarization models with additional canonical markers. To address this point, we have expanded our panel using transcriptional markers commonly used in the murine polarization model for M1 macrophages such as Tnfa, Il6, and Il1b. As discussed in the response to Reviewer #1's minor point 5 and Reviewer #2's major point 2, we have also expanded our panel to include additional markers for M2 such as Vegf, Retnla, Ym1, Mgl1, and CD206. We have added these new data to Supplementary Figure 1. Finally, we have added additional citations for the in vitro polarization models. Please see the modified text and new data, below.
"As macrophages are a phenotypically heterogeneous population in the TME, we first sought to understand whether diversity in macrophage phenotype could translate to diversity in circadian rhythms of macrophages. To this end, we used two well-established in vitro polarization models to study distinct macrophage phenotypes[5, 60-63]. For a model of pro-inflammatory macrophages, we stimulated macrophages with IFNγ (interferon γ) and LPS (lipopolysaccharide) to elicit a pro-inflammatory phenotype[60, 64]. These macrophages are often referred to as 'M1' and are broadly viewed as anti-tumorigenic, and we will refer to them throughout this paper as pro-inflammatory macrophages[65, 66]. For a model at the opposite end of the phenotypic spectrum, we stimulated macrophages with IL-4 and IL-13[60, 67]. While these type 2 stimuli play a role in the response to parasites and allergy, they are also major drivers of wound healing; in line with this, IL-4 and IL-13-stimulated macrophages have been well-characterized to adopt gene expression profiles associated with wound-healing and anti-inflammatory macrophage phenotypes[68-71]. As such, these macrophages are often used as a model to study pro-tumorigenic macrophages in vitro and are often referred to as 'M2' macrophages; throughout this paper, we will refer to IL-4 and IL-13-stimulated macrophages as pro-resolution macrophages[66, 72, 73]. Consistent with previous studies, we found that genes associated with anti-inflammatory and pro-resolution programming characteristic of IL-4 and IL-13-stimulated macrophages such as Arg1, Retnla, Chil3 (Ym1), Clec10a (MGL1), and Mrc1 (CD206) were induced in IL-4 and IL-13-stimulated macrophages, but not IFNγ and LPS-stimulated macrophages. In contrast, genes associated with pro-inflammatory activity characteristic of IFNγ and LPS-stimulated macrophages such as Nos2 (iNOS), Tnfa, Il1b, and Il6 were induced in IFNγ and LPS-stimulated macrophages, but not IL-4 and IL-13-stimulated macrophages (Supplementary Figure 1)[28, 30, 65, 71, 74, 75]. This indicates that macrophages stimulated with IL-4 and IL-13 were polarized toward a pro-resolution phenotype, while macrophages stimulated with IFNγ and LPS were polarized toward a pro-inflammatory phenotype.
5) Several portions of the manuscript are unnecessarily long, including the intro and discussion. Please consolidate the text. The results section is also very lengthy, please consider consolidation.
We appreciate Reviewer #3's preference for a shorter manuscript. The revised manuscript, in response to the many Reviewer comments and requests, contains many new pieces of data, and we have taken care to describe these new data as briefly and simply as possible. In preparation for this Revision, we also removed and shortened several sections of the Results and Discussion where we felt extra explanation was not necessary. We will work with the editor of the journal we submit to ensure the length of the manuscript sections is compliant with the journal's guidelines.
6) The authors find that macrophage phenotype impacts rhythmicity. However, there is no mechanistic understanding of why this occurs. The authors should provide some mechanistic insight on this topic in the discussion.
We agree with Reviewer #3 that while the mechanism by which macrophage phenotype alters rhythms remains unknown, this is an important topic of discussion. While there is some literature on how circadian rhythms modulate inflammatory response (and hints at how it may influence phenotype) in macrophages, there is very little on the converse: how phenotype may influence circadian rhythms. We address this point by expanding on our Discussion - please see the modified text below.
"Elucidating the role of circadian rhythms in regulation of macrophage biology necessitates a better understanding of the crosstalk between phenotype and circadian rhythms. Although lactate polarizes macrophages toward a pro-resolution phenotype similar to acidic pH[30, 93], exposure to lactate had different effects on circadian rhythms - and in some cases, circadian clock gene expression - than exposure to acidic pH (Figure 4). Sensing of lactate occurs through different pathways than acid-sensing, which may contribute to the different ways in which these two stimuli modulate circadian rhythms of macrophages[111]. One previously published finding that may offer mechanistic insight into how phenotype can influence circadian rhythms is the suppression of Bmal1 by LPS-inducible miR-155[54]. It has also been observed that RORα-mediated activation of Bmal1 transcription is enhanced by PPARγ co-activation[112]. In macrophages, PPARγ expression is induced upon stimulation with IL-4 and plays a key role in alternative activation of macrophages, promoting a pro-resolution macrophage phenotype, and supporting resolution of inflammation[113-115]. Such observations prompt the question of whether there are yet-unidentified factors induced downstream of various polarizing stimuli that can modulate expression of circadian genes at the transcriptional and protein levels. Further work is required to understand the interplay between macrophage phenotype and circadian rhythms."
7) The data presented in Figure 9 is very intriguing and arguably the strongest aspect of the paper. To strengthen the point, the authors could repeat this experiment with an additional cell model, another PDAC line or a different cancer line.
We appreciate Reviewer #3's comment about the impact of tumor growth data. Indeed, our finding that deletion of Bmal1 in co-injected macrophages accelerated PDAC growth has been recapitulate by others in different cancer models. This lends strength to our observations. We discuss and cite complementary work on macrophage rhythms and tumor growth in other models of cancer the Discussion, please see below.
"Data from our lab and others suggest that disruption of the macrophage-intrinsic circadian clock accelerates tumor growth, indicating that circadian regulation of macrophages is tumor-suppressive in models of PDAC (our work) and melanoma [109]. This agrees with complementary findings that behavioral disruption of circadian rhythms in mice (through chronic jetlag) disrupts tumor macrophage circadian rhythms and accelerates tumor growth[56]."
Minor Comments:
1) Data is Figure 2 is interesting and the impact on circadian rhythms is clear based on changes in amplitude and period. However, though the impact on period and amplitude is clear from Figures 2A-C, the changes in circadian gene expression are less clear. For instance, though amplitude is up in 2B, amplitude is suppressed in 2C. However, that does not appear to be reflected in the gene expression data in Figures 2E and F. The authors should comment on this.
Reviewer #3 correctly points out that there appear to be discrepancies between the LumiCycle data in Figure 2 and the circadian gene expression data in Figure 2. This discrepancy is perhaps unsurprising given that the gene expression data is only a short time course over 12 hours, while the LumiCycle data are collected over a course of 3 days. The gene expression data do not allow us to determine changes in period or rhythm. Another point of interest is that it's been shown that circadian regulation occurs on many different levels (transcriptional, post-transcriptional, translational, post-translational). As result of this, circadian patterns observed in gene transcripts don't always match those of their encoded proteins; just the same, circadian patterns of proteins aren't always reflected in their encoding gene transcripts (Collins 2021 Genome Res). Due to this multi-level regulation, we propose that the results of the LumiCycle analysis, which measures PER2-Luc levels, are a more robust readout of rhythms because they are further downstream of the molecular clock than transcriptional readouts. That said, observing changes at both the protein (by Lumicycle) and transcriptional level confirm that all components of the clock are altered by acidic pH, even if the way in which they are altered appears to differ. We have incorporated the points we raised above into the Results section.
Please see the modified text below.
"Low pH was also observed to alter the expression of the circadian clock genes Per2, Cry1, and Nr1d1 (REV-ERBα) over time across different macrophage phenotypes, confirming that multiple components of the circadian clock are altered by acidic pH (Figure 2D-F). Notably, the patterns in expression of circadian genes did not always match the patterns of PER2-Luc levels observed by LumiCycle. This is perhaps unsurprising, as circadian rhythms are regulated at multiple levels (transcriptional, post-transcriptional, translational, post-translational); as a result, circadian patterns observed in circadian proteins such as PER2-Luc do not always match those of their gene transcripts[77]."
2) On line 156-158, authors describe damping rate. I believe the authors are trying to say that damping rate increases as the time it takes cells to desynchronize decreases and vice versa. However, this point needs to be better explained.
We thank Reviewer #3 for bringing to our attention that this was not communicated clearly in the text. We have adjusted our explanation to be clearer. Please see the modified text below.
"Damping of rhythms in most free-running cell populations (defined as populations cultured in the absence of external synchronizing stimuli) occurs naturally as the circadian clocks of individual cells in the population become desynchronized from each other; thus, damping can be indicative of desynchrony within a population[84]. The damping rate increases as the time it takes for rhythms to dissipate decreases; conversely, as damping rate decreases as the time it takes for rhythms to dissipate increases."
3) Data presented in Figures 3 and 4 are different in terms of the impact of changing the pH. The source of the macrophages is different, but the authors could clarify this further.
We thank Reviewer #3 for this comment. Our conclusion is that the impact of low pH is largely similar in Figure 3 (peritoneal macrophages) and Figure 4 (BMDMs exposed to low pH and lactate). In both Figures 3 and 4, exposure to acidic pH by culturing macrophages at pH 6.5 increased amplitude, decreased period, and increased damping rate compared to macrophages cultured at neutral pH 7.4.
4) For heatmaps shown in Figures 7 and 8, please calculate covariance and display asterisks where P We thank Reviewer #3 for the excellent suggestion to use an additional approach to asses circadian clock status in samples by measuring co-variance in the circadian clock gene network. To address this point, we have performed weighted gene co-expression network analysis (WGCNA) to calculate covariance, as was originally performed in Chun and Fortin et al Science Advances 2022. For the samples analyzed in Figure 7 (now Figure 6), we have added these data to the figure. We have applied this analysis to a new set of human data that we analyzed and added it to the new Figure 7. Finally, for the samples analyzed in Figure 8, we have added these data as a new Supplementary Figure 9. Please see the data and modified text below.
Figure 6
"Weighted gene co-expression network analysis (WGCNA) has been used as an alternate approach to measure the co-variance between clock genes and thus assess bi-directional correlations among the core clock gene network in healthy tissue and tumor samples [103]. In line with the circadian disorder observed by CCD, while many bi-directional correlations among the core clock gene network were significant and apparent in wild type peritoneal macrophages, these relationships were altered or abolished within BMAL1 KO peritoneal macrophages and TAM samples, and in some cases replaced by new relationships (Figure 6E). This indicates that there is population-level disorder in the circadian rhythms of tumor-associated macrophages in murine lung cancer."
Figure 7
"We next assessed the status of the circadian clock in human TAMs from NSCLC patients. We performed CCD with publicly available RNA-seq data of tumor-adjacent macrophages and tumor-associated macrophages from NSCLC patients, using alveolar macrophages from healthy donors as a control[104, 105]. To assess the contribution of the acidic TME to circadian disorder, we subset TAM NSCLC patient samples into groups (Crem high TAMs and Crem low TAMs) based on median Crem expression. Notably, in macrophages from human NSCLC there was a trend toward disorder in Crem low but not Crem high TAM samples (Figure 7A,B). Additionally, the co-variance among core clock genes observed in alveolar macrophages from healthy donors was absent within Crem low and Crem high TAM samples (Figure 7C). In all, these data indicate that there is population-level disorder in the circadian rhythms of tumor-associated macrophages in humans and mice, suggesting that circadian rhythms are indeed altered in macrophages within the TME."
Supplementary Figure 9
"CCD score worsened as populations became increasingly desynchronized, with the 12hr desynchronized population having a significantly worse CCD score than synchronized, homogenous macrophage population (Figure 8C). This indicates that as circadian rhythms of individual macrophages within a population become more different from each other, circadian disorder increases at the population-level. This is further supported by WGCNA, which revealed that the significant co-variance of circadian clock genes in the synchronized population was progressively altered and lost as the population is increasing desynchronized to 12 hours (Supplementary Figure 9)."
Reviewer #3 (Significance (Required)):
This is an important study that is well-done. It is the feeling of the reviewer that the study warrants a revision, at the discretion of the editor. The study represents an important understanding of the crosstalk between cancer cells and immune cells as well as the understanding of how the TME disrupts circadian rhythms.
We thank Reviewer #3 for their comments regarding the impact and significance of our work. As shown by the comments above, we are confident we have fully addressed each of the points that were made to result in a much-improved revised manuscript.
-
-
Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.
Learn more at Review Commons
Referee #3
Evidence, reproducibility and clarity
Review for Knudsen-Clark et al. "Circadian rhythms of macrophages are altered by the acidic pH of the tumor microenvironment"
Knudsen-Clark and colleagues explore the impact of TME alterations on macrophage circadian rhythms. The authors find that both acidic pH and lactate modulate circadian rhythms which alter macrophage phenotype. Importantly, they define circadian disruption of tumor-associated macrophages within the TME and show that circadian disruption in macrophages promotes tumor growth using a PDAC line. This represents an important understanding of the crosstalk between cancer cells and immune cells as well as the understanding of how the TME disrupts circadian rhythms. The study is well-done, however, authors need to address several important points below.
Major comments:
- In Figures 3 and 4, the authors can include additional clock genes that can be run by qPCR. This was done in Figure 2 and was a nice addition to the data.
- There are far too many figures with minimal data in each. Please consolidate the figures. For example, Figures 1-3 can be fully combined, Figures 4-6 can be combined, and Figures 7-8 can be combined. Additionally, it is unclear if Figure 5 needs to be in the main, it can be moved to the supplement.
- The observation that conditions like pH and lactate alter macrophage phenotype and rhythmicity are important. However, macrophage phenotype via gene expression does not always correlate to function. It is important for authors to demonstrate the effect of pH or lactate on macrophage function. This can be done using co-culture assays with cancer cells. If these experiments cannot be performed, it is suggested that authors discuss these limitations and consideration in the discussion.
- On line 119-122, authors describe a method for polarization of macrophages. They then reference one gene to confirm each macrophage polarization state. To more definitively corroborate proper macrophage polarization, authors should perform qPCR for additional target genes that are associated with each phenotype. For example, Socs3, CD68, or CD80 for M1, and CD163 or VEGF for M2. Alternatively, the authors should cite previous literature validating this in vitro polarization model.
- Several portions of the manuscript are unnecessarily long, including the intro and discussion. Please consolidate the text. The results section is also very lengthy, please consider consolidation.
- The authors find that macrophage phenotype impacts rhythmicity. However, there is no mechanistic understanding of why this occurs. The authors should provide some mechanistic insight on this topic in the discussion.
- The data presented in Figure 9 is very intriguing and arguably the strongest aspect of the paper. To strengthen the point, the authors could repeat this experiment with an additional cell model, another PDAC line or a different cancer line.
Minor Comments:
- Data is Figure 2 is interesting and the impact on circadian rhythms is clear based on changes in amplitude and period. However, though the impact on period and amplitude is clear from Figures 2A-C, the changes in circadian gene expression are less clear. For instance, though amplitude is up in 2B, amplitude is suppressed in 2C. However, that does not appear to be reflected in the gene expression data in Figures 2E and F. The authors should comment on this.
- On line 156-158, authors describe damping rate. I believe the authors are trying to say that damping rate increases as the time it takes cells to desynchronize decreases and vice versa. However, this point needs to be better explained.
- Data presented in Figures 3 and 4 are different in terms of the impact of changing the pH. The source of the macrophages is different, but the authors could clarify this further.
- For heatmaps shown in Figures 7 and 8, please calculate covariance and display asterisks where P < 0.001. This will more clearly demonstrate the loss of co-variance between the clock network as a result of clock disruption, the TME, and cell desynchrony.
Significance
This is an important study that is well-done. It is the feeling of the reviewer that the study warrants a revision, at the discretion of the editor. The study represents an important understanding of the crosstalk between cancer cells and immune cells as well as the understanding of how the TME disrupts circadian rhythms.
-
Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.
Learn more at Review Commons
Referee #2
Evidence, reproducibility and clarity
Knudsen-Clark et al. showed that the circadian rhythm of bone marrow-derived macrophages (BMDM) can be affected by polarization stimuli, pH of the microenvironment, and by the presence of sodium-lactate. Mechanistically, the acidic pH of cell microenvironment is partly regulated by intracellular cAMP-mediated signaling events in BMDM. The authors also showed that the circadian clock of peritoneal macrophages is also modified by the pH of the cell microenvironment. Using publicly available data, the authors showed that the circadian rhythm of tumor-associated macrophages is similar to that of Bmal1-KO peritoneal macrophages. In a murine model of pancreatic cancer, the authors showed that the tumor growth is accelerated in C57BL/6 mice co-injected with cancer cells and Bmal1-KO BMDM as compared to mice co-injected with cancer cell and wild type BMDM.
Major points of criticism: 1. Nine main figures include different experimental models on a non-systematic manner in the manuscript, and only literature-based correlation is used to link the results each other. The authors used in vitro BMDM and peritoneal cell-based model systems to study the effects of IL4+IL13, IFN+LPS, low pH, sodium-lactate, adenylate cyclase inhibitors on the circadian clock of macrophages. The link between these microenvironment conditions of the cells is still correlative with the tumor microenvironment: publicly available data were used to correlate the increased expression level of cAMP-activated signaling events with the presence of acidic pH of tumor microenvironment. Notably, the cell signaling messenger molecule cAMP is produced by not only low extracellular pH by activated GPCRs, but also starvation of the cell. The starvation is also relevant to this study, since the BMDM used in the in vitro culture system were starving for 24 hours before the measurement of Per2-Luc expression to monitor circadian rhythm. 2. The definition of pre-resolution macrophages (MF) used across the manuscript could be argued. The authors defined BMDM polarized with IL-4 and IL-13 as pre-resolution MF. Resolution is followed by inflammation, but the IL-4 secretion does not occur in every inflammatory setting. Moreover, IL-4 and IL-13 are secreted during specific tissue environment and immunological settings involving type 2 inflammation or during germinal center reactions of the lymph nodes. • What are the characteristics of pre-resolution macrophages (MF)? The authors indicated that IL-4 and IL-13 cytokines were used to model the pre-resolution macrophages. In which pathological context are these cytokines produced and induce pre-resolution macrophages? IL-4 polarized BMDM can also produce pro-inflammatory protein and lipid mediators as compared to LPS-stimulated BMDM, and IL-4 polarized BMDM still have potent capacity to recruit immune cells and to establish type 2 inflammation. • The authors showed Arg1 and Vegfa qPCR data from BMDM only. Based on the literature, these MFs are anti-inflammatory cells particularly. Resolution-related MFs followed by acute inflammation are a specific subset of MFs, and the phenotype of pre-resolution MF should be described, referred, and measured specifically. 3. The authors used IFN and LPS, or IL-4 and IL-13 and co-treatments to polarize BMDM in to type 1 (referred as pro-inflammatory MF) and type 2 (referred as pre-resolution MF) activation state. The comparison between these BMDM populations has limitations, since LPS induces a potent inflammatory response in MF. The single treatment with MF-polarizing cytokines enable a more relevant comparison to study the circadian clock in classically and alternatively activated MF. 4. There are missing links between the results of showing the circadian rhythm of polarized BMDM, sodium-lactate treated BMDM, and tumor growth. Specifically, do the used pancreatic ductal adenocarcinoma cells produce IL-4 and sodium-lactate? In the LLC-based experimental in silico analysis of tumors, the LLC do not produce IL-4. 5. How can the circadian rhythm affect the function of BMDM? The Authors should provide evidence that circadian rhythm affects the function of polarized MF. 6. In Figure 3, the authors show data from peritoneal cells. The isolated peritoneal cells are not pure macrophage populations. Based on the referred article in the manuscript, the peritoneal cavity contains more then 50% of lymphocytes, and the myeloid compartment contains 80% macrophages. 7. The figure legend of Figure 3 describes the effects of pH on the circadian rhythm of bone marrow-derived macrophages ex vivo. Peritoneal macrophages involve tissue resident peritoneal macrophages with yolk sac and fetal liver origin, and also involve small peritoneal MF with bone marrow origin. The altered description of results and figure legends makes confusion. 8. In Figure 6C, one single Western blot is shown with any quantification. The authors should provide data of the relative protein level of p-CREB from at least 3 independent experiments. In the Western-blot part of the methods, the authors described that the pellet was discarded after cell lysis. The p-CREB is the activated form of the transcription factor CREB and there is increased binding to the chromatin to regulate gene expression. By discarding the pellet after cell lysis, the chromatin-bond p-CREB could be also removed at the same time. 9. It is confusing that adenylate-cyclase inhibitor MDL-12 elevated the phospho-CREB levels in BMDM. How can the authors exclude any other inducers of CREB phosphorylation? 10. It is described in the methods that BMDM were starving for 24 hours in serum-free culture media followed by serum shock (50% FBS). The cAMP production can be induced during cell starvation which should be considered for the data representation. 11. How can the authors explain and prove that the wild type and Bmal1-KO BMDM co-injected with pancreatic cancer cells subcutaneously survive, present, and have effector functions at the same extent in the subcutaneous tissue, before and during tumor growth (Figure 9)? In other words, what kind of MF-derived parameters could be modified by disrupting the circadian rhythm of MF during tumor development? The production of MF-derived regulatory enzymes, cytokines, growth factors are affected by the disrupted circadian clock in MF?
Minor points of criticism: 1. The figure legends of the graphs and diagrams are missing in Figure 2D,E,F 2. The BMAL1-based in vivo murine model of circadian rhythm is not introduced in the manuscript.
Significance
Knudsen-Clark et al. showed that the circadian rhythm of bone marrow-derived macrophages (BMDM) can be affected by polarization stimuli, pH of the microenvironment, and by the presence of sodium-lactate. Mechanistically, the acidic pH of cell microenvironment is partly regulated by intracellular cAMP-mediated signaling events in BMDM. The authors also showed that the circadian clock of peritoneal macrophages is also modified by the pH of the cell microenvironment. Using publicly available data, the authors showed that the circadian rhythm of tumor-associated macrophages is similar to that of Bmal1-KO peritoneal macrophages. In a murine model of pancreatic cancer, the authors showed that the tumor growth is accelerated in C57BL/6 mice co-injected with cancer cells and Bmal1-KO BMDM as compared to mice co-injected with cancer cell and wild type BMDM.
Major points of criticism:
- Nine main figures include different experimental models on a non-systematic manner in the manuscript, and only literature-based correlation is used to link the results each other. The authors used in vitro BMDM and peritoneal cell-based model systems to study the effects of IL4+IL13, IFN+LPS, low pH, sodium-lactate, adenylate cyclase inhibitors on the circadian clock of macrophages. The link between these microenvironment conditions of the cells is still correlative with the tumor microenvironment: publicly available data were used to correlate the increased expression level of cAMP-activated signaling events with the presence of acidic pH of tumor microenvironment. Notably, the cell signaling messenger molecule cAMP is produced by not only low extracellular pH by activated GPCRs, but also starvation of the cell. The starvation is also relevant to this study, since the BMDM used in the in vitro culture system were starving for 24 hours before the measurement of Per2-Luc expression to monitor circadian rhythm.
- The definition of pre-resolution macrophages (MF) used across the manuscript could be argued. The authors defined BMDM polarized with IL-4 and IL-13 as pre-resolution MF. Resolution is followed by inflammation, but the IL-4 secretion does not occur in every inflammatory setting. Moreover, IL-4 and IL-13 are secreted during specific tissue environment and immunological settings involving type 2 inflammation or during germinal center reactions of the lymph nodes.
- What are the characteristics of pre-resolution macrophages (MF)? The authors indicated that IL-4 and IL-13 cytokines were used to model the pre-resolution macrophages. In which pathological context are these cytokines produced and induce pre-resolution macrophages? IL-4 polarized BMDM can also produce pro-inflammatory protein and lipid mediators as compared to LPS-stimulated BMDM, and IL-4 polarized BMDM still have potent capacity to recruit immune cells and to establish type 2 inflammation.
- The authors showed Arg1 and Vegfa qPCR data from BMDM only. Based on the literature, these MFs are anti-inflammatory cells particularly. Resolution-related MFs followed by acute inflammation are a specific subset of MFs, and the phenotype of pre-resolution MF should be described, referred, and measured specifically.
- The authors used IFN and LPS, or IL-4 and IL-13 and co-treatments to polarize BMDM in to type 1 (referred as pro-inflammatory MF) and type 2 (referred as pre-resolution MF) activation state. The comparison between these BMDM populations has limitations, since LPS induces a potent inflammatory response in MF. The single treatment with MF-polarizing cytokines enable a more relevant comparison to study the circadian clock in classically and alternatively activated MF.
- There are missing links between the results of showing the circadian rhythm of polarized BMDM, sodium-lactate treated BMDM, and tumor growth. Specifically, do the used pancreatic ductal adenocarcinoma cells produce IL-4 and sodium-lactate? In the LLC-based experimental in silico analysis of tumors, the LLC do not produce IL-4.
- How can the circadian rhythm affect the function of BMDM? The Authors should provide evidence that circadian rhythm affects the function of polarized MF.
- In Figure 3, the authors show data from peritoneal cells. The isolated peritoneal cells are not pure macrophage populations. Based on the referred article in the manuscript, the peritoneal cavity contains more then 50% of lymphocytes, and the myeloid compartment contains 80% macrophages.
- The figure legend of Figure 3 describes the effects of pH on the circadian rhythm of bone marrow-derived macrophages ex vivo. Peritoneal macrophages involve tissue resident peritoneal macrophages with yolk sac and fetal liver origin, and also involve small peritoneal MF with bone marrow origin. The altered description of results and figure legends makes confusion.
- In Figure 6C, one single Western blot is shown with any quantification. The authors should provide data of the relative protein level of p-CREB from at least 3 independent experiments. In the Western-blot part of the methods, the authors described that the pellet was discarded after cell lysis. The p-CREB is the activated form of the transcription factor CREB and there is increased binding to the chromatin to regulate gene expression. By discarding the pellet after cell lysis, the chromatin-bond p-CREB could be also removed at the same time.
- It is confusing that adenylate-cyclase inhibitor MDL-12 elevated the phospho-CREB levels in BMDM. How can the authors exclude any other inducers of CREB phosphorylation?
- It is described in the methods that BMDM were starving for 24 hours in serum-free culture media followed by serum shock (50% FBS). The cAMP production can be induced during cell starvation which should be considered for the data representation.
- How can the authors explain and prove that the wild type and Bmal1-KO BMDM co-injected with pancreatic cancer cells subcutaneously survive, present, and have effector functions at the same extent in the subcutaneous tissue, before and during tumor growth (Figure 9)? In other words, what kind of MF-derived parameters could be modified by disrupting the circadian rhythm of MF during tumor development? The production of MF-derived regulatory enzymes, cytokines, growth factors are affected by the disrupted circadian clock in MF?
Minor points of criticism:
- The figure legends of the graphs and diagrams are missing in Figure 2D,E,F
- The BMAL1-based in vivo murine model of circadian rhythm is not introduced in the manuscript.
-
Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.
Learn more at Review Commons
Referee #1
Evidence, reproducibility and clarity
The manuscript by Knudsen-Clark et al. investigates the novel topic of circadian rhythms in macrophages and their role in tumorigenesis. The authors explore how circadian rhythms of macrophages may be influenced by the tumor microenvironment (TME). They utilize a system of bone marrow-derived macrophages obtained from transgenic mice carrying PER2-Luciferase (PER2-Luc), a trackable marker of rhythmic activity. The study evaluates how conditions associated with the TME, such as polarizing stimuli (to M1 or M2 subtype), acidic pH, and elevated lactate, can each alter circadian rhythms in macrophages. The authors employ several approaches to explore macrophage functions in cancer-related settings. While the manuscript presents interesting findings and may be the first to demonstrate that tumor stimuli alter circadian rhythms in macrophages and impact tumor growth, it lacks a clear conclusion regarding the role of altered circadian rhythms in suppressing tumor growth. . Several discrepancies need to be addressed before publication, therefore, the manuscript requires revision before publication, addressing the following comments:
Major comments:
- It is well known that pro-inflammatory macrophages primarily rely on glycolysis during inflammation, exhibiting dysregulated tricarboxylic acid (TCA) cycle activity. These pro-inflammatory macrophages are commonly referred to as 'M1' or pro-inflammatory, as noted in the manuscript. In contrast, M2 macrophages, or pro-resolution macrophages, are highly dependent on active mitochondrial respiration and oxidative phosphorylation (OXPHOS). Given that M1 macrophages favor glycolysis, they create an acidic environment due to elevated lactate levels and other acidifying metabolites. However, the study does not address this effect. The authors' hypothesis revolves around the acidic environment created by glycolytic tumors, yet they overlook the self-induced acidification of media when culturing M1 macrophages. This raises the question of how the authors explain the reduced circadian rhythms observed in pro-inflammatory macrophages in their study, while low pH and higher lactate levels enhance the amplitude of circadian rhythms. I would encourage the authors to incorporate the glycolytic activity of pro-inflammatory macrophages into their experimental setup. Otherwise the data look contradictory and misleading in some extent.
- The article examines the role of circadian rhythms in tumor-associated macrophages, yet it lacks sufficient compelling data to support this assertion. Two figures, Figure 7 and Figure 9, are presented in relation to cancer. In Figure 7, gene expression analysis of Arg1 (an M2 marker) and Crem (a potential circadian clock gene) is conducted in wild-type macrophages, BMAL1-knockout macrophages with dysregulated circadian rhythms, and using publicly available data on tumor-associated macrophages from a study referenced as 83. However, it is noted that this referenced study is actually a review article by Geeraerts et al. (2017) titled "Macrophage Metabolism as Therapeutic Target for Cancer, Atherosclerosis, and Obesity" published in Frontiers in Immunology. This raises concerns about the reliability of the results. Furthermore, comparing peritoneal macrophages from healthy mice with macrophages isolated from lung tumors is deemed inaccurate. It is suggested that lung macrophages from healthy mice and those from mice with lung tumors should be isolated separately for a more appropriate comparison. Consequently, Figure 7B is further questioned regarding how the authors could compare genes from the circadian rhythm pathway between these non-identical groups. As a result, the conclusion drawn from these data, suggesting that tumor-associated macrophages exhibit a gene expression pattern similar to BMAL1-KO macrophages, is deemed incorrect, affecting the interpretation of the data presented in Figure 8.
- If the authors aim to draw a clear conclusion regarding the circadian rhythms of tumor-associated macrophages (TAMs), they may need to analyze single-sorted macrophages from tumors and corresponding healthy tissues. Such data are publicly available (of course not in #83)
- Additionally, it is widely acknowledged that human and mouse macrophages exhibit distinct gene expression profiles, both in vitro and in vivo. While assuming that genes involved in circadian rhythms are conserved across species, the authors could consider extending their funding to include analyses of single-sorted macrophages from cancer patients, such as those with lung cancer or pancreatic ductal adenocarcinoma (PDAC). These experiments would provide relevant insights into TAM biology.
Minor comments:
- Figure 2C needs clarification. It's unclear why pro-inflammatory macrophages treated with lactic acid would have a shorter amplitude and period, while acidic pH would increase amplitude and period in M2 macrophages.
- The scale in Figure 2C should be equal for all conditions (e.g., -200).
- Absolute values of amplitude, damping, and period differ between Figure 1 and Figure 2A, B, C. The authors should explain these discrepancies.
- The authors should consider modulating the acidic environment of macrophages in settings more representative of cancer. For example, by adding conditioned media from tumor cells with pronounced glycolysis.
- Arg1 alone is not sufficient as an M2 polarization marker. The authors should include additional markers.
Significance
While the manuscript provides valuable insights and has obvious novelty, it requires a significant revision
-
-
us18.campaign-archive.com us18.campaign-archive.com
-
du partenariat avantage
Ça s'appelle les forfaits partenaires. On pourrait reformuler «désormais d'un partenariat avantageux» ou «désormais des forfaits partenaires à prix avantageux» ou quelque chose comme ça.
-
s
point
-
,
Virgule intempestive
-
Le
Il manque un connecteur logique dans la phrase: «Étant donné que le calendrier etc.»
-
en
je suggère «à l'extérieur»
-
VIDÉO | APPUYER LE CHANGEMEN
L'image contient un hyperlien pas rapport.
-
Guide d’aide à la décision pour les commerces, « Choisir des contenants réutilisables selon mon modèle d’affaires ».
Mettre l'hyperlien quelque part vers le guide, comme dans le titre par exemple.
-
ASSURANCES COLLECTIVES
L'image contient un hyperlien pas rapport.
-
plus commode et sécurisé
plus commode et sécurisé que quoi? l'ancienne version du programme? On pourrait enlever le «plus», si ça déforme pas trop ce que tu avais en tête.
-
-
learn.cantrill.io learn.cantrill.io
-
Welcome back, this is part two of this lesson where we continue immediately from the end of part one. In my case, it took about three minutes for the status check to change to "two out of two checks passed," indicating we're good to continue. AWS runs several checks on an EC2 instance as the final stage of the provisioning process, so ensure an instance has passed these checks before proceeding. You can see the instance has been provisioned into US-East-1C, with its own public IP version 4 address and public IP version 4 DNS name for internet access. Additional details such as the security group name, key name, and launch time are also available. Clicking on the instance reveals more detailed information in the bottom pane across various tabs like Details, Security, Networking, Storage, Status Checks, and Monitoring. To connect to the terminal of this EC2 instance, right-click the instance, select "connect," and choose one of the connection methods. EC2 Instance Connect allows access via a web browser. For this lesson, we focus on connecting using a local SSH client. Ensure you have the local SSH client and the A4L.PEM key file downloaded earlier. In your terminal, navigate to the folder containing the key file and adjust the file's permissions using the chmod 400 command. If on Windows, follow the detailed steps linked in the lesson to correct permissions. After setting permissions, use the provided SSH connection command to connect to the EC2 instance. This command uses the key pair to authenticate your connection. AWS stores the public part of the key pair on the EC2 instance, while you have the private part, allowing secure access. Throughout the course, we will use various methods to connect to EC2 instances, including local SSH clients, Instance Connect, and Session Manager. For Windows EC2 instances, we'll use Remote Desktop, which is beyond the scope of this lesson. To finish up, terminate the instance by selecting it, right-clicking, and choosing "terminate instance." Additionally, delete the security group created for this instance by navigating to the security groups, selecting it, and deleting it once the instance is terminated. Complete these steps and then proceed to the next lesson.
-
-
www.biorxiv.org www.biorxiv.org
-
eLife assessment
This study provides valuable insights into the complex genetics of dominant optic atrophy. Leveraging a fly model, the investigators provide solid evidence, albeit with small effect sizes, for a dominant negative mechanism of certain pathogenic variants that tend to cause more severe phenotypes, a long held hypothesis in the field. The work is of high interest to those in the optic atrophy and degeneration fields.
-
-
abqtypers.substack.com abqtypers.substack.com
-
Choosing the Right Typewriter by [[Joe Van Cleave]]
-
Remember that typewriter-typing (typewritering?) is different from keyboarding on a computer, even if the key layouts are similar between the two.
typewritering as a retcon neologism with respect to keyboarding
-
-
learn.cantrill.io learn.cantrill.io
-
Welcome to this demo lesson where you'll create your first EC2 instance as part of this course. This lesson falls under the AWS Free Tier, so assuming you're using a new account created for this course, there won't be any charges. Ensure you're logged into the general AWS account and have the Northern Virginia region (US-East-1) selected. Once there, navigate to the EC2 console by typing "EC2" in the search box, finding the EC2 service, and clicking to access the console. At the dashboard, the first step is to create an SSH key pair, essential for accessing the EC2 instance. If you don’t already have one, scroll down the left menu, click on Keypairs under Network and Security, and create a key pair. Remember, you'll only have one opportunity to download your part of the key pair, so keep it safe. Name it "A4L" (Animals for Life), choose the key pair type and private key file format based on your operating system (PEM for Mac OS/Linux or modern Windows, PPK for older Windows/using PuTTY), and save it to your default download location.
Next, return to the dashboard to begin creating your EC2 instance. Click on "Instances" to see all launched instances (you shouldn't have any yet), then click "Launch Instances" to go to the launch instance console. Name the instance "my first EC2 instance" and select the Amazon Machine Image (AMI) for the operating system—use Amazon Linux 2023 for this demo, as it’s free tier eligible. Leave all defaults and choose the instance type, ensuring it’s a free tier eligible type like t2.micro. Select the SSH key pair "A4L" you created earlier.
Configure network settings by selecting the default VPC and ensure the option to auto-assign a public IP is enabled for internet access. Create a new Security Group named "my_first_instance_sg" to allow SSH from anywhere, understanding you'll need the key pair for access. Configure storage, leaving the default 8GIB GP3 root volume, and expand advanced details if necessary for later use. Launch the EC2 instance and wait for the creation process, which may take a few moments. Refresh to see the instance status change from pending to running, and wait for the status check to complete. This concludes part one of the lesson. Take a break and join part two to continue from here.
-
-
johnlewismechanicalantiques.com johnlewismechanicalantiques.com
-
https://johnlewismechanicalantiques.com/cleaning-and-restoration/
John Lewis lays out his restoration process here
-
-
johnlewismechanicalantiques.com johnlewismechanicalantiques.com
-
https://johnlewismechanicalantiques.com/
John Lewis in Albuquerque, NM, a typewriter repair person since 1966.
-
-
www.biorxiv.org www.biorxiv.org
-
eLife assessment
This important study examines the extent to which distinct developmental pathways that result in alternative morphs correlate with transcriptome differences in a marine annelid, Streblospio benedicti. The strengths of the study include the experimental design and dense temporal sampling, which together provide convincing evidence that the two morphs can be clearly distinguished at the transcriptome level, despite relatively modest overall differences. The work will be of particular interest to students of the evolution of development.
-
Reviewer #1 (Public Review):
Summary:<br /> Overall, this study provides a meticulous comparison of developmental transcriptomes between two sub-species of the annelid Streblospio benedicti. Different lineages of S. benedicti maintain one of two genetically programmed alternative life histories, the ancestral planktotrophic or derived lecithotrophic forms of development. This contrast is also seen at the inter-species level in many marine invertebrate taxa, such as echinoderms and molluscs. The authors report relatively (surprisingly?) modest differences in transcriptomes overall, but also find some genes whose expression is essentially morph-specific (which they term "exclusive").
Strengths:<br /> The study is based on dense and appropriately replicated sampling of early development. The tight clustering of each stage/morph combination in PCA space suggests the specimens were accurately categorized. The similar overall trajectories of the two morphs was surprising to me for two stage: 1) the earliest stage (16-cell), at which we might expect maternal differences due to the several-fold difference in zygote size, and 2) the latest stage (1-week), where there appears to be the most obvious morphological difference. This is why we need to do experiments!
The examination of F1 hybrids was another major strength of the study. It also produced one of the most surprising results: though intermediate in phenotype, F1 embryos have the most distinct transcriptomes, and reveal a range of fixed, compensatory differences in the parental lines. Further, the F1 lack expression of nearly all transcripts identified as morph-specific in the pure parental lines. Since the F1 larvae present intermediate traits combining the features of both morphs, this implies that morph-specific transcripts are not actually necessary for morph-specific traits. This is interesting and somewhat counter to what one might naively expect.
Weaknesses:<br /> Overall I really enjoyed this paper, and in its revised form it addresses some concerns I had in the first version. I still see a few places where it can be tightened and made more insightful.
-
Reviewer #2 (Public Review):
The manuscript by Harry and Zakas determined the extent to which gene expression differences contribute to developmental divergence by using a model that has two distinct developmental morphs within a single species. Although the authors did collect a valuable dataset and trends in differential expression between the two morphs of S. benedicti were presented, we found limitations about the methods, system, and resources that the authors should address.
We have two major points:
(1) Background information about the biological system needs to be clarified in the introduction of this manuscript. The authors stated that F1 offspring can have intermediate larval traits compared to the parents (Line 81). However, the authors collected F1 offspring at the same time as the mother in the cross. If offspring have intermediate larval traits, their developmental timeline might be different than both parents and necessitate the collection of offspring at different times to obtain the same stages as the parents. Could the authors (1) explain why they collected offspring at the same time as parents given that other literature and Line 81 state these F1 offspring develop at intermediate rates, and (2) add the F1 offspring to Figure 1 to show morphological and timeline differences in development?
Additionally, the authors state (Lines 83-85) that they detail the full-time course of embryogenesis for both the parents and the F1 crosses. However, we do not see where the authors have reported the full-time course for embryogenesis of the F1 offspring. Providing this information would shape the remaining results of the manuscript.
(2) We have several concerns about the S. benedicti genome and steps regarding the read mapping for RNA-seq:
The S. benedicti genome used (Zakas et al. 2022) was generated using the PP morph. The largest scaffolds of this assembly correspond to linkage groups, showing the quality of this genome. The authors should point out in the Methods and/or Results sections that the quality of this genome means that PP-specific gene expression can be quantified well. However, the challenges and limitations of mapping LL-specific expression data to the PP genome should be discussed.
It is possible that the authors did not find exclusive gene expression in the LL morph because they require at least one gene to be turned on in one morph as part of the data-cleaning criteria. Because the authors are comparing all genes to the PP morph, they could be missing true exclusive genes responsible for the biological differences between the two morphs. Did they make the decision to only count genes expressed in one stage of the other morph because the gene models and mapping quality led to too much noise?
The authors state that the mapping rates between the two morphs are comparable (Supplementary Figure 1). However, there is a lot of variation in mapping the LL individuals (~20% to 43%) compared to the PP individuals. What is the level of differentiation within the two morphs in the species (pi and theta)? The statistical tests for this comparison should be added and the associated p-value should be reported. The statistical test used to compare mapping rates between the two morphs may be inappropriate. The authors used Salmon for their RNA alignment and differential expression analysis, but it is possible that a different method would be more appropriate. For example, Salmon has some limitations as compared to Kallisto as others have noted. The chosen statistical test should be explained, as well as how RNA-seq data are processed and interpreted.
What about the read mapping rate and details for the F1 LP and PL individuals? How did the offspring map to the P genome? These details should be included in Supplementary Figure 1. Could the authors also provide information about the number of genes expressed at each stage in the F1 LP and PL samples in S Figure 2? How many genes went into the PCA? Many of these details are necessary to evaluate the F1 RNA-seq analyses.
Generally, the authors need to report the statistics used in data processing more thoroughly. The authors need to report the statistics used to (1) process and evaluate the RNA-seq data and (2) determine the significance between the two morphs (Supplementary Figures 1 and 2).
-
Author response:
The following is the authors’ response to the original reviews.
Reviewer #1 (Public Review):
Summary:
Overall, this study provides a meticulous comparison of developmental transcriptomes between two sub-species of the annelid Streblospio benedicti. Different lineages of S. benedicti maintain one of two genetically programmed alternative life histories, the ancestral planktotrophic or derived lecithotrophic forms of development. This contrast is also seen at the inter-species level in many marine invertebrate taxa, such as echinoderms and molluscs. The authors report relatively (surprisingly?) modest differences in transcriptomes overall but also find some genes whose expression is essentially morph-specific (which they term "exclusive").
Strengths:
The study is based on a dense and appropriately replicated sampling of early development. The tight clustering of each stage/morph combination in PCA space suggests the specimens were accurately categorized. The similar overall trajectories of the two morphs were surprising to me for two stages: 1) the earliest stage (16-cell), at which we might expect maternal differences due to the several-fold difference in zygote size, and 2) the latest stage (1-week), where there appears to be the most obvious morphological difference. This is why we need to do experiments!
The examination of F1 hybrids was another major strength of the study. It also produced one of the most surprising results: though intermediate in phenotype, F1 embryos have the most distinct transcriptomes, and reveal a range of fixed, compensatory differences in the parental lines.
Weaknesses:
Overall I really enjoyed this paper, but I see a few places where it can be tightened and made more insightful. These relate to better defining the basis for "exclusive" expression (regulation or gene presence/absence?), providing more examples of how specific genes related to trophic mode behave, and placing the study in the context of similar work in other phyla.
As suggested, we changed the term “exclusive expression” to “morph-specific” expression throughout the paper to clarify which genes are only expressed in one morph. We also added references to similar work in other phyla such as recent work on lecithotrophic and planktotrophic development in species of Heliocidaris sea urchins in the 4th paragraph of the discussion. We added additional data about the F1 hybrids in “Gene expression of Genetic Crosses” section and the new Figure 8B. We find that gene expression in F1 offspring is divided between matching the maternal and paternal gene expression patterns, with slightly more genes matching paternal expression.
Reviewer #2 (Public Review):
The manuscript by Harry and Zakas determined the extent to which gene expression differences contribute to developmental divergence by using a model that has two distinct developmental morphs within a single species. Although the authors did collect a valuable dataset and trends in differential expression between the two morphs of S. benedicti were presented, we found limitations about the methods, system, and resources that the authors should address.
We have two major points:
(1) Background information about the biological system needs to be clarified in the introduction of this manuscript. The authors stated that F1 offspring can have intermediate larval traits compared to the parents (Line 81). However, the authors collected F1 offspring at the same time as the mother in the cross. If offspring have intermediate larval traits, their developmental timeline might be different than both parents and necessitate the collection of offspring at different times to obtain the same stages as the parents. Could the authors (1) explain why they collected offspring at the same time as parents given that other literature and Line 81 state these F1 offspring develop at intermediate rates, and (2) add the F1 offspring to Figure 1 to show morphological and timeline differences in development?
Additionally, the authors state (Lines 83-85) that they detail the full-time course of embryogenesis for both the parents and the F1 crosses. However, we do not see where the authors have reported the full-time course for embryogenesis of the F1 offspring. Providing this information would shape the remaining results of the manuscript.
(2) We have several concerns about the S. benedicti genome and steps regarding the read mapping for RNA-seq:
The S. benedicti genome used (Zakas et al. 2022) was generated using the PP morph. The largest scaffolds of this assembly correspond to linkage groups, showing the quality of this genome. The authors should point out in the Methods and/or Results sections that the quality of this genome means that PP-specific gene expression can be quantified well. However, the challenges and limitations of mapping LL-specific expression data to the PP genome should be discussed.
It is possible that the authors did not find exclusive gene expression in the LL morph because they require at least one gene to be turned on in one morph as part of the data-cleaning criteria. Because the authors are comparing all genes to the PP morph, they could be missing true exclusive genes responsible for the biological differences between the two morphs. Did they make the decision to only count genes expressed in one stage of the other morph because the gene models and mapping quality led to too much noise?
The authors state that the mapping rates between the two morphs are comparable (Supplementary Figure 1). However, there is a lot of variation in mapping the LL individuals (~20% to 43%) compared to the PP individuals. What is the level of differentiation within the two morphs in the species (pi and theta)? The statistical tests for this comparison should be added and the associated p-value should be reported. The statistical test used to compare mapping rates between the two morphs may be inappropriate. The authors used Salmon for their RNA alignment and differential expression analysis, but it is possible that a different method would be more appropriate. For example, Salmon has some limitations as compared to Kallisto as others have noted. The chosen statistical test should be explained, as well as how RNA-seq data are processed and interpreted.
What about the read mapping rate and details for the F1 LP and PL individuals? How did the offspring map to the P genome? These details should be included in Supplementary Figure 1. Could the authors also provide information about the number of genes expressed at each stage in the F1 LP and PL samples in S Figure 2? How many genes went into the PCA? Many of these details are necessary to evaluate the F1 RNA-seq analyses.
Generally, the authors need to report the statistics used in data processing more thoroughly. The authors need to report the statistics used to (1) process and evaluate the RNA-seq data and (2) determine the significance between the two morphs (Supplementary Figures 1 and 2).
(1) We clarified in the methods that F1 embryos are collected at the same stage (not absolute time) as the parental types. So the “16-cell” stage is comparable across planktotrophic, lecithotrophic and F1 offspring regardless of absolute time taken to reach that stage (which differs by ~3 hours- Figure 1).
Figure 2A details every time point collected for all crosses. As mentioned in the methods, we were unable to collect two timepoints for one set of crosses (LP) due to limited tissue. However, we still cover the full development time from “16 cell” through “swimming larvae” stages, which is the full larval development time.
(2) We appreciate the reviewer's concerns regarding the mapping to the reference genome. The S. benedicti genome is a largely complete and contiguous chromosome-length genome which we have now highlighted in the manuscript. However, the reference is only for the planktotrophic morph. So it is certainly possible that there could be mapping bias for lecithotrophic reads or F1 reads, as we point out in the discussion. While some bias is certainly possible, it is unlikely to be driving major differences in the results. We performed several tests to demonstrate this:
(1) We conducted two-sided T-tests of the mapping rates between all sample groups in our dataset (PP, LL, PL, LP) to determine if there were significant differences in mapping rates among the populations. No significant differences were found. The specific results of these statistical tests are included in the updated manuscript in supplementary figure 1 and are as follows:
Author response table 1.
(2) In response to the comment about sequence level divergence affecting mapping rate, we estimated pi (nucleotide diversity within a population) and dxy (genomic divergence between two populations) based on the sampled transcriptomic data of our Planktotrophic and Lecithotrophic populations. We used PIXY (Korunes, K.L. and Samuk, K., 2021) with its standard settings to estimate these values, with variant call files in bcf format produced with bcftools - one for all planktotrophic samples and one for all lecithotrophic samples in our dataset. We found that across regions of the transcriptome, the difference in pi between Planktotrophs and Lecithotrophs was between 0.11% and 4.2%. Genomic divergence across the transcriptome is also relatively minor: estimates of dxy ranged from 0.0049 to 0.0076. Given that these estimates show relatively modest differences in nucleotide diversity and overall sequence divergence, we maintain that it is unlikely that they significantly impact the results described in this study. From what we have seen in the literature, these values are not outside of other population studies that are mapping to a species reference derived from one population.
We added the mapping rates of all samples in the Supplement (SFig. 1) as requested. We added the number of genes expressed at each stage in the Supplement (SFig. 2) as requested. We have also provided further details and figures (Fig 8B) on read mapping rates and statistics used in data processing, including those for F1 RNA-seq data.
-
-
johnlewismechanicalantiques.com johnlewismechanicalantiques.com
-
https://johnlewismechanicalantiques.com/packing-instructions/
Solid advice for shipping typewriters here, which is frequently repeated. This advice is given by a specialist with expertise in typewriter repair and restoration.
-
-
www.researchsquare.com www.researchsquare.com
-
eLife assessment
This study presents valuable findings on how the endocannabinoid system is involved in endometriosis progression using CNR1 and CNR2 knockout (KO) mouse models. The evidence supporting the authors' claims is incomplete; including bulk RNA-seq, flow cytometry, and imaging mass cytometry would have strengthened the study. This work might be of interest to medical scientists working on endometriosis.
-
Reviewer #1 (Public Review):
Summary:
The endocannabinoid system (ECS) components are dysregulated within the lesion microenvironment and systemic circulation of endometriosis patients. Using endometriosis mouse models and genetic loss of function approaches, Lingegowda et al. report that canonical ECS receptors, CNR1 and CNR2, are required for disease initiation, progression, and T-cell dysfunction.
Strengths:
The approach uses genetic approaches to establish in vivo causal relationships between dysregulated ECS and endometriosis pathogenesis. The experimental design incorporates both bulk and single-cell RNAseq approaches, as well as imaging mass spectrometry to characterize the mouse lesions. The identification of immune-related and T-cell-specific changes in the lesion microenvironment of CNR1 and CNR2 knockout (KO) mice represents a significant advance
Weaknesses:
Although the mouse phenotypic analyses involves a detailed molecular characterization of the lesion microenvironment using genomic approaches, detailed measurements of lesion size/burden and histopathology would provide a better understanding of how CNR1 or CNR2 loss contributes to endometriosis initiation and progression. The cell or tissue-specific effects of the CNR1 and CNR2 are not incorporated into the experimental design of the studies. Although this aspect of the approach is recognized as a major limitation, global CNR1 and CNR2 KO may affect normal female reproductive tract function, ovarian steroid hormone levels, decidualization response, or lead to preexisting alterations in host or donor tissues, which could affect lesion establishment and development in the surgically induced, syngeneic mouse model of endometriosis.
-
Reviewer #2 (Public Review):
Summary:
The endocannabinoid system (ECS) regulates many critical functions, including reproductive function. Recent evidence indicates that dysregulated ECS contributes to endometriosis pathophysiology and microenvironment. Therefore, the authors further examined the dysregulated ECS and its mechanisms in endometriosis lesion establishment and progression using two different endometrial sources of mouse models of endometriosis with CNR1 and CNR2 knockout mice. The authors presented differential gene expressions and altered pathways, especially those related to the adaptive immune response in CNR1 and CNR2 ko lesions. Interstingly, the T-cell population was dramatically reduced in the peritoneal cavity lacking CNR2, and the loss of proliferative activity of CD4+ T helper cells. Imaging mass cytometry analysis provided spatial profiling of cell populations and potential relationships among immune cells and other cell types. This study provided fundamental knowledge of the endocannabinoid system in endometriosis pathophysiology.
Strengths:
Dysregulated ECS and its mechanisms in endometriosis pathogenesis were assessed using two different endometrial sources of mouse models of endometriosis with CNR1 and CNR2 knockout mice. Not only endometriotic lesions but also peritoneal exudate (and splenic) cells were analyzed to understand the specific local disease environment under the dysregulated ECS.
Providing the results of transcriptional profiles and pathways, immune cell profiles, and spatial profiles of cell populations support altered immune cell population and their disrupted functions in endometriosis pathogenesis via dysregulation of ECS.
L386: Role of CNR2 in T cells: Finding nearly absent CD3+ T cells in the peritoneal cavity of CNR2 ko mice is intriguing.
Interpretation of the results is well-described in discussion.
Weaknesses:
The study was terminated and characterized 7 days after EM induction surgery without the details for selecting the time point to perform the experiments.
The authors also mentioned that altered eutopic endometrium contributes to the establishment and progression of endometriosis. This reviewer agrees L324-325. If so, DEGs are likely identified between eutopic endometrium (with/without endometriosis lesion induction) and ectopic lesions. It would be nice to see the data (even though using publicly available data sets).
Figure 7 CDEF. Please add the results of the statistical analyses and analyzed sample numbers. L444-450 cannot be reviewed without them.
This reviewer agrees L498-500. In contrast, retrograded menstrual debris is not decidualized. The section could be modified to avoid misunderstanding.
The authors addressed all my concerns. I do not have any comments.
-
Author response:
The following is the authors’ response to the original reviews.
Public Reviews:
Reviewer #1 (Public Review):
Summary:
The endocannabinoid system (ECS) components are dysregulated within the lesion microenvironment and systemic circulation of endometriosis patients. Using endometriosis mouse models and genetic loss of function approaches, Lingegowda et al. report that canonical ECS receptors, CNR1 and CNR2, are required for disease initiation, progression, and T-cell dysfunction.
Strengths:
The approach uses genetic approaches to establish in vivo causal relationships between dysregulated ECS and endometriosis pathogenesis. The experimental design incorporates both bulk and single-cell RNAseq approaches, as well as imaging mass spectrometry to characterize the mouse lesions. The identification of immune-related and T-cell-specific changes in the lesion microenvironment of CNR1 and CNR2 knockout (KO) mice represents a significant advance
Weaknesses:
Although the mouse phenotypic analyses involve a detailed molecular characterization of the lesion microenvironment using genomic approaches, detailed measurements of lesion size/burden and histopathology would provide a better understanding of how CNR1 or CNR2 loss contributes to endometriosis initiation and progression. The cell or tissue-specific effects of the CNR1 and CNR2 are not incorporated into the experimental design of the studies. Although this aspect of the approach is recognized as a major limitation, global CNR1 and CNR2 KO may affect normal female reproductive tract function, ovarian steroid hormone levels, decidualization response, or lead to preexisting alterations in host or donor tissues, which could affect lesion establishment and development in the surgically induced, syngeneic mouse model of endometriosis.
We appreciate the reviewer's thoughtful and constructive feedback. We agree that the additional measurements of lesion size/burden and histopathology would provide valuable insights into the specific contributions of CNR1 and CNR2 to endometriosis progression. However, the focus of this study was on assessing the alterations in complex immune microenvironment due to the absence of CNR1 and CNR2, given their close relation in regulating immune cell populations. We will plan to incorporate these measurements in future studies to further strengthen the understanding of the disease pathogenesis. Regarding the potential effects of global knockout, the reviewer raises a valid concern. To address this, we will explore cell and/or tissue-specific knockout models in future experiments to better isolate the direct effects of CNR1 and CNR2 on the disease process, while minimizing potential confounding factors from systemic alterations.
Reviewer #2 (Public Review):
Summary:
The endocannabinoid system (ECS) regulates many critical functions, including reproductive function. Recent evidence indicates that dysregulated ECS contributes to endometriosis pathophysiology and the microenvironment. Therefore, the authors further examined the dysregulated ECS and its mechanisms in endometriosis lesion establishment and progression using two different endometrial sources of mouse models of endometriosis with CNR1 and CNR2 knockout mice. The authors presented differential gene expressions and altered pathways, especially those related to the adaptive immune response in CNR1 and CNR2 ko lesions. Interestingly, the T-cell population was dramatically reduced in the peritoneal cavity lacking CNR2, and the loss of proliferative activity of CD4+ T helper cells. Imaging mass cytometry analysis provided spatial profiling of cell populations and potential relationships among immune cells and other cell types. This study provided fundamental knowledge of the endocannabinoid system in endometriosis pathophysiology.
Strengths:
Dysregulated ECS and its mechanisms in endometriosis pathogenesis were assessed using two different endometrial sources of mouse models of endometriosis with CNR1 and CNR2 knockout mice. Not only endometriotic lesions, but also peritoneal exudate (and splenic) cells were analyzed to understand the specific local disease environment under the dysregulated ECS.
Providing the results of transcriptional profiles and pathways, immune cell profiles, and spatial profiles of cell populations support altered immune cell population and their disrupted functions in endometriosis pathogenesis via dysregulation of ECS.
In line 386: Role of CNR2 in T cells. The finding that nearly absent CD3+ T cells in the peritoneal cavity of CNR2 ko mice is intriguing.
The interpretation of the results is well-described in the Discussion.
Weaknesses:
The study was terminated and characterized 7 days after EM induction surgery without the details for selecting the time point to perform the experiments.
The authors also mentioned that altered eutopic endometrium contributes to the establishment and progression of endometriosis. This reviewer agrees with lines 324-325. If so, DEGs are likely identified between eutopic endometrium (with/without endometriosis lesion induction) and ectopic lesions. It would be nice to see the data (even though using publicly available data sets).
Figure 7 CDEF. The results of the statistical analyses and analyzed sample numbers should be added. Lines 444-450 cannot be reviewed without them.
This reviewer agrees with lines 498-500. In contrast, retrograded menstrual debris is not decidualized. The section could be modified to avoid misunderstanding.
We would like to thank the reviewer for insightful comments, suggestions and acknowledging the importance of the work presented in this manuscript.
Regarding 7-day time point, we have provided rationale in lines 479-481, but agree that it isn’t sufficient and hence we have provided additional details on the selection of the 7-day time point for the experiments in methods section (Mouse model of EM). We have also noted the suggestion on providing comparison of differentially expressed genes in the eutopic endometrium vs ectopic lesions. Since there are publications comparing the eutopic vs ectopic gene expression patterns (PMIDs: 33868805 and 18818281), including a study exploring the ECS genes in the endometrium throughout different menstrual cycles (PMID: 35672435), we believe additional analysis using the same dataset may not yield new information. However, we see the value in reviewer’s comment, and we will look at the gene expression patterns in the uterine vs endometriosis like lesions in our future studies with tissue or cell specific CNR1 and CNR2 knockout models to understand functional relevance of ECS in endometriosis initiation.
Since the IMC study was exploratory for proof of concept, we did not have enough biological replicates for meaningful statistical validation (n = 2-3). We have clarified this information in the methods, results, and figure legends for appropriately representing the limitations of the current setup.
Finally, we appreciate the feedback on the section discussing retrograded menstrual debris. Even though the menstrual debris may not be decidualized, some endometriotic lesions have the ability to decidualize based on their response to estrogen and progesterone in a cycling manner (PMID: 26450609), similar to the endometrium in the uterine cavity. We have clarified this in the revised MS.
Recommendations for the Authors:
Reviewer #1 (Recommendations For The Authors):
The mechanism of how alterations in ECS contribute to the observed cellular and molecular changes is unclear. Connecting CNR1 or CNR2 function to a specific cell type or cellular process would provide a more detailed understanding of how dysregulated ECS contributes to endometriosis pathogenesis.
We agree that integrating the functions of CNR1 or CNR2 to specific cell types or cellular processes would strengthen the mechanistic insights presented in our study. This would help elucidate specific pathways by which dysregulated ECS leads to the alterations in immune cell populations, gene expression profiles, and other key aspects of endometriosis development and progression. This is a rapidly evolving field and at this stage, we do not have published information to reflect on this aspect in the revised manuscript.
(1) As mentioned in the text, the ECS components being studied are widely expressed and may affect multiple aspects of endometriosis pathogenesis and symptomatology. However, the cell or tissue-specific effects of the CNR1 and CNR2 are not incorporated into the experimental design of the studies. Although these limitations are mentioned in the discussion, it is important to know if global CNR1 and CNR2 KO affect normal female reproductive tract function, ovarian steroid hormone levels, decidualization response, or if preexisting alterations in host or donor tissues affect lesion development in the surgically induced, syngeneic mouse model of endometriosis. This would also be the case in studies on immune system dysfunction or lesion microenvironment, as it is possible preexisting immune system dysfunction following CNR1 or CNR2 loss could alter the disease trajectory and lead to a misinterpretation of the findings. Some of these potential confounders could be addressed using crossover approaches in Figure 1A experimental design, but the donor tissues are reported to be matched to the recipients based on genotype.
The reviewer raised an excellent point that the widespread expression of the ECS components studied in our manuscript may affect multiple aspects of endometriosis pathogenesis and symptomatology. Indeed, the cell or tissue-specific effects of CNR1 and CNR2 knockout are not fully incorporated into our experimental design, which could lead to potential confounding factors that may affect the interpretation of some of our findings. However, as outlined in our previous comments, we will incorporate the tissue/cell specific knockout, as well the crossover approaches to elucidate if the loss of CNR1 and CNR2 function is lesion driven in future studies. We agree that it is important to understand the impact of global CNR1 and CNR2 knockout on normal female reproductive tract function, ovarian steroid hormone levels, decidualization response, and other potential preexisting alterations in the host or donor tissues that could influence lesion development in the syngeneic mouse model of endometriosis. As outlined in the MS (lines 59-62), there are studies highlighting pregnancy specific impact including implantation and impaired primary decidual zone formation. We did not find any baseline alterations in the systemic immune profiles between the CNR1 and CNR2 knockout mice and the WT mice without EM induction. However, the uterine environment has not been assessed to understand the baseline immune profile between the knockout mice and WT mice. We agree with the reviewer that, the possibility of preexisting immune system dysfunction following CNR1 or CNR2 loss could alter the disease trajectory related to immune system dysfunction or lesion microenvironment. We have highlighted this in the limitations section.
(2) The phenotypic characterization of the endometriosis mouse model with or without CNR1 or CNR2 KO is very limited. To better understand how the observed cellular and molecular alterations correlate with endometriosis pathogenesis and severity CNR1 and CNR2 K/O mice, a detailed characterization of lesion size differences and histopathology should be made. Importantly, the histopathological characterization of the lesions would complement the imaging mass spectrometry findings.
We agree that more detailed characterization of the endometriosis lesions in our CNR1 and CNR2 knockout mouse models are required. As evident for our several previous publications, we have focused on detailed histopathological characterization of endometriotic lesions in our syngeneic mouse model of endometriosis including a multiple time course study (Symons et al, 2020, FASEB). In the present investigation, we focused on cataloging spatial and transcriptomic changes as we do not currently have any information on the global influence of CNR1 and CNR2 knockout on endometriosis lesion microenvironment, since we prioritized this aspect, we were not able to provide detailed histological assessment of lesions. However, the IMC analysis provides a detailed, spatially resolved profile of the cellular composition and interactions within the endometriotic lesions, which we believe offers valuable insights into the mechanisms by which the dysregulated ECS may contribute to endometriosis pathogenesis. This quantitative, high-dimensional approach complements the transcriptional profiling and other analyses we have performed.
(3) Given the effect sizes and variance observed with the ECS ligand measurements, an N = 4-5 biological samples for mouse phenotypic studies seems too low.
The reviewer raises a valid point about low sample size. As elaborated earlier, this was a proof of principle study to capture biologically significant alterations within lesion and surrounding peritoneal microenvironment in the absence of CNR1, CNR2 receptors. This information is crucial for establishing the potential mechanisms by which the dysregulated ECS may contribute to the pathogenesis of endometriosis. Now that we have established the framework and baseline understanding of immune-inflammatory alterations, we will refine our future experimental approaches and include more samples if becomes necessary.
Reviewer #2 (Recommendations For The Authors):
It is hard to read the labeling of figures. Please increase the font size of each figure.
We have increased the font size of the labels where necessary to improve the readability.
Supplementary Data 1, Table 1 seems like Supplementary Table 1. Please use the same labeling of the Supplementary tables and figures to avoid confusion.
We have updated the labeling accordingly and ensured that all supplementary tables and figures are consistently labeled.
This reviewer suggests depositing RNA-seq and IMC data to NCBI etc. and listing the accession number in the MS.
Thank you for your recommendation to deposit the RNA-seq and imaging mass cytometry (IMC) data from our study in public repositories such as NCBI. We appreciate your suggestion, as data sharing is an important aspect of scientific transparency and reproducibility. Bulk mRNA sequencing data has been attached as a supplementary file and IMC data has been deposited on Mendeley Data (DOI: 10.17632/2ptns5yhzh.1).
Please clarify L363.
We have clarified this in the revised MS. The revised text now reads: “However, we did not find the same differences (T cell-related genes) in the UnD lesions of CNR2 k/o mice. Moreover, UnD lesions of CNR2 k/o mice showed significantly low number of DEGs (11 compared to 65 in the DD lesions from CNR2 k/o mice) suggesting a decidualization dependent response (Supplementary Data 3).”
Figure 7B: It is hard to see/understand the results in L438-440. It might be helpful if % is added to the figure.
We have added more tick marks to the y-axis of Figure 7B to make it easier for the reader to interpret the percentages of the different cell types.
Figure 7 legend: 2nd D should be G.
We have revised the legend accordingly.
Supplementary Figure 6: It seems immune cells are clustered in CN1, which is different from Figure 7. To easily understand Suppl Fig 6AB, please add some details in the legend.
We have revised the legend as suggested.
The revised legend now reads: “A, B Representative image of 8 distinct cell types from CN analysis of DD and UnD lesions from WT, CNR1 k/o, and CNR2 k/o mice, respectively. C Heatmap representation of CN analysis shows distinct clustering patterns observed in the UnD lesions among the different genotypes. The clustering reveals distinct spatial patterns of immune cell populations within the UnD lesions, which appear to differ from the observations in Figure 7G. This suggests potential spatial heterogeneity in the immune landscape of EM like lesions under conditions of decidualization.”
-
-
stylo.ecrituresnumeriques.ca stylo.ecrituresnumeriques.ca
-
www.biorxiv.org www.biorxiv.org
-
eLife assessment
This valuable study details an aspect of plant immunity where ATG6 was not previously known to have a role. The results suggest a direct relationship between ATG6 and NPR1, a well-studied salicylic acid receptor protein, which could be of interest to researchers studying the regulation of plant immunity. While the data presented are compelling, there are concerns about the interpretation of results, particularly regarding discrepancies in fluorescence and protein blot data. Addressing these issues would improve the overall impact of the work and consistency with prior studies.
-
Reviewer #1 (Public Review):
The authors showed that autophagy-related genes are involved in plant immunity by regulating the protein level of the salicylic acid receptor, NPR1.
The experiments are carefully designed and the data is convincing. The authors did a good job of understanding the relationship between ATG6 and NRP1.
The authors have addressed most of my previous concerns.
-
Reviewer #2 (Public Review):
The manuscript by Zhang et al. explores the effect of autophagy regulator ATG6 on NPR1-mediated immunity. The authors propose that ATG6 directly interacts with NPR1 in the nucleus to increase its stability and promote NPR1-dependent immune gene expression and pathogen resistance. This novel role of ATG6 is proposed to be independent of its role in autophagy in the cytoplasm. The authors demonstrate through biochemical analysis that ATG6 interacts with NPR1 in yeast and very weakly in vitro. They further demonstrate using overexpression transgenic plants that in the presence of ATG6-mcherry the stability of NPR1-GFP and its nuclear pool is increased.
Comments on revised version:
The authors demonstrate the correlation between overexertion of atg6 and higher stability and activity of npr1. They claim a novel activity of atg6 in the nucleus.<br /> Overall, the experimental scope of the study is solid, however, the over-interpretation of the results substantially reduces the significance and value of this study for the target plant immunity readership.
-
Author response:
The following is the authors’ response to the original reviews.
eLife assessment
The study reports on a previously unrecognized function of ATG6 in plant immunity. The work is valuable because it proposes a direct interaction between ATG6 and a well-studied salicylic acid receptor protein, NPR1, which may interest researchers investigating plant immunity regulation. While the data presented are compelling, more information regarding the specificity of ATG6's role would improve the overall impact of the study, especially with an eye towards consistency with prior work.
We also genuinely thank the editor and reviewers for the constructive and helpful suggestions and comments. These comments have greatly improved the quality and thoroughness of our manuscript. We have carefully studied these comments and have made the appropriate changes as far as possible. Additionally, some minor errors were also corrected during the revision process. New text is shown in blue in the revised manuscript. Our responses to the reviewer's comments are provided below each respective comment.
Public Reviews:
Reviewer #1 (Public Review):<br /> Summary:<br /> The authors showed that autophagy-related genes are involved in plant immunity by regulating the protein level of the salicylic acid receptor, NPR1.<br /> Strengths:<br /> The experiments are carefully designed and the data is convincing. The authors did a good job of understanding the relationship between ATG6 and NRP1.
Thank you very much for recognizing our research.
Weaknesses:<br /> - The authors can do a few additional experiments to test the role of ATG6 in plant immunity.<br /> I recommend the authors to test the interaction between ATGs and other NPR1 homologs (such as NPR2).
Thanks to your valuable feedback, it was discovered that the Arabidopsis NPRs family comprises six members: NPR1, NPR2, NPR3, NPR4, NPR5/PETIOLE 1 (BOP1), and NPR6/BOP2. NPR3/4 function in tandem as negative regulators to modulate SA signaling and plant immune responses (Ding et al., 2018). Similar to NPR1, NPR2 acts as a positive regulator of SA signaling (Castello et al., 2018). NPR5/BOP1 and NPR6/BOP2 primarily participate in the regulation of plant growth and development (McKim et al., 2008). This study specifically investigates the correlation between ATG6 and NPRs in plant resistance to pathogenic bacteria. Consequently, we experimentally confirmed the interaction between ATG6 and NPR1, NPR3, and NPR4 (Fig. 1 and Fig. S1 in the revised manuscript). It would be intriguing to further explore the interactions between ATG6 and other NPRs in the context of regulating plant growth and development in future research endeavors.
-The concentration of SA used in the experiment (0.5-1 mM) seems pretty high. Does a lower concentration of SA induce ATG6 accumulation in the nucleus?
Thank you for pointing this out. The NPR1 protein is known to be unstable and prone to degradation through the 26S proteasome pathway (Spoel et al., 2009; Saleh et al., 2015). Consequently, to investigate the function of NPR1, many scientists and research groups typically employ higher concentrations of SA (e.g., 0.5 mM, 1 mM, or even 5 mM) to elucidate its role (Spoel et al., 2009; Fu et al., 2012; Lee et al., 2015; Saleh et al., 2015; Skelly et al., 2019; Zavaliev et al., 2020; Chen et al., 2021a). In our study, we observed an interaction between ATG6 and NPR1. To enhance the detection of the NPR1 protein, we standardized the SA concentration (Arabidopsis was treated with 0.5 mM SA; Tobacco was treated with 1 mM SA) used in our experiments. Subsequently, we analyzed the nuclear accumulation ATG6 or NPR1 using a relatively high SA concentration (Arabidopsis was treated with 0.5 mM SA; Tobacco was treated with 1 mM SA), consistent with concentrations used in previous studies (Spoel et al., 2009; Lee et al., 2015; Saleh et al., 2015; Skelly et al., 2019; Zavaliev et al., 2020; Chen et al., 2021a).
-Does the silencing of ATG6 affect the cell death (or HR) triggered by AvrRPS4?
Thank you for pointing this out. In this study, we examined changes in Pst DC3000/avrRps4-induced cell death in Col, amiRNAATG6 # 1, amiRNAATG6 # 2, npr1, NPR1-GFP, ATG6-mCherry and ATG6-mCherry × NPR1-GFP plants. The results of Taipan blue staining showed that Pst DC3000/avrRps4-induced cell death in npr1, amiRNAATG6 # 1 and amiRNAATG6 # 2 was significantly higher compared to Col (Fig. S15 in the revised manuscript). Conversely, Pst DC3000/avrRps4-induced cell death in ATG6-mCherry, NPR1-GFP and ATG6-mCherry × NPR1-GFP was significantly lower compared to Col. Notably, Pst DC3000/avrRps4-induced cell death in ATG6-mCherry × NPR1-GFP was significantly lower compared ATG6-mCherry and NPR1-GFP (Fig. S15 in the revised manuscript). These results suggest that ATG6 and NPR1 cooperatively inhibit Pst DC3000/avrRps4-induced cell dead. The relevant description can be found in lines 394-404 of the revised manuscript.
-SA and NPR1 are also required for immunity and are activated by other NLRs (such as RPS2 and RPM1). Is ATG6 also involved in immunity activated by these NLRs?
Thank you for your valuable comments. The most notable event in the NLR-mediated ETI immune response is the induction of hypersensitive response-programmed cell death (HR-PCD) (Jones and Dangl, 2006; Yuan et al., 2021). SA plays a dual role in the ETI response. On one hand, the accumulation of SA during the R gene-mediated ETI defense response is directly linked to the onset of HR-PCD (Nawrath and Metraux, 1999). SA and NPR1 can enhance the ETI response by regulating the expression of downstream target genes (Falk et al., 1999; Feys et al., 2001; Ding et al., 2018; Liu et al., 2020). On the other hand, the activation of SA signaling can have a negative regulatory effect on HR-PCD during the ETI response. High levels of SA have been shown to significantly inhibit HR-PCD triggered by the avrRpt2 effector (Rate and Greenberg, 2001; Devadas and Raina, 2002; Jurkowski et al., 2004). Rate et al. discovered that the inhibition of HR-PCD by SA relies on NPR1 (Rate and Greenberg, 2001).
Arabidopsis AtATG6 or its homologs in other species (such as NbBECLIN1, TaATG6s, etc.) have been identified as positive regulators in plant immunity, playing a crucial role in inhibiting cell death and preventing invasion by pathogenic microorganisms (Liu et al., 2005; Patel and Dinesh-Kumar, 2008; Yue et al., 2015). Patel et al. demonstrated that, akin to autophagy-deficient mutants previously documented, AtATG6 antisense (AtATG6-AS) plants treated with Pst DC3000/avrRpm1 exhibited diffuse cell death, indicating the necessity of ATG6 in restricting cell death (Patel and Dinesh-Kumar, 2008). In tobacco, deficiencies in BECLIN 1 result in the onset of diffuse HR-PCD, underscoring the essential role of BECLIN 1 in limiting HR-PCD (Liu et al., 2005). Despite the genetic evidence supporting the critical function of ATG6 in plant immunity, the precise molecular mechanisms through which ATG6 impedes the invasion of pathogenic microorganisms remain elusive.
In our study, we uncovered that ATG6 interacts with NPR1 to hinder pathogen invasion and inhibit the initiation of cell death. In animals, members of the NLR family have been observed to interact with the autophagy-related protein LC3 to inhibit the survival of pathogen (Zhang et al., 2019). Similar mechanisms may exist in plants. However, it remains to be explored whether NLR directly induces the activation of ATG6 through interaction or the relationship between NPR1-ATG6 interactions and NLR-mediated plant immunity, necessitating further investigation.
Reviewer #2 (Public Review):
Summary:
The manuscript by Zhang et al. explores the effect of autophagy regulator ATG6 on NPR1-mediated immunity. The authors propose that ATG6 directly interacts with NPR1 in the nucleus to increase its stability and promote NPR1-dependent immune gene expression and pathogen resistance. This novel role of ATG6 is proposed to be independent of its role in autophagy in the cytoplasm. The authors demonstrate through biochemical analysis that ATG6 interacts with NPR1 in yeast and very weakly in vitro. They further demonstrate using overexpression transgenic plants that in the presence of ATG6-mcherry the stability of NPR1-GFP and its nuclear pool is increased.
However, the overall conclusions of the study are not well supported experimentally. The significance of the findings is low because of their mostly correlational nature, and lack of consistency with earlier reports on the same protein.
Thank you for your valuable and constructive suggestions. In this article, we unveil a novel relationship in which ATG6 positively regulates NPR1 in plant immunity (Fig. 8 in the revised manuscript). ATG6 interacts with NPR1 to synergistically enhance plant resistance by regulating NPR1 protein levels, stability, nuclear accumulation, and formation of SINCs-like condensates. This may be of interest to researchers studying the regulation of plant immunity. While there may be minor flaws in our current study, the significance of these findings cannot be overstated, as they have the potential to redirect scientific attention towards uncovering novel functions for autophagy genes.
Based on the integrity and quality of the data as well as the depth of analysis, it is not yet clear if ATG6 is a specific regulator of NPR1 or if it is affecting NPR1's stability indirectly, through inducing an elevation of SA levels in plants. As such, the current study demonstrates a correlation between overexpression of ATG6, SA accumulation, and NPR1 stability, however, whether and how these components work together is not yet demonstrated.
Thanks to your valuable feedback. Although as the reviewer said there may be some flaws in our data from the current results, scientific research is an ongoing process and I am confident that future studies will be even better. From the results given to us at the moment at least this study reports a previously undiscovered function of ATG6 in plant immunity. We propose a direct interaction between ATG6 and a well-studied salicylic acid receptor protein, NPR1. We unveil a novel relationship in which ATG6 positively regulates NPR1 in plant immunity (Fig. 8 in the revised manuscript). ATG6 interacts with NPR1 to synergistically enhance plant resistance by regulating NPR1 protein levels, stability, nuclear accumulation, and formation of SINCs-like condensates. This may be of interest to researchers studying the regulation of plant immunity.
Based on the provided biochemical data, it is not yet clear if the ATG6 functions specifically through NPR1 or through its paralogs NPR3 and NPR4, which are negative regulators of immunity. It is quite possible that interaction with NPR1 (or any NPR) is not the major regulatory step in the activity of ATG6 in plant immunity. The effect of ATG6 on NPR1 could well be indirect, through a change in the SA level and redox environment of the cell during the immune response. Both SA level and redox state of the cell were reported to induce accumulation of NPR1 in the nucleus and increase in stability.
Thanks to your valuable feedback. In this study, we validated the interaction between ATG6 and NPR1 through various approaches and identified the key regions mediating their interaction. Our findings indicate that ATG6 interacts with NPR1 to synergistically enhance plant resistance by regulating NPR1 protein levels, stability, nuclear accumulation, and the formation of SINC-like condensates. These results clearly demonstrate the involvement of ATG6 in the regulation of NPR1.Furthermore, we also found that ATG6 interacts with NPR3/4 (Fig. S1 in the revised manuscript). This is particularly relevant given that NPR3 and NPR4 have been shown to act as adaptors for the ubiquitin E3 ligase Cullin 3 (CUL3) to regulate the degradation of NPR1. Therefore, whether ATG6 regulates NPR1 through its interactions with NPR3/4 is an intriguing question worth exploring in future studies. We appreciate the reviewer's concerns and are committed to addressing them in our future research to further elucidate the complex regulatory mechanisms involving ATG6, NPR1, and other key players in plant immunity.
Another major issue is the poor quality of the subcellular analyses. In contradiction to previous studies, ATG6 in this study is not localized to autophagosome puncta, which suggests that the soluble localization pattern presented here does not reflect the true localization of ATG6. Even if the authors propose a novel, non-canonical nuclear localization for ATG6, they still should have detected the canonical autophagy-like localization of this protein.
Thanks to your valuable feedback. We conducted predictions at NLS Mapper (https://nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi) and identified two bipartite NLSs in ATG6, with the sequences "MRKEEIPDKSRTIPIDPNLPKWVCQNCHHS" and "DPNLPKWVCQNCHHS LTIVGVDSYAGKFFNDP". To further elucidate the nuclear localization of ATG6, we introduced Agrobacterium tumefaciens carrying ATG6-GFP into nls-mCherry tobacco leaves through transient transformation. Subsequently, we observed the localization of ATG6-GFP, along with the canonical autophagy-like patterns. Our findings revealed fluorescence signals of ATG6-GFP in both the cytoplasm and nuclei (Figure 2b). The nuclear-localized ATG6-GFP overlapping with the nuclear-localized marker, nls-mCherry (indicated by white arrows). Additionally, we observed punctate patterns indicative of canonical autophagy-like localization of ATG6-GFP fluorescence signals (indicated by red circles). Based on these results, we are more confident about the authenticity of ATG6's nuclear localization. The revised manuscript includes clearer images to support our observations.
Recommendations for the Authors:
Reviewer #2 (Recommendations For The Authors):
The duration and concentration of SA treatments are quite variable between experiments which makes comparisons difficult.
Thank you for pointing this out. The NPR1 protein is known to be unstable and prone to degradation through the 26S proteasome pathway (Spoel et al., 2009; Saleh et al., 2015). Consequently, to investigate the function of NPR1, many scientists and research groups typically employ higher concentrations of SA (e.g., 0.5 mM, 1 mM, or even 5 mM) to elucidate its role (Spoel et al., 2009; Fu et al., 2012; Lee et al., 2015; Saleh et al., 2015; Skelly et al., 2019; Zavaliev et al., 2020; Chen et al., 2021a). In our study, we observed an interaction between ATG6 and NPR1. To enhance the detection of the NPR1 protein, we standardized the SA concentration used in our experiments. In this study, for the treatment of Arabidopsis, we followed the protocols outlined in Saleh et al. and Spoel et al., utilizing 0.5 mM SA (Spoel et al., 2009; Saleh et al., 2015). For tobacco treatment, we adopted the methodology described in the study by Zavaliev et al., administering 1 mM SA (Zavaliev et al., 2020).
The methods section does not explain some of the essential experimental conditions and reagents used in the study.
Thank you for pointing this out. Due to word limitations we have placed the detailed experimental methods and reagents in Supplemental Data 1. In Supplemental Data 1, we provide a comprehensive overview of the experimental flow and conditions employed in our study.
Lines 62-63: the C-terminal domain of all NPRs has a name (already defined as SA-binding domain (SBD)). Also, it would be worth referring to the structure of NPR1 (Kumar et al 2022, Nat) as the source of information about its domains.
Thank you for pointing this out, we have changed this description in the revised manuscript (lines 62-63).
Lines 66-69: NPR1 doesn't form monomers. A recent study showed that the basic functional unit of NPR1 is a dimer (Kumar et al 2022, Nat).
Thank you for pointing this out. In the revised manuscript (line 67) " monomers " has been changed to “dimer”.
Lines 89-95 and elsewhere: the term "invasion" has a very specific meaning and it doesn't necessarily refer to disease. A pathogen can invade the plant but cause no disease (e.g. ETI). Most plant genetic immune mechanisms act after pathogen invasion, not before it. Those cited works reported the disease resistance, not the invasion resistance.
Thank you for pointing this out. We've changed the incorrect description in the revised manuscript (line 91).
Lines 113-119: the truncation at the aa328 includes half of the ANK domain (repeats 1 and 2), not just BTB. The C-terminal truncation variant contains the other half (repeats 3 and 4) of the ANK domain, not the entire ANK domain. It also contains the SBD, not just the NLS. So, this kind of analysis cannot determine the role of ANK domain in the interaction, nor it can conclusively determine if the interaction is through SBD. The interaction should be tested with the SBD domain only in order to make this conclusion.
Thank you for pointing this out, we have removed the inappropriate description and made the appropriate changes in the revised manuscript (lines 114 and 115).
In Figure S1, the equally strong interaction of atg6 is found for NPR3/NPR4. Does that mean that atg6 functions also through these other NPRs? What's the significance of these data compared to NPR1-ATG6 interaction? This is especially important, because both NPR3 and NPR4 are predominantly nuclear proteins, and they are unlikely to significantly overlap with autophagy components in the cytoplasm.
NPR1 and its paralogues NPR3/NPR4, which frequently interact with other proteins to regulate plant immune responses (Backer et al., 2019; Chen et al., 2019). To identify ATGs that interact with NPRs, we performed yeast two-hybrid (Y2H) screens using NPRs as bait. Interestingly, ATG6 interacted with NPR1, NPR3 and NPR4, respectively, and different concentrations of SA treatment did not significantly affect their interaction (Fig. S1a). NPR1 is an important positive regulator of the plant immune response (Chen et al., 2021b). In Arabidopsis and N. benthamian, ATG6 or its homologues was reported to act as a positive regulator to enhance plant disease resistance to P. syringae pv. tomato (Pst) DC3000 and Pst DC3000/avrRpm1 bacteria (Patel and Dinesh-Kumar, 2008), N. benthamiana mosaic virus (TMV) (Liu et al., 2005). Therefore, in this study we focused on investigating the biological significance of the interaction between ATG6 and NPR1. Whether the interaction between ATG6 and NPR3/4 also has an effect on plant immunity is a question that remains to be explored in future studies.
In Figure 1c and elsewhere: why not use the anti-mCherry antibody to detect atg6-mcherry? Are we seeing the correct protein band of atg6-mcherry? Also, it is not clear what antibodies they used throughout the study: the sources and specificities of antibodies are not provided.
Thank you for pointing this out. We initially synthesized the ATG6 antibody (anti-ATG6, 1:200, peptide, C-KEKKKIEEEERK, Abmart) in order to detect the endogenous ATG6 protein, and we also tested the specificity and potency of the ATG6 antibody (results are shown in Fig. S17). Additionally, in order to determine the location of the ATG6-mCherry bands, we also detected ATG6-mCherry in ATG6-mCherry Arabidopsis using the ATG6 antibody, and we also used Col as a control (results are shown in Fig. S4). These results show that our synthesized ATG6 antibody can effectively and clearly immunize to both ATG6 and ATG6-mCherry. Therefore, in this study, we used the ATG6 antibody to analyze both ATG6-mCherry and endogenous ATG6. Detailed antibody information is presented in Supplementary Data 1, table S4
In Figures 1d, 2a, and 2b, the subcellular localization pattern of atg6 contradicts what was published before (Fujiki et al 2007, Plant Phys; Liu et al 2018, FPlS; Xu et al 2017, Autophagy; Li et al 2018, Nat. Comm.). As an autophagy protein, atg6 was shown to localize to cytoplasmic puncta (autophagosomes), like atg8. No nuclear localization was found in those studies. The lack of puncta and the strong nuclear accumulation are signs that the localization of atg6 reported here has to be interpreted with caution. With the data provided, I am not convinced yet that we are looking at the correct ATG6 subcellular localization. Even if the authors propose a novel, non-canonical localization for atg6, they still should have detected the canonical autophagy-like localization of this protein.
Thanks to your valuable feedback. To further elucidate the nuclear localization of ATG6, we introduced Agrobacterium tumefaciens carrying ATG6-GFP into nls-mCherry tobacco leaves through transient transformation. Subsequently, we observed the localization of ATG6-GFP, along with the canonical autophagy-like patterns. Our findings revealed fluorescence signals of ATG6-GFP in both the cytoplasm and nuclei (Figure 2b). The nuclear-localized ATG6-GFP overlapping with the nuclear-localized marker, nls-mCherry (indicated by white arrows). Additionally, we observed punctate patterns indicative of canonical autophagy-like localization of ATG6-GFP fluorescence signals (indicated by red circles). Based on these results, we are more confident about the authenticity of ATG6's nuclear localization. The revised manuscript includes clearer images to support our observations.
It would make more sense to include the BiFC data (fig. S2) in the main figure, instead of the co-localization (fig. 1d) which cannot serve as evidence for interaction.
Thank you for the feedback. We accept your suggestion. In Fig.1, we have replaced the co-localization image with a BiFC (Bimolecular Fluorescence Complementation) image to better illustrate the interaction.
In Figure S2, the bifc signals have to be quantified to qualify as evidence for interaction. also, a subcellular marker has to be used (e.g. nuclear mcherry). From the current poor-quality images, one cannot determine where in the cell the presumed interaction takes place, nucleus or cytoplasm, or both. Also, no puncta are seen in these images.
Thank you for pointing this out. Despite the lack of clarity in the images we provided, our BiFC results unequivocally demonstrate the interaction between ATG6 and NPR1 in both the cytoplasm and nucleus. Notably, as the reviewer pointed out, punctate signals were not observed in our images. This lack of punctate signals is consistent with previous studies (Figure 2) that have also shown BiFC results between autophagy-associated proteins ATG8s and their interacting partners. For instance, Fig 1G (Marshall et al. 2019, Cell), Fig 2F (Marshall et al. 2019, Cell), Fig 4B (Macharia et al. 2019, BMC Plant Biology), and Fig 3 (Zhou et al. 2018, Autophagy) all did not exhibit punctate signals, aligning closely with our findings.
In Figure S3a, the nuclear localization is shown for stomata. It is known that stomata are especially strong expressors of the transgenes, and localization there could be an artefact of overaccumulation of the fusion protein. Also, why do they present the localization of atg6-gfp, if the analysis and the cross were made with atg6-mcherry?
Thank you for pointing this out. In our previous experiments, we observed the localization of ATG6 in the nucleus of Arabidopsis thaliana plants overexpressing ATG6-GFP (Fig. S3a). To clearly visualize the location of the nucleus, we used the cytosolic DAPI dye, which readily stained the nuclei of the stomatal guard cells. This allowed us to easily identify the nuclear regions for our observations. Additionally, in Fig. 2a and Fig.S3b, we detected the fluorescence signal of ATG6-mCherry within the nucleus, further confirming the nuclear localization of ATG6. Moreover, the nuclear and cytoplasmic fractions were separated. Under SA treatment, ATG6-mCherry and ATG6-GFP were detected in the cytoplasmic and nuclear fractions in N. benthamiana (Fig. 2c and d). Similarly, ATG6 was also detected in the nuclear fraction of UBQ10::ATG6-GFP and UBQ10::ATG6-mCherry overexpressing plants (Fig. 2e and f).
In Figure S3b, the images are low resolution and of poor quality. Why atg6-mcherry is expressed in a single cell if these are transgenic plants? The nuclear co-localization with npr1-gfp has to be shown more clearly with high res. images and also be quantified, because the expression of atg6-mcherry is not as uniform as npr1-gfp.
Thank you for pointing this out. Contrary to the reviewer's assertion, the ATG6-mCherry fluorescence signal depicted in Figure S3b was not exclusive to a single cell. In fact, this fluorescence was also evident in other cells, albeit with relatively weaker intensity. This disparity in fluorescence intensity may be attributed to the irregularities in leaf structure at the time of image capture using the microscope. To bolster our conclusion, we further examined the fluorescence signals in the cells of the root elongation zone in ATG6-mCherry x NPR1-GFP, as depicted in the figure below. Our observations revealed that the fluorescence signals of ATG6-mCherry exhibited uniform distribution, with detection in both the cytoplasm and nucleus. We have replaced the original unclear image with a high-quality image.
Lines 138-143: In fig. S3d, it would make more sense to show the WB on the hybrid npr1-gfp/atg6-mcherry plants with both anti-gfp and anti-mcherry antibodies to detect the free mcherry/gfp. Since the analysis of the level of free FP is done, then why didn't they test the free mcherry levels in Figure S4a? This would be more important than testing the free GFP in ATG6-GFP plants, because the imaging of atg6-mcherry was done in the hybrid plants (fig. S3b).
Thank you for pointing this out. We initially synthesized the ATG6 antibody (anti-ATG6, 1:200, peptide, C-KEKKKIEEEERK, Abmart) in order to detect the endogenous ATG6 protein, and we also tested the specificity and potency of the ATG6 antibody (results are shown in Fig. S17). Additionally, in order to determine the location of the ATG6-mCherry bands, we also detected ATG6-mCherry in ATG6-mCherry Arabidopsis using the ATG6 antibody, and we also used Col as a control (results are shown in Fig. S4). These results show that our synthesized ATG6 antibody can effectively and clearly immunize to both ATG6 and ATG6-mCherry. Therefore, in this study, we used the ATG6 antibody to analyze both ATG6-mCherry and endogenous ATG6. Detailed antibody information is presented in Supplementary Data 1, table S4. In the previous experiments, we procured the mCherry antibody (mCherry-Tag Monoclonal Antibody(6B3), BD-PM2113, China) to immunolabel ATG6-mCherry. However, we encountered challenges with the potency of this mCherry antibody, and considering our budget constraints, as well as the availability of our self-synthesized ATG6 antibody, we chose not to pursue the purchase of another antibody from a different company for the continuation of the Western Blot experiment.
In Figure 2c, there's no atg6-mcherry detected at time 0, in either cytoplasm or nucleus, yet the microscope images in panel a show strong accumulation in both compartments.
Thank you for pointing this out. Previous studies ATG6 can also be degraded via the 26s proteasome pathway (Qi et al., 2017). We speculate that this phenomenon might be attributed to the rapid turnover of ATG6 at time 0.
Lines 156-160: this statement is unsupported by the data. In fig. S5, the bands for native atg6 in the nuclear fraction are extremely weak, and they do not show the reverse pattern of change along the time points compared to the cytoplasmic fraction, which would indicate that the nuclear fraction is complementary to the cytoplasmic pool of the protein. The result more likely suggests that the majority of the ATG6 is in the cytoplasm, and that the weak bands detected in the nucleus are either background signal, or a contamination from the cytoplasmic pool. At this low protein level or poor immuno-detection the background signal is inevitable due to overexposure. Even though the actin marker is not detected in the nuclear fraction, it doesn't necessarily mean that there's no contamination from the cytoplasm in the nuclear fraction. The actin is just too abundant and can be detected at lower exposure.
Thank you for pointing this out. In Fig. S5, we detected the subcellular localization of endogenous ATG6, although the image quality was somewhat low. Nevertheless, the cytosolic and nuclear localization of ATG6 could be clearly observed. In addition to this, we also verified the cytosolic and nuclear localization of ATG6 in Arabidopsis using confocal fluorescence microscopy and nucleoplasmic separation experiments. Actin and H3 were used as cytoplasmic and nucleus internal reference, respectively. (Fig. 2e and f). Furthermore, we observed the cytosolic and nuclear localization of ATG6 when we expressed ATG6-GFP or ATG6-mCherry in tobacco leaves through cis-transfection experiments (Fig. 2a-d). These results are consistent with the prediction of the subcellular location of ATG6 in the Arabidopsis subcellular database (https://suba.live/) (Fig. S3c). The reviewer's feedback has been valuable in helping us present these findings more clearly. We acknowledge the limitations in the image quality for the endogenous ATG6 localization, but we believe the combination of multiple experimental approaches, including the use of fluorescent protein fusions, provides robust evidence for the cytosolic localization of ATG6 in plant cells. Moving forward, we will continue to investigate the significance of ATG6's subcellular distribution and its potential dual roles in both the nucleus and the cytosol, particularly in the context of its interaction with the key immune regulator NPR1. We appreciate the reviewer's constructive comments, as they will help us strengthen the presentation and interpretation of our findings.
In Figure 3a the images are of too low resolution to see the co-localization. The focal planes of the top and bottom panels are quite different: the top is focused on stomata, the bottom - on pavement cells. So, the number of the NPR1-GFP nuclei between these two focal planes is dramatically different. Also, it looks like the atg6-mcherry in these plants are predominantly in the cytoplasm, not the nucleus as the authors claim. A higher resolution and higher quality of images are required to determine this.
Thank you for pointing this out. To ensure the clarity and accuracy of our confocal images, we have supplied a clearer image as supplementary evidence. The Bright images distinctly show that both sets of images are in the same plane of focus. Furthermore, in the figure (third one in the fourth column), the nucleus localization of ATG6-mCherry is clearly visible, and that ATG6-mCherry is co-localized with NPR1-GFP in the nucleus, as indicated by the white arrow.
In Figure 3b, it is not indicated what exactly was measured and in what condition, mock or SA. If these are numbers of nuclei, then it should be indicated what size of the area was sampled, not just "section", and both mock and SA should be included in the measurements. Also, how many independent images have been sampled? what does the error bar represent? What does "normal" mean? Shouldn't this be a mock treatment?
Thank you for pointing out this. The term "Normal" in this context refers to mock treatment, and we have revised the description for clarity. In Figure 3b, the graph illustrates the count of nuclear localizations of NPR1-GFP in ATG6-mCherry × NPR1-GFP and NPR1-GFP Arabidopsis plants following SA treatment. Statistical data were obtained from three independent experiments, each comprising five individual images, resulting in a total of 15 images analyzed for this comparison. Detailed descriptions were also added to the revised manuscript (Lines 568-570, 800-804).
Lines 167-168: the proposed increase of NPR1-GFP in the nucleus could be simply due to a higher accumulation of SA in the hybrid plants, not because of the direct interaction of atg6.
Thank you for pointing out this. Our results confirmed that ATG6 overexpression significantly increased nuclear accumulation of NPR1 (Fig. 3). Notably, the ratio (nucleus NPR1/total NPR1) in ATG6-mCherry × NPR1-GFP was not significantly different from that in NPR1-GFP, and there is a similar phenomenon in N. benthamiana (Fig. 3c-f). These results suggested that the increased nuclear accumulation of NPR1 by ATG6 might result from higher levels and more stable NPR1, rather than the enhanced nuclear translocation of NPR1 facilitated by ATG6. Furthermore, we found that under SA treatment, the protein levels of NPR1 were significantly higher in the ATG6-mCherry × NPR1-GFP line compared to the NPR1-GFP line (Fig. 5a). Notably, even in the absence of differences in SA levels between the two lines, we observed that ATG6 could delay the degradation of NPR1 under normal conditions (Fig. 6). These findings suggest that ATG6 employs both SA-dependent and SA-independent mechanisms to maintain the stability of the key immune regulator NPR1. In summary, we therefore suggest that the increased nuclear accumulation in NPR1 cells is a dual effect of SA and ATG6.
Lines 202-204: "Increased nuclear accumulation" implies increased translocation. However, they found that the ratio of NPR1-GFP does not change (Figure 3), so the reason for higher nuclear accumulation is not translocation, but abundance.
Thank you for pointing out this. Our results confirmed that ATG6 overexpression significantly increased nuclear accumulation of NPR1 (Fig. 3). ATG6 also increases NPR1 protein levels and improves NPR1 stability (Fig. 5 and 6). Therefore, we consider that the increased nuclear accumulation of NPR1 in ATG6-mCherry x NPR1-GFP plants might result from higher levels and more stable NPR1 rather than the enhanced nuclear translocation of NPR1 facilitated by ATG6. To verify this possibility, we determined the ratio of NPR1-GFP in the nuclear localization versus total NPR1-GFP. Notably, the ratio (nucleus NPR1/total NPR1) in ATG6-mCherry × NPR1-GFP was not significantly different from that in NPR1-GFP, and there is a similar phenomenon in N. benthamiana (Fig. 3c-f). These results suggested that the increased nuclear accumulation of NPR1 by ATG6 might result from higher levels and more stable NPR1, rather than the enhanced nuclear translocation of NPR1 facilitated by ATG6. Further we analyzed whether ATG6 affects NPR1 protein levels and protein stability. Our results show that ATG6 increases NPR1 protein levels under SA treatment and ATG6 maintains the protein stability of NPR1 (Fig. 5 and 6). These results suggested that the increased nuclear accumulation of NPR1 by ATG6 result from higher levels and more stable NPR1. The corresponding description is shown in revised manuscript (lines 338~352).
Lines 204-205: the co-localization in Figure 1d cannot be interpreted as interaction.
Thank you for the feedback. We have replaced the co-localization image with a BiFC (Bimolecular Fluorescence Complementation) image to better illustrate the interaction in Fig 1d.
What age of plants were used for the analysis in Figures 4 and S7? The age of the plant might significantly affect the free SA levels under control conditions.
Thank you for the feedback. In Figures 4 and S7, 3-week-old plants were used to determine salicylic acid (SA) levels and the expression of target genes. Figures 4 and S7 figure notes provide detailed descriptions (lines 818-819).
In Figure 5a they treat with SA, but the analysis in Figure S10 is done with the pathogen, so how can these data be correlated?
Thank you for pointing out this. Previous studies have demonstrated that pathogen infestation rapidly increases the salicylic acid (SA) content in plants, and the elevated SA then activates plant immune responses. Therefore, both pathogen treatment and direct SA treatment can activate SA-dependent plant immune responses. The NPR1 protein is known for its instability. In Figure 5a, we utilized a 0.5 mM SA treatment to assess the changes in NPR1 protein levels, as the impact of SA treatment is more immediate and pronounced.
Lines 241-242: In Figure 5b, it is not clear why there's no detection of NPR1-GFP and atg6-mcherry at time 0?? The levels of proteins in the transient assay are sufficiently high for detection by WB.
Thank you for pointing this out. The NPR1 protein is known to be unstable and prone to degradation through the 26S proteasome pathway (Spoel et al., 2009; Saleh et al., 2015). In addition, previous studies ATG6 can also be degraded via the 26s proteasome pathway (Qi et al., 2017). We speculate that this phenomenon might be attributed to the rapid turnover of NPR1 and ATG6 at time 0.
In Figures 5c-d, the quality of these images is very poor, and they do not clearly show the signs. What structure was exactly measured in these images? There are so many fluorescent bodies there, that it is not clear what are we looking at. Also, it is not clear why they did not show the mcherry channel? It would be important to see if the bodies in SA-treated plants show co-localization with atg6-mcherry autophagosomes (if these exist at all).
Thank you for pointing this out. Interestingly, similar to previous reports (Zavaliev et al., 2020), SA promoted the translocation of NPR1 into the nucleus, but still a significant amount of NPR1 was present in the cytoplasm (Fig. 3c and e). Previous studies have shown that SA increased NPR1 protein levels and facilitated the formation of SINCs in the cytoplasm, which are known to promote cell survival (Zavaliev et al., 2020). We therefore observed the fluorescence signal of SINCs-like condensates in the cytoplasm of tobacco leaves. After 1mM SA treatment, more SINCs-like condensates fluorescence were observed in N. benthamiana co-transformed with ATG6-mCherry + NPR1-GFP compared to mCherry + NPR1-GFP (Fig. 5c-d and Supplemental movie 1-2). We have a clearer demonstration in the supplemental video movie 1-2. Additionally, we observed that SINCs-like condensates signaling partial co-localized with certain ATG6-mCherry autophagosomes fluorescence signals.
Lines 245-247: so, is it atg6 or SA that increases the NPR1 levels? If this is due to SA, then the whole study doesn't have novelty, because we already know from previous works that SA increases the stability of npr1.
Thank you for pointing this out. Indeed, previous studies have shown that salicylic acid (SA) increases NPR1 levels and protein stability (Spoel et al., 2009; Saleh et al., 2015). In our experiments, we found that under SA treatment, the protein levels of NPR1 were significantly higher in the ATG6-mCherry × NPR1-GFP line compared to the NPR1-GFP line (Fig. 5a). Additionally, free SA levels were also significantly elevated in the ATG6-mCherry × NPR1-GFP line under pathogen challenge (Pst DC3000/avrRps4), but not under normal conditions (Fig. 4a). Furthermore, even in the absence of differences in SA levels between the two lines, we observed that ATG6 could delay the degradation of NPR1 under normal conditions (Fig. 6). These findings represent one of our new discoveries. These findings suggest that ATG6 employs both SA-dependent and SA-independent mechanisms to maintain the stability of the key immune regulator NPR1.
Lines 313-316: npr1 and atg6 can function independently from each other, so the term "jointly" is misleading. Based on the overall data provided in this manuscript it cannot be concluded that the two proteins work in one complex to control plant immunity.
Thank you for pointing this out. In the revised manuscript "jointly" has been changed to “cooperatively”.
Lines 369-374: this speculation is beyond the main hypothesis claiming that atg6 functions through npr1. If atg6 can activate the transcription alone, then what is the significance of its activation of npr1? How can one distinguish between the two?
Thank you for pointing this out. Transcription activation by transcription factors typically requires at least two conserved structural domains: a transcription activation domain and a DNA-binding domain. However, ATG6 does not possess these two typical conserved structural domains found in canonical transcription factors. Given this structural context, it is unlikely that ATG6 would be able to directly activate transcription on its own. The lack of the canonical transcription factor domains in ATG6 suggests that it may not be able to function as a direct transcriptional activator. Previous studies have shown that acidic activation domains (AADs) in transcriptional activators (such as Gal4, Gcn4 and VP16) play important roles in activating downstream target genes. Acidic amino acids and hydrophobic residues are the key structural elements of AAD (Pennica et al., 1984; Cress and Triezenberg, 1991; Van Hoy et al., 1993). Chen et al. found that EDS1 contains two ADD domains and confirmed that EDS1 is a transcriptional activator with AAD (Chen et al., 2021a). Here, we also have similar results that ATG6 overexpression significantly enhanced the expression of PR1 and PR5 (Fig. 4b-c and S9), and that the ADD domain containing acidic and hydrophobic amino acids is also found in ATG6 (148-295 AA) (Fig. S14). We speculate that ATG6 might act as a transcriptional coactivator to activate PRs expression synergistically with NPR1.
Lines 389-400: the cell death due to AvrRPS4 in Col-0 ecotype is extremely weak as there's no complete receptor complex for this effector. So, one has to use a very high dose to induce cell death in Col-0, certainly higher than the one used for bacterial growth. The authors used the same dose in both assays, so it is likely that what we see as "cell death" is not an effector-triggered response, but rather symptom-associated for the virulent pathogen.
Thank you for pointing this out. Indeed, as the reviewer pointed out, most cell death assays use higher concentrations of Pst DC3000/avrRps4 or Pst DC3000/avrRpt2, but they typically treat Arabidopsis for a relatively short period, usually less than 1 day(Hofius et al., 2009; Zavaliev et al., 2020). In this study, although we used relatively low Pst DC3000/avrRps4 (0.001) injections, we detected cell death under a relatively long period of Pst DC3000/avrRps4 infestation (3 days). Pst DC3000/avrRps4-infested plants multiply significantly in host cells, and therefore we assumed that the propagated pathogens after 3 days of incubation would be sufficient to induce intense cell death. Consequently, we chose this concentration of Pst DC3000/avrRps4 for the experiment.
Lines 407-416: why do you expect "delay of degradation" with autophagy inhibitor? Shouldn't it be the opposite? In Figure S14, if we compare the bands between 120min and 120min+ConA+WM, the effect of autophagy inhibitors is actually quite strong (0.47 vs 0.22), with about 50% more degradation of NPR1 in their presence. So, the conclusion that the degradation of NPR1 is autophagy-independent is wrong according to this result.
Thank you for pointing this out. We have revised the inaccurate description, as outlined in the revised manuscript (lines 413-425).
References
Backer R, Naidoo S, van den Berg N. 2019. The NONEXPRESSOR OF PATHOGENESIS-RELATED GENES 1 (NPR1) and Related Family: Mechanistic Insights in Plant Disease Resistance. Front Plant Sci 10, 102.
Castello MJ, Medina-Puche L, Lamilla J, et al. 2018. NPR1 paralogs of Arabidopsis and their role in salicylic acid perception. PLoS One 13, e0209835.
Chen H, Li M, Qi G, et al. 2021a. Two interacting transcriptional coactivators cooperatively control plant immune responses. Sci Adv 7, eabl7173.
Chen J, Mohan R, Zhang Y, et al. 2019. NPR1 Promotes Its Own and Target Gene Expression in Plant Defense by Recruiting CDK8. Plant Physiol 181, 289-304.
Chen J, Zhang J, Kong M, et al. 2021b. More stories to tell: NONEXPRESSOR OF PATHOGENESIS-RELATED GENES1, a salicylic acid receptor. Plant Cell Environ.
Cress WD, Triezenberg SJ. 1991. Critical structural elements of the VP16 transcriptional activation domain. Science 251, 87-90.
Devadas SK, Raina R. 2002. Preexisting systemic acquired resistance suppresses hypersensitive response-associated cell death in Arabidopsis hrl1 mutant. Plant Physiol 128, 1234-1244.
Ding Y, Sun T, Ao K, et al. 2018. Opposite Roles of Salicylic Acid Receptors NPR1 and NPR3/NPR4 in Transcriptional Regulation of Plant Immunity. Cell 173, 1454-1467 e1415.
Falk A, Feys BJ, Frost LN, et al. 1999. EDS1, an essential component of R gene-mediated disease resistance in Arabidopsis has homology to eukaryotic lipases. Proc Natl Acad Sci U S A 96, 3292-3297.
Feys BJ, Moisan LJ, Newman MA, et al. 2001. Direct interaction between the Arabidopsis disease resistance signaling proteins, EDS1 and PAD4. EMBO J 20, 5400-5411.
Fu ZQ, Yan S, Saleh A, et al. 2012. NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants. Nature 486, 228-232.
Hofius D, Schultz-Larsen T, Joensen J, et al. 2009. Autophagic components contribute to hypersensitive cell death in Arabidopsis. Cell 137, 773-783.
Jones JD, Dangl JL. 2006. The plant immune system. Nature 444, 323-329.
Jurkowski GI, Smith RK, Jr., Yu IC, et al. 2004. Arabidopsis DND2, a second cyclic nucleotide-gated ion channel gene for which mutation causes the "defense, no death" phenotype. Mol Plant Microbe Interact 17, 511-520.
Lee HJ, Park YJ, Seo PJ, et al. 2015. Systemic Immunity Requires SnRK2.8-Mediated Nuclear Import of NPR1 in Arabidopsis. Plant Cell 27, 3425-3438.
Liu Y, Schiff M, Czymmek K, et al. 2005. Autophagy regulates programmed cell death during the plant innate immune response. Cell 121, 567-577.
Liu Y, Sun T, Sun Y, et al. 2020. Diverse Roles of the Salicylic Acid Receptors NPR1 and NPR3/NPR4 in Plant Immunity. Plant Cell 32, 4002-4016.
McKim SM, Stenvik GE, Butenko MA, et al. 2008. The BLADE-ON-PETIOLE genes are essential for abscission zone formation in Arabidopsis. Development 135, 1537-1546.
Nawrath C, Metraux JP. 1999. Salicylic acid induction-deficient mutants of Arabidopsis express PR-2 and PR-5 and accumulate high levels of camalexin after pathogen inoculation. Plant Cell 11, 1393-1404.
Patel S, Dinesh-Kumar SP. 2008. Arabidopsis ATG6 is required to limit the pathogen-associated cell death response. Autophagy 4, 20-27.
Pennica D, Goeddel DV, Hayflick JS, et al. 1984. The amino acid sequence of murine p53 determined from a c-DNA clone. Virology 134, 477-482.
Qi H, Xia FN, Xie LJ, et al. 2017. TRAF Family Proteins Regulate Autophagy Dynamics by Modulating AUTOPHAGY PROTEIN6 Stability in Arabidopsis. Plant Cell 29, 890-911.
Rate DN, Greenberg JT. 2001. The Arabidopsis aberrant growth and death2 mutant shows resistance to Pseudomonas syringae and reveals a role for NPR1 in suppressing hypersensitive cell death. Plant J 27, 203-211.
Saleh A, Withers J, Mohan R, et al. 2015. Posttranslational Modifications of the Master Transcriptional Regulator NPR1 Enable Dynamic but Tight Control of Plant Immune Responses. Cell Host Microbe 18, 169-182.
Skelly MJ, Furniss JJ, Grey H, et al. 2019. Dynamic ubiquitination determines transcriptional activity of the plant immune coactivator NPR1. Elife 8.
Spoel SH, Mou Z, Tada Y, et al. 2009. Proteasome-mediated turnover of the transcription coactivator NPR1 plays dual roles in regulating plant immunity. Cell 137, 860-872.
Van Hoy M, Leuther KK, Kodadek T, et al. 1993. The acidic activation domains of the GCN4 and GAL4 proteins are not alpha helical but form beta sheets. Cell 72, 587-594.
Yuan M, Ngou BPM, Ding P, et al. 2021. PTI-ETI crosstalk: an integrative view of plant immunity. Curr Opin Plant Biol 62, 102030.
Yue J, Sun H, Zhang W, et al. 2015. Wheat homologs of yeast ATG6 function in autophagy and are implicated in powdery mildew immunity. BMC Plant Biol 15, 95.
Zavaliev R, Mohan R, Chen T, et al. 2020. Formation of NPR1 Condensates Promotes Cell Survival during the Plant Immune Response. Cell 182, 1093-1108 e1018.
-