10,000 Matching Annotations
  1. Mar 2026
    1. Pero vuelvo al principio de mi decisión que se fundamentaba en que podía conectarlo con zotero. Obsidian es modular, eso quiere decir que puede integrar modulos de funcionalidad que los usuarios desarrollan, gracias a que la totalidad del código del software es es libre y de código abierto. Entonces existen modulos, llamados en obsidian complementos, que pueden agregar funciones al programa. Existen un complemento que toma el formato de citación o las anotaciones, subrayados, comentarios, e incluso los dibujos que realizamos en Zotero, y los integra como una nota, también hay un complemento similar para Kindle, que también usaba

      Hace unas semanas descargué Obsidian en mi computador y con tutoriales de youtube, intenté aprender a usarlo, pero me causó mucha frustración. No sé si es por mi sistema operativo, pero había una casilla que salía en mi pantalla, pero en ninguna de todos los videotuoriales que revisé, así que no puede crear ni la cuenta. Y bueno, tuve la sensación de que si así era el login el manejo sería más tedioso. Mi única habilidad es con Zotero y Mendeley para usarlo como gestores bibliográficos, gracias a una capacitación en la biblioteca de la universidad.

    2. Habían muchas. Entre las que encontre había una que prometía articularse con Zotero y era obsidian. Entre las características que me entusiasmaron de este software se destaca el uso de MarkDown un formato de texto plano que garantizaría que mis notas no dependieran de ningún software, por otro lado es multiplataforma, que para este caso implica que puede funcionar en linux, windows, ios, y android, lo que quiere decir, que puedo anotar en el celular, en mi tableta, en mi PC de escritorio, o en mi portatil, incluso, si llegara a pasar algo extraordinario que me obligara a usar algún dispositivo de la malevola empresa de la manzana, ahí también funcionaría.

      Esta información es vital para mí, para mí mi gestor bibliográfico es Zotero, y más por un asunto de desconocimiento. Sería muy beneficioso que pudieras realizar una clase magistral sobre estas estrategias que pudiera ser multimodal, es decir; usar en el pc, la tablet y poder tener acceso a la información en cualquier lugar.

    1. Cuando necesitaba algo, no lo encontraba o me demoraba mucho encontrandolo, y mientras más anotaba, más agendas y más difícil encontrar lo que necesitaba.

      Creo que este es un proceso por el que pasamos todos. Sí bien siempre pensamos que nuestro método de toma de notas es útil. Cuando debemos buscarlas como lo mencionas, es muy complicado y tedioso, trtar de encontrar exactamente la información que necesitas.

    1. o proclaim a viable alternative to the market economy in theirpolitical manifestos

      This was seen in the CDU's socail market economy plan thats in ghdi SLAYY

    Annotators

    1. Reviewer #2 (Public review):

      Summary

      The authors introduce DNA O-MAP, a method that combines oligo-based in situ hybridization with peroxidase-mediated proximity biotinylation to profile proteins and DNA-DNA interactions linked to targeted genomic regions. In the revised manuscript, they expand the method beyond repetitive elements by profiling non-repetitive gene clusters (HOXA and HOXB), studying inhibitor-induced chromatin remodeling, and differentiating homolog-specific proteomes on both the active and inactive X chromosome. These additions considerably broaden the scope of the work and indicate that DNA O-MAP is currently most effective for analyzing gene-cluster size or domain-level chromatin environments, rather than focusing on individual promoters or cis-regulatory elements.

      Strengths

      The study demonstrates that DNA O-MAP can be applied to both repetitive domains and non-repetitive genomic regions, including gene clusters spanning 80 kilobases and larger single-copy chromosomal intervals, rather than isolated cis-regulatory elements.

      Orthogonal validation using ENCODE ChIP-seq data supports several differentially enriched proteins observed between the HOXA and HOXB gene clusters proteomes.

      The ability to detect quantitative changes in local protein environments after chemical perturbation demonstrates the method's sensitivity at the level of extended genomic domains.

      Homolog-resolved analysis of the active and inactive X chromosome provides an additional demonstration of biological specificity and technical flexibility at the megabase scale.

      The revised manuscript appropriately frames DNA O-MAP as a method for interrogating local domain-level genomic environments, rather than exhaustively defining the protein composition of individual regulatory elements.

      Weaknesses

      As with all proximity labeling approaches, the effective resolution of DNA O-MAP is constrained by the spatial distance of peroxidase-mediated labeling rather than by genomic distance. Consequently, for gene-cluster-scale targets, enrichment extends beyond the targeted interval into surrounding chromosomal regions, potentially limiting the method's specificity at the level of individual promoters, enhancers, or gene bodies.

      Specificity is demonstrated through comparative and internally controlled analyses rather than through a quantitative estimate of false discovery rate for locus specificity. Readers should therefore interpret individual protein enrichments as indicative of local chromatin environments rather than definitive evidence of direct binding to a specific regulatory element.

      Orthogonal validation is necessarily selective and hypothesis-driven. A broader validation would be required before newly enriched proteins can be interpreted as bona fide region-resident factors.

      Comparisons to prior locus-proteomics methods remain indirect and should be interpreted primarily in terms of demonstrated feasibility, scalability, and reduced cell-number requirements rather than absolute performance or resolution.

    2. Reviewer #3 (Public review):

      Significance of the Findings:

      The study by Liu et al. presents a novel method, DNA-O-MAP, which combines locus-specific hybridisation with proximity biotinylation to isolate specific genomic regions and their associated proteins. The potential significance of this approach lies in its purported ability to target genomic loci with heightened specificity by enabling extensive washing prior to the biotinylation reaction, theoretically improving the signal-to-noise ratio when compared with other methods such as dCas9-based techniques. Should the method prove successful, it could represent a notable advancement in the field of chromatin biology, particularly in establishing the proteomes of individual chromatin regions-an extremely challenging objective that has not yet been comprehensively addressed by existing methodologies.

      Strength of the Evidence:

      The evidence presented by the authors is somewhat mixed, and the robustness of the findings appears to be preliminary at this stage. While certain data indicate that DNA-O-MAP may function effectively for repetitive DNA regions, a number of the claims made in the manuscript are either unsupported or require further substantiation. There are significant concerns about the resolution of the method, with substantial biotinylation signals extending well beyond the intended target regions (megabases around the target), suggesting a lack of specificity and poor resolution, particularly for smaller loci. Furthermore, comparisons with previous techniques are unfounded since the authors have not provided direct comparisons with the same mass spectrometry (MS) equipment and protocols. Additionally, although the authors assert an advantage in multiplexing, this claim appears overstated, as previous methods could achieve similar outcomes through TMT multiplexing. Therefore, while the method has potential, the evidence requires more rigorous support, comprehensive benchmarking, and further experimental validation to demonstrate the claimed improvements in specificity and practical applicability.

    3. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      The authors describe a method to probe both the proteins associated with genomic elements in cells, as well as 3D contacts between sites in chromatin. The approach is interesting and promising, and it is great to see a proximity labeling method like this that can make both proteins and 3D contacts. It utilizes DNA oligomers, which will likely make it a widely adopted method. However, the manuscript over-interprets its successes, which are likely due to the limited appropriate controls, and of any validation experiments. I think the study requires better proteomic controls, and some validation experiments of the "new" proteins and 3D contacts described. In addition, toning down the claims made in the paper would assist those looking to implement one of the various available proximity labeling methods and would make this manuscript more reliable to non-experts.

      Strengths:

      (1) The mapping of 3D contacts for 20 kb regions using proximity labeling is beautiful.

      (2) The use of in situ hybridization will probably improve background and specificity.

      (3) The use of fixed cells should prove enabling and is a strong alternative to similar, living cell methods.

      Weaknesses:

      (1) A major drawback to the experimental approach of this study is the "multiplexed comparisons". Using the mtDNA as a comparator is not a great comparison - there is no reason to think the telomeres/centrosomes would look like mtDNA as a whole. The mito proteome is much less complex. It is going to provide a large number of false positives. The centromere/telomere comparison is ok, if one is interested in what's different between those two repetitive elements.

      We appreciate the reviewers' point here. In fact we selected the mitochondrial DNA as a target for just the reason that the reviewer notes. mtDNA should be spatially distinct from the nuclear targets and allow us to determine if we were in fact seeing spatially distinct proteins at the interorganelle (mtDNA vs. telomeres/centrosomes) and intraorganelle (telomeres vs centromeres) levels.

      But the more realistic use case of this method would be "what is at a specific genomic element"? A purely nuclear-localized control would be needed for that. Or a genomic element that has nothing interesting at it (I do not know of one).

      We have now added two studies in Figure 4 and Figure 5 detailing the use of OMAP to investigate specific genomic elements. In this case the Hox clusters (HOXA and HOXB) and haplotype-specific analysis of X-chromosome inactivation centers in female murine (EY.T4) cells. The controls in these cases are more specific, in line with those suggested by the reviewer as we (1) compare HOXA and HOXB with or without EZH2 inhibition using the same sets of probes and (2) specifically compare the region surrounding the XIC in female cells for the inactive and active X chromosomes.

      You can see this in the label-free work: non-specific, nuclear GO terms are enriched likely due to the random plus non-random labeling in the nucleus. What would a Telo vs general nucleus GSEA look like? (GSEA should be used for quantitative data, no GO). That would provide some specificity. Figures 2G and S4A are encouraging, but a) these proteins are largely sequestered in their respective locations, and b) no validation by an orthogonal method like ChIP or Cut and Run/Tag is used.

      We performed GSEA on the enrichment scores for the label-free proteomics data from the SAINT output in Figure 1D and that several of these proteins (e.g., those highlighted in Figure 2A: TERF1, CENPN, TOM70) have already been extensively validated to co-localize to these locations.

      To the reviewers request for additional validation, we analyzed ChIP-seq data for several proteins to determine if they were enriched surrounding specific loci. In the case of the HoxA/B analysis, we found that HDAC3 and TCF12 were enriched at HOXB compared to HOXA, and SMARCB1 and ZC3H13 were enriched at HOXA compared to HOXB (Figure 4C). HDAC3 and TCF12 ChIP data confirmed increased peak calls at HOXB and SMARCB1 and ZC3H13 ChIP data confirmed increased peak calls at HOXA for these four selected proteins (Figure 4D).

      You can also see this in the enormous number of "enriched" proteins in the supplemental volcano plots. The hypothesis-supporting ones are labeled, but do the authors really believe all of those proteins are specific to the loci being looked at? Maybe compared to mitochondria, but it's hard to believe there are not a lot of false positives in those blue clouds. I believe the authors are more seeing mito vs nucleus + Telo than the stated comparison. For example, if you have no labeling in the nucleus in the control (Figures 1C and 2C) you cannot separate background labeling from specific labeling. Same with mito vs. nuc+Telo. It is not the proper control to say what is specifically at the Telo.

      We agree with the reviewer that compared to mitochondrial targeting, there could be non-specific nuclear comparisons. We note again though that we purposefully stayed away from using the word “specifically” when describing the proteomics work developed here. The reason being that we are not atlasing a large number of targets to define specificity. Instead, we highlight in Figure 2 that we did observe differences in proteins associating with telomeres and mitochondrial DNA. That may be non-specific, and in fact, this is also why we decided to include two nuclear targets to determine what might be specifically enriched. Thus, we compared centromeric and telomeric protein enrichment as determined by OMAP and observed consistent differential enrichment of shelterin proteins at telomeres (Figure 2I) and CENP-A complex members at centromeres (Figure 2J). We could have done the relative comparisons to no-oligo controls, analogous to how CASPEX compared targeted analyses to no-sgRNA controls (PMID: 29735997). However, we found that the mitochondrial targeted samples were generally better as a comparator because (1) we have clear means to validate differences and (2) the local environment around DNA is being labeled.

      I would like to see a Telo vs nuclear control and a Centromere vs nuc control. One could then subtract the background from both experiments, then contrast Telo vs Cent for a proper, rigorous comparison. However, I realize that is a lot of work, so rewriting the manuscript to better and more accurately reflect what was accomplished here, and its limitations, would suffice.

      Assuming the nuclear control was the same, It is unclear how this ratio-of-ratios ([Telo/Ctrl]/[Cent/ctrl]) experiment would be inherently different from the direct comparison between Telo and Centromere. Again, assuming the backgrounds are derived from the same cellular samples. More than likely adding the extra ratios could increase the artifactual variance in the estimates, reducing the power of the comparisons as has been seen in proteomics data using ratio-of-ratio comparisons in the past (Super-SILAC).

      (2) A second major drawback is the lack of validation experiments. References to literature are helpful but do not make up for the lack of validation of a new method claiming new protein-DNA or DNA-DNA interactions. At least a handful of newly described proximal proteins need to be validated by an orthogonal method, like ChIP qPCR, other genomic methods, or gel shifts if they are likely to directly bind DNA. It is ok to have false positives in a challenging assay like this. But it needs to be well and clearly estimated and communicated.

      We appreciate the reviewers' point here. To be clear, we have not made any claims about new proteins at specific loci. Instead we validated that known telomeric and centromeric associating proteins were consistently enriched by DNA OMAP (Figure 2). We also want to emphasize that while valuable, the current paper is not an atlasing paper to define the full and specific proteomes of two genomic loci. We instead show how this method can be used to observe quantitative differences in proteins enriched at certain loci (HOXA/B work, Figure 4) and even between haplotypes (Xi/Xa work, Figure 5).

      (3) The mapping of 3D contacts for 20 kb regions is beautiful. Some added discussion on this method's benefits over HiC-variants would be welcomed.

      We appreciate the reviewers' point here and have added the following text to the discussion: “Additionally, we show that this method is also able to detect DNA-DNA contacts through biotinylation of loop anchors. Our approach functions similarly to 4C[86]. However, our approach of biotin labeling of contacts does not rely on pairwise ligation events. Thus, detection of contacts through DNA O-MAP will vary in the sampling of DNA-DNA contacts in comparison.”

      (4) The study claims this method circumvents the need for transfectable cells. However, the authors go on to describe how they needed tons of cells, now in solution, to get it to work. The intro should be more in line with what was actually accomplished.

      We took the reviewers point and have worked to scale down the DNA OMAP experiments while revising this manuscript. As noted in Figure 5, we have been able to scale this work down to work on plates with ~10x fewer cells than with our initial experiments. This is on top of the initial DNA OMAP work in Figure 1 and 2, as well as our additional work in Figure 4, where we are using 30-60 million cells in solutions which is still 10x less material than previous work (PMID: 29735997). Thus, the newest DNA OMAP platform uses ~100x fewer cells than previous work.

      (5) Comments like "Compared to other repetitive elements in the human genome...." appear to circumvent the fact that this method is still (apparently) largely limited to repetitive elements. Other than Glopro, which did analyze non-repetitive promoter elements, most comparable methods looked at telomeres. So, this isn't quite the advancement you are implying. Plus, the overlap with telomeric proteins and other studies should be addressed. However, that will be challenging due to the controls used here, discussed above.

      As noted above, we have added Figures 4 and 5 to address the reviewer concerns by targeting multiple non-repetitive loci (HOXA and HOXB clusters and a 4.5Mb region straddling X-inactivation center on both the active and inactive X homolog). Targeting the regions around the X-inactivation center shows the potential to perform haplotype-resolved proteome analysis of chromatin interactors.

      For the telomeric protein overlap, we tried to do this specifically in Figure 1F, we agree with the reviewer that the controls used dramatically change the proteins considered enriched. The goal of the network analysis was to show (1) that we identify proteins previously observed in telomere proteomic datasets and (2) that we gain a more complete view of proteins based on capturing more known interacting proteins than many previous methods as was noted for the RNA OMAP platform (PMID: 39468212). For example, we observed enrichment of PRPF40A in the telomeric DNA OMAP data. From the Bioplex interactome, PRPF40A was observed to interact with TERF2IP and TERF2, suggesting that through these interactions PRPF40A may colocalize at telomeres. Similarly, we observed enrichment of SF3A1, SF3B1, and SF3B2. The SF3 proteins are known regulators of telomere maintenance (PMID: 27818134), but have not previously been observed in telomeric proteomics datasets, except now in DNA OMAP.

      We have added the following text to the Results to clarify these points:

      “To benchmark DNA O-MAP, we compared the full set of telomeric proteins to proteins observed in five established telomeric datasets (PICh, C-BERST, CAPLOCUS, CAPTURE, BioID)12,14,16,35,36 (Figure 1F). DNA O-MAP captured both previously observed telomeric interacting proteins (shelterins) as well as telomere associated proteins (ribonucleoproteins). We identified multiple heterogeneous nuclear ribonucleoproteins (hnRNPs) previously annotated as telomere-associated, including HNRNPA1 and HNRNPU. HNRNPA1 has been demonstrated to displace replication protein A (RPA) and directly interact with single-stranded telomeric DNA to regulate telomerase activity37–39. HNRNPU belongs to the telomerase-associated proteome40 where it binds the telomeric G-quadruplex to prevent RPA from recognizing chromosome ends41. We mapped DNA O-MAP enriched telomeric proteins to the BioPlex protein interactome and observed that in addition to capturing proteins from previously observed telomeric datasets (Figure 1F), DNA O-MAP enriched for interactors of previously observed telomeric proteins. Previous data found RBM17 and SNRPA1 at telomeres, and in BioPlex these proteins interact with three SF3 proteins (SF3A1, SF3B1, SF3B2). Though they were not identified in previous telomeric proteome datasets, all three of these SF3 proteins were enriched in the DNA O-MAP telomeric data. Furthermore, through interactions with G-quadruplex binding factors, these SF3 proteins are regulators of telomere maintenance (PMID: 27818134). Taken together, this data supports the effectiveness of DNA O-MAP for sensitively and selectively isolating loci-specific proteomes.”

      Reviewer #2 (Public review):

      Summary

      Liu and MacGann et al. introduce the method DNA O-MAP that uses oligo-based ISH probes to recruit horseradish peroxidase for targeted proximity biotinylation at specific DNA loci. The method's specificity was tested by profiling the proteomic composition at repetitive DNA loci such as telomeres and pericentromeric alpha satellite repeats. In addition, the authors provide proof-of-principle for the capture and mapping of contact frequencies between individual DNA loop anchors.

      Strengths

      Identifying locus-specific proteomes still represents a major technical challenge and remains an outstanding issue (1). Theoretically, this method could benefit from the specificity of ISH probes and be applied to identify proteomes at non-repetitive DNA loci. This method also requires significantly fewer cells than other ISH- or dCas9-based locus-enrichment methods. Another potential advantage to be tested is the lack of cell line engineering that allows its application to primary cell lines or tissue.

      We thank the reviewers for their comments and note that we have followed up on the idea of targeting non-repetitive DNA loci (HOXA and HOXB clusters and a 4.5Mb section of the X chromosome on each homolog) in the revised manuscript (Figures 4 and 5).

      Weaknesses

      The authors indicate that DNA O-MAP is superior to other methods for identifying locus-specific proteomes. Still, no proof exists that this method could uncover proteomes at non-repetitive DNA loci. Also, there is very little validation of novel factors to confirm the superiority of the technique regarding specificity.

      Our primary claim for DNA OMAP is that it requires orders of magnitude fewer cells than previous studies. Based on comments along these lines from both reviewers, we performed DNA OMAP targeting non-repetitive DNA loci (HOXA and HOXB clusters and a 4.5Mb section of the X chromosome on each homolog) in the revised manuscript (Figure 4 and 5). For the X chromosome targeting, we used ~3 million cells per condition with methods that we optimized during revision. When targeting HOXA and HOXA, we were able to identify HDAC3 and TCF12 enrichment at HOXB compared to HOXA as well as ZC3H13 and SMARB1 enrichment at HOXA compared to HOXB, which is consistent with ChIP-seq reads from ENCODE for these proteins (Figure 4C, D). Both the HOXand X chromosome work help to address limitations noted in the Gauchier et al. paper the reviewer notes as both show progress towards overcoming “the major signal-to-noise ratio problem will need to be addressed before they can fully describe the specific composition of single-copy loci”.

      The authors first tested their method's specificity at repetitive telomeric regions, and like other approaches, expected low-abundant telomere-specific proteins were absent (for example, all subunits of the telomerase holoenzyme complex). Detecting known proteins while identifying noncanonical and unexpected protein factors with high confidence could indicate that DNA O-MAP does not fully capture biologically crucial proteins due to insufficient enrichment of locus-specific factors. The newly identified proteins in Figure 1E might still be relevant, but independent validation is missing entirely. In my opinion, the current data cannot be interpreted as successfully describing local protein composition.

      We analyzed ChIP-seq reads for our HOXA and HOXB (Figure 4C,D) which recapitulate our findings for four of our differentially enriched proteins. We also note that with the addition of the nonrepetitive loci (Figures 4 and 5), we have performed DNA OMAP on seven different targets (telomeres, pericentromeres, mitoDNA, HOXA, HOXB, Xi, and Xa) and identified expected targets at each of these. The consistency of these data, which mirrors the consistency of the RNA implementation of OMAP (PMID: 39468212), reinforces that we can successfully enrich local proteomes at genomic loci.

      Finally, the authors could have discussed the limitations of DNA O-MAP and made a fair comparison to other existing methods (2-5). Unlike targeted proximity biotinylation methods, DNA O-MAP requires paraformaldehyde crosslinking, which has several disadvantages. For instance, transient protein-protein interactions may not be efficiently retained on crosslinked chromatin. Similarly, some proteins may not be crosslinked by formaldehyde and thus will be lost during preparation (6).

      Based on this critique we have gone back through the manuscript to improve the fairness of our comparisons and expanded the limitations in our discussion section.

      To the point about fixation, Schmiedeberg et al., which the reviewer references, does describe crosslinking requiring longer interactions (~5 s). Yet, as featured in reviews, many additional studies have found that “it has been possible to perform ChIP on transcription factors whose interactions with chromatin are known from imaging studies to be highly transient” (Review PMID: 26354429). We note similar results in proteomics analysis in Subbotin and Chait that state that the linkage of lysine-based fixatives like formaldehyde and “glutaraldehyde to reactive amines within the cellular milieu were sufficient to preserve even labile and transient interactions (PMID: 25172955).

      (1) Gauchier M, van Mierlo G, Vermeulen M, Dejardin J. Purification and enrichment of specific chromatin loci. Nat Methods. 2020;17(4):380-9.

      (2) Dejardin J, Kingston RE. Purification of proteins associated with specific genomic Loci. Cell. 2009;136(1):175-86.

      (3) Liu X, Zhang Y, Chen Y, Li M, Zhou F, Li K, et al. In Situ Capture of Chromatin Interactions by Biotinylated dCas9. Cell. 2017;170(5):1028-43 e19.

      (4) Villasenor R, Pfaendler R, Ambrosi C, Butz S, Giuliani S, Bryan E, et al. ChromID identifies the protein interactome at chromatin marks. Nat Biotechnol. 2020;38(6):728-36.

      (5) Santos-Barriopedro I, van Mierlo G, Vermeulen M. Off-the-shelf proximity biotinylation for interaction proteomics. Nat Commun. 2021;12(1):5015.

      (6) Schmiedeberg L, Skene P, Deaton A, Bird A. A temporal threshold for formaldehyde crosslinking and fixation. PLoS One. 2009;4(2):e4636.

      Reviewer #3 (Public review):

      Significance of the Findings:

      The study by Liu et al. presents a novel method, DNA-O-MAP, which combines locus-specific hybridisation with proximity biotinylation to isolate specific genomic regions and their associated proteins. The potential significance of this approach lies in its purported ability to target genomic loci with heightened specificity by enabling extensive washing prior to the biotinylation reaction, theoretically improving the signal-to-noise ratio when compared with other methods such as dCas9-based techniques. Should the method prove successful, it could represent a notable advancement in the field of chromatin biology, particularly in establishing the proteomes of individual chromatin regions - an extremely challenging objective that has not yet been comprehensively addressed by existing methodologies.

      Strength of the Evidence:

      The evidence presented by the authors is somewhat mixed, and the robustness of the findings appears to be preliminary at this stage. While certain data indicate that DNA-O-MAP may function effectively for repetitive DNA regions, a number of the claims made in the manuscript are either unsupported or require further substantiation. There are significant concerns about the resolution of the method, with substantial biotinylation signals extending well beyond the intended target regions (megabases around the target), suggesting a lack of specificity and poor resolution, particularly for smaller loci.

      We thank the reviewers for their comments and note that we have followed up on the idea of targeting non-repetitive DNA loci (HOX clusters and part of the X chromosome) in the revised manuscript (Figures 4 and 5).

      Furthermore, comparisons with previous techniques are unfounded since the authors have not provided direct comparisons with the same mass spectrometry (MS) equipment and protocols. Additionally, although the authors assert an advantage in multiplexing, this claim appears overstated, as previous methods could achieve similar outcomes through TMT multiplexing. Therefore, while the method has potential, the evidence requires more rigorous support, comprehensive benchmarking, and further experimental validation to demonstrate the claimed improvements in specificity and practical applicability.

      We have made the comparisons as best as possible. In fact, we found it difficult to find examples of recent implementations of many of these methods. Purchasing the exact mass spectrometers or performing every version of chromatin proteomics would be well beyond the scope of this work. On the other hand, OMAP has already generated data for three manuscripts. We are making the claim that using the instrumentation and methods available to us, we were able to reduce the number of cells required to analyze a given genomic loci. We then applied TMT multiplexing to further improve the throughput and perform replicate analyses. To fully validate that one protein exists at one loci and no other would require exhaustive atlasing of protein-genomic interactions which would be well beyond the scope of this single paper. Similarly, ChIP for every target identified to assess an empirical FDR would be well beyond the scope of this work.

      Recommendations for the authors:

      Reviewing Editor Comments:

      In summary, all three reviewers raised major concerns about the limitations of the method, many of which could be resolved by more precise and transparent language about these limitations. If you choose to resubmit a revised version, you should address questions like: What scale does "individual locus" refer to? At what scale can the method map protein-DNA interactions at individual targeted loci, rather than large repetitive domains? What is the estimated false discovery rate for a set of enriched proteins? The eLife assessment for this version of the manuscript is based on reviewer concerns. Note that this assessment can be updated after receiving a response to reviewer comments.

      Reviewer #1 (Recommendations for the authors):

      (1)The first couple of paragraphs make it sound like your method would exclusively benefit from sample multiplexing with MS-based proteomics. That is a bit misleading. The other stated methods use TMT. They don't use it to compare very different genomic (or compartmental) regions, but there is no reason cberst, glopro or CasID could not.

      A good point and we have updated the manuscript to reflect this. While previous methods generally did not use TMT, they could be adapted to do so and, similar to OMAP, improved by the use of more replicates in their analyses.

      (2) Please make the colors in 1F for the dataset overlap easier to read. 2 and 4+ are too similar.

      We appreciate the comment on making the colors easier to discern. Along these lines we’ve changed the color of “2” to make it easier to distinguish from “4+”.

      (3) Label as many dots as legible in your volcano plots.

      We’ve labeled a number of proteins that are relevant to the discussion in this paper as well as some additional proteins. We feel that additional labeling would detract from the points that we are trying to make in individual figure panels about groups of proteins, rather than general remodeling of all proteins.

      (4) Figure 2E needs a divergent color scheme since it crosses 0. And is it scaled, log-transformed, or both? And compared to what then?

      Figure 2E (heatmap) is z-scaled relative protein abundance measurements based on TMTpro reporter ion signal to noise (“s/n”). We have added additional information to the legend to highlight the information that the reviewer points out here. For the color, we are unsure of what is being asked for, as above 0 is red and below 0 is blue.

      (5) Unclear what you are implying with "...only 1-2 biological replicates." I would omit or clarify.

      Fair point, we have updated the manuscript to omit this section to simplify the introduction.

      (6) H2O2 and biotin phenols might be toxic to living organisms. But so is 4% PFA and ISH. I realize you are trying to justify your new approach but you don't need to do it with exaggerated contrasts. This O-MAP is a great approach and probably more likely for people to adopt it because it's DNA ISH based. Plus, with the clinking, you are likely not displacing proteins via Cas9 landing.

      We appreciate the reviewer’s comments about adoption and lack of protein displacement. We’ve scaled back on the claims and added more about limitations owing to crosslinking and ISH.

      (7) How much genome does the Cent regions take up? You state 500 kb for Telos.

      In the text we delineate how large of a region the PanAlpha probes target “The genome-wide binding profile of the pan-alpha probe closely overlaps with centromeres (Figure S1) and covers approximately 35 Mb of the genome according to in silico predictions.” Additionally, we’ve added Table S4 to summarize target locus sizes for all of the included targets.

      (8) You seem to be underestimating the lysine labeling. Is that after TMT labeling and analysis? If so, you're already ignoring what couldn't be seen. I don't think it's that important but you included it, so please describe clearly why it's an issue and how much of an issue it is. How does that relate to lit values? And it's not just TMTpro, it's any lysine labeler.

      We appreciate the reviewers point about specifying the reasoning and the lack of clarity around overall lysine labeling. That 1.38% is the number of peptides with remainder modifications due to formaldehyde crosslinking. For overall acylation of lysines with TMT labels, we generally expect (and achieve) >97% labeling of lysines with TMT reagents as the Kuster and Carr labs nicely demonstrated across a range of labeling conditions (PMID: 30967486).

      Decrosslinking is a critical step generally for proteomics workflows on fixed or FFPE tissues and thus we sought to explore whether we could achieve sufficiently low residual lysine alkylation to enable protein quantitation by TMTpro reagents (or any lysine labeler, as the reviewer notes). For TMTpro-based methods on peptides, this is less of a concern generally as protease cleavage frees new primary amines at the N-termini of peptides which can be labeled for quantitation. But in part since we are describing a proteomics method on fixed tissues we wanted to share these data and the potential inclusion of residual fixation modifications for readers to potentially take into consideration when performing this method.

      Reviewer #3 (Recommendations for the authors):

      Liu et al. describe an original locus labelling approach that enables the isolation of specific genomic regions and their associated proteins. I have mixed views on this work, which, in my opinion, remains preliminary at this stage. Establishing the proteome of a single chromatin region is one of the most complex challenges in chromatin biology, as extensively discussed in Gauchier et al. (2020). Any breakthrough towards this goal is of significant interest to the community, making this manuscript potentially compelling. Indeed, some data suggest that the method works for repetitive DNA to some extent. However, much of the data is not very convincing, and in the case of small DNA targets, it argues against the use of DNA-O-MAP.

      In contrast to existing methods, DNA-O-MAP combines locus-specific hybridisation in situ (using affordable oligonucleotides) with proximity biotinylation. A major advantage of this strategy over other locus-specific biotinylation methods is the possibility of extensively washing excess or non-specifically hybridised probes before the biotinylation reaction, theoretically limiting biotinylation to the target region and thus significantly enhancing the signal-to-noise ratio. Other methods involving proximity biotinylation, such as targeted dCas9, do not have this capacity, meaning biotinylation occurs not only at the locus where a small fraction of dCas9 molecules is targeted but also around non-bound dCas9 molecules (representing the vast majority of dCas9 expressed in a given cell). This aspect potentially represents an interesting advance.

      We thank the reviewer for their thoughts and critiques, which we hope have in part relieved concerns pertaining to limitation on repetitive elements. To the latter points, we confirmed this with new specificity analysis that showed labeling to be highly specific to a given probe locus (Figure S3).

      Below, I outline the significant issues:

      The manuscript implies that DNA-O-MAP has better sensitivity than earlier techniques like CAPTURE, GLOPRO, or PICh. The authors state that PICh uses one trillion cells (which I doubt is accurate), and other methods require 300 million cells, whereas DNA-O-MAP uses only 60 million cells, suggesting the latter is more feasible. However, these earlier experiments were conducted almost 15 and 6 years ago, when mass spectrometry (MS) sensitivity was considerably lower than that of current instruments. The authors cannot know whether the proteome obtained by previous methods using 60 million cells, but analysed with current MS technology, would yield results inferior to those of DNA-O-MAP. Unless the authors directly compare these methods using the same number of cells and identical MS setups, I find their argument unjustified and misleading.

      Based on the instrumentation listed, we actually do have a good idea of how sensitivity changes may have affected identifications and overall sensitivity. For example, the CASPEX data was collected on an Orbitrap Fusion Lumos, while our data was collected on an Orbitrap Fusion Eclipse. From our work characterizing these two instruments during the Eclipse development (PMID: 32250601), we do actually know that the ion optics improvements boosted sensitivity of the Eclipse used in our work compared to the Lumos by ~50%, meaning if GLOPRO was run on an Eclipse it would still require >200 million cells per replicate for input.

      It is suggested that DNA-O-MAP is capable of 'multiplexing', whereas previous methods are not. This statement is also misleading. As I understand it, the targeted regions do not originate from a common pool of cells. Instead, TMT multiplexing only occurs after each group of cells has been independently labelled (Telo, Centro, Mito, control). Therefore, previous methods could also perform multiplexing with TMT. Moreover, it is unclear how each proteome was compared: one would expect many more proteins from centromeres than from telomeres (I am unsure about the number of mitochondria in these cells) since these regions are significantly larger than telomeres (possibly 10 to 100 times larger?). Have the authors attempted to normalise their proteomics data to the size (concatenated) of each target? This is particularly relevant when comparing histone enrichment at chromatin regions of differing sizes.

      We agree with the reviewers that this was overstated. In fact the GLOPRO paper notes that they performed a MYC analysis with a previous generation of TMT that could multiplex 10 samples. We have amended the manuscript to be more specific in those contexts. As stated in the methods section, “Samples were column normalized for total protein concentration”, to account for the amount of protein and size of the different targets.

      Figure 1C shows streptavidin dots resembling telomeres. To substantiate this claim, simultaneous immunofluorescence with a telomere-specific protein (e.g., TRF1 or TRF2) is required. It is currently unknown whether all or only a subset of telomeres are targeted by DNA-O-MAP, and it is also unclear if some streptavidin foci are non-telomeric. Quantification is needed to indicate the reproducibility of the labelling (the same comment applies to the centromere probes later in the manuscript; an immunofluorescence assay with CENPB would be informative, alongside quantifications).

      We understand the reviewer’s concern about specificity and reproducibility of DNA-O-MAP. To address this we have added analysis showing the efficiency and specificity of our FISH and biotin labeling for Telomere, PanAlpha, and Mitochondria targeting oligos (Figure S3). We found that biotin deposition was highly specific to the intended targets with an average across the three probes of 98% specificity.

      Perhaps more importantly, the authors suggest that it may be possible to enrich proteins that are not necessarily present at the target locus but are instead in spatial proximity (e.g., RNA polymerase I subunits enriched upon centromere targeting). Does this not undermine the purpose of retrieving locus-specific proteomes?

      The goal of DNA OMAP is to identify a local neighborhood of proteins around a specific genomic loci, similar to GLOPRO. As we note in the work presented in Figure 4 and 5 now, these neighborhoods are inherently interesting for comparison of quantitative changes that occur around a genomic locus.

      Possibly related to the previous issue, when DNA-O-MAP is used to assess DNA-DNA interactions, probes covering regions of 20-25 kb are employed. Therefore, one would expect these regions to be significantly biotinylated compared to flanking regions. However, Genome Browser screenshots indicate extensive biotinylation signals spanning several megabases around the 20-25 kb targets. If the method were highly resolutive, the target region would be primarily enriched, with possibly discrete lower enrichment at distant interacting regions. The lack of discrete enrichment suggests poor resolution, likely due to the likely large scale of proximity biotinylation. This compromises the effectiveness of DNA-O-MAP, especially if it is intended to target small loci with complex sequences. Could the authors quantify the absolute number of reads from the target region compared to those from elsewhere in the genome (both megabases around the locus and other chromosomes, where many co-enriched regions seem to exist)? This would provide insights into both enrichment and specificity.

      Thanks for this suggestion, we have included a new Figure S8 to look at normalized read depth as a function of distance from the genomic target. The resolution of DNA OMAP, like all peroxidase mediated proximity labeling methods, is not dependent on the sequence length of the DNA region, but the 30-40nm of physical space around the HRP molecule that is targeted to the genomic loci. 

      Minor Issues:

      (1) Page 3, second paragraph: It is unclear why probes producing a visible signal in situ necessarily translates to their ability to retrieve a specific proteome.

      We have revised the manuscript to de-emphasize the visible signal aspect of probe targeting and re-emphasize our initial point that the number of probes needed to properly target unique regions makes the use of locked nucleic acid probes cost-prohibitive. The basic point though, we and others previously showed with RNA OMAP (PMID: 39468212) and Apex/proximity labeling strategies, the ability to deposit biotin and visualize generally directly translates to recovery of proximally labeled proteins (PMID: 26866790).

      (2) Page 3, last paragraph: "to reach a higher degree of enrichment...": Has it been demonstrated that direct protein biotinylation provides higher enrichment of relevant proteins? Certainly, there is higher enrichment of proteins, but whether they are relevant is another matter.

      Our point here was that the methods using direct protein biotinylation have higher levels of enrichment and thus require less cells than the previously mentioned PICh method, which is why we wrote the following: “In the case of GLoPro, APEX-based proximity labeling enhanced protein detection sensitivity, reducing the input required for each replicate analysis to ~300 million cells—a 10-fold reduction in cell input compared to PICh which used 3 billion cells.”

      Regarding if these proteins are relevant or not, we show enrichment of known proteins that are critical to the function of their occupied genomic region at telomeres and centromeres. Additionally, we’ve made added quantitative comparisons to assess relevance in our analysis of Hox and our targeted region of the X chromosome through comparisons to ChIP data at these regions. The improved enrichment that we’ve established in our initial submission as well as in the updated version also means that we can further scale down the number of cells required.

      (3) Figure 2B is misleading; it appears as though all three regions are targeted in the same cell, suggesting true multiplexing, which, I believe, is not the case.

      To avoid any potential confusion about how the samples were derived we’ve updated this figure panel to show three separate cells, each with a different region being targeted.

      (3) If I understand correctly, the 'no probe' control should primarily retrieve endogenously biotinylated proteins (carboxylases), which are mainly found in mitochondria. Why does the Pearson clustering in Supplementary Figure 2 not place this control proteome closer to the mitochondrial proteome?

      Under the assumption that the ~10 carboxylases are biotinylated at the same levels in all cells, yet the proportion of these carboxylases compared to all enriched proteins for a given target is markedly reduced. Thus, as a proportion of the enriched proteome we note in Figure S4 that mitochondrial DNA OMAP enriches proteins besides the carboxylases. We believe this explains why the ‘no probe’ sample can be clearly separated along PC2 in Figure 2D.

      (4) Was CENPA enriched in the centromere DNA-O-MAP? If not, have the authors scaled up (e.g., with ten times more cells) to see if the local proteome becomes deeper and detects relevant low-abundance proteins like CENPA or HJURP? This would be very informative.

      We did not observe CENPA, and we had originally contemplated the experiment the reviewer suggested, but noted that CENPA has only two tryptic peptides (>7 AA, <35AA), and they are both in the commonly phosphorylated region of the protein. Rather than scale up these experiments, we decided to attempt DNA OMAP on the non-repetitive locus experiments.

      (5) Using a few million cells, I do not see how the starting chromatin amount could range from 0.5 to 7 mg, as shown in Figures 2 and 3. How were these figures calculated? One diploid cell contains approximately 6 pg of DNA/chromatin, which means one billion cells represent about 6 mg of DNA/chromatin (a typical measurement for these methods).

      Thanks to the reviewer for catching this, that should have been the total lysate amount, not chromatin mass. We have corrected Figures 2 and 3.

      (6) Figure S1: There is no indication of the metrics used for the shades of red.

      We have added a gradient legend to depict this.

      (7) What is the purpose of HCl in the experiment?

      HCl treatment was done to reduce autofluorescence for imaging (PMID: 39548245).

      (8) I could not find the MS dataset on the server using the provided accession number (PDX054080).

      Thank you for pointing this out, we have confirmed the dataset is public now and added the new datasets for the Xi/Xa and Hox studies. We also note that the accession should be “PXD054080”

      (9) Why desthiobiotin instead of biotin?

      We have tested both; desthiobiotin was helpful to reduce adsorption to surfaces. Either biotin or desthiobiotin can be used, though, for OMAP.

    1. A auto exposição nas redes sociais tornou-se uma prática profundamente enraizada na cultura digital contemporânea, onde a visibilidade é frequentemente percebida como uma recompensa. O número de curtidas, amigos, postagens, seguidores e comentários servem como métricas de sucesso pessoal, criando uma dinâmica onde os usuários estão constantemente expostos ao julgamento de outros (Lima, 2022).

      Ver onde posso falar sobre isso,...Porque ja havia falado de como as pessoas podem falar oque quiser nas redes sociais...Esse conta o outro lado da moeda, como as pessoas se expoem facil na internet em troca de likes

    1. salvo quando

      Via de regra, é proibido o desconto de qualquer valor do salário do empregado. Apenas se admite nas hipóteses de: - Adiantamento; - Dispositivo de lei ou de contrato coletivo; - Dano culposo, se previsto em contrato; - Dano doloso.

      Nessa linha:

      b) Dano doloso

      • Se o empregado provoca um dano qualquer ao empregador, e o faz dolosamente, ou seja, com a intenção de fazê-lo, deve ressarcir o empregador dos prejuízos experimentados. E este ressarcimento pode ser feito inclusive através do desconto nos salários, a teor do disposto no art. 462, § 1º, da CLT.

      • Caso o valor a ser ressarcido seja superior a 70% do valor do salário, entende-se que somente pode ser descontado, por mês, até este limite, ante o disposto na OJ 18 da SDC do TST:

      OJ-SDC-18. Descontos autorizados no salário pelo trabalhador. Limitação máxima de 70% do salário-base (inserida em 25.05.1998).

      • Os descontos efetuados com base em cláusula de acordo firmado entre as partes não podem ser superiores a 70% do salário-base percebido pelo empregado, pois deve-se assegurar um mínimo de salário em espécie ao trabalhador.

      c) Dano culposo, se autorizado em contrato o desconto

      • No caso de dano causado ao empregador pelo empregado, tendo agido este com culpa (seja por imperícia, imprudência ou negligência), pode o empregador descontar do salário o prejuízo experimentado, desde que o empregado tenha autorizado expressamente o desconto em tais hipóteses.

      • Na prática, quase todos os empregados autorizam o desconto por dano culposo no momento da admissão, ao assinar o famoso contrato de adesão imposto pelo empregador.

      • Nesta hipótese de desconto por dano culposo, surge a polêmica questão da OJ 251 do TST:

      OJ-SDI1-251. Descontos. Frentista. Cheques sem fundos (inserida em 13.03.2002).

      É lícito o desconto salarial referente à devolução de cheques sem fundos, quando o frentista não observar as recomendações previstas em instrumento coletivo.

      • A interpretação que se dá a tal verbete é no sentido de que o TST flexibilizou o rigor do dispositivo celetista, passando a prever, ao menos neste caso, a autorização genérica para desconto na própria norma coletiva, pelo que o desconto prescindiria de autorização contratual do empregado.

      • No mundo dos fatos, a hipótese é mais ou menos a seguinte: a norma coletiva prevê que o frentista deve anotar, no verso do cheque recebido, os dados básicos do emitente, como endereço e telefone, bem como a placa do veículo. Caso deixe de fazê-lo, se sujeita ao desconto salarial caso o cheque não tenha provisão de fundos.

      (RESENDE, Ricardo. Direito do Trabalho - 9ª Edição 2023. 9. ed. Rio de Janeiro: Método, 2023. E-book. p.568. . Acesso em: 19 mai. 2025.)


      • Obs.: Não confundir a possibilidade de desconto salarial decorrente de dano doloso/culposo com desconto de valores da rescisão contratual.

      • Enquanto jurisprudência entende pela possibilidade de desconto de até 70% do salário na hipótese dano doloso, na hipótese de rescisão contratual, o limite é o salário mensal para fins de desconto. O valor remanescente será tido como dívida civil.

    1. o we have a responsibility to send lead-ers into the future that can imagine the consequences of their technologicaladvancements and design against it if necessary

      is this working?

    1. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      The authors test the hypotheses, using an effort-exertion and an effort-based decision-making task, while recording brain dynamics with EEG, that the brain processes reward outcomes for effort differentially when they earned for themselves versus others.

      The strengths of this experiment include what appears to be a novel finding of opposite signed effects of effort on the processing of reward outcomes when the recipient is self versus others. Also, the experiment is well-designed, the study seems sufficiently powered, and the data and code are publicly available.

      We thank Reviewer #1 for the affirmative appraisal of our manuscript as well as the thoughtful and insightful comments, which have enabled us to significantly improve the manuscript.

      (1) Inferences rely heavily on the results of mixed effects models which may or may not be properly specified and are not supported by complementary analyses.

      We thank Reviewer #1 for raising this critical issue of model specification. We have re-fitted our mixed-effects models and performed complementary analyses to validate the robustness of our findings. Specifically, we adopted the maximal converging random-effects structure (including random slopes for Recipient, Effort, and Magnitude where feasible) while ensuring model stability (see Responses to Reviewer #1’s Recommendations point 2). Crucially, our primary findings, including the Recipient × Effort and Recipient × Effort × Magnitude interactions, remained robust. Furthermore, additional analyses confirmed that these results were not confounded by factors such as response speed and subjective effort rating (see Responses to Reviewer #1’s Recommendations point 5).

      (2) Also, not all results hang together in a sensible way. For example, participants report feeling less subjective effort, but also more disliking of tasks when they were earning rewards for others versus self. Given that participants took longer to complete tasks when earning effort for others, it is conceivable that participants might have been working less hard for others versus themselves, and this may complicate the interpretation of results.

      We thank Reviewer #1 for this insightful point (which also relates to Reviewer #3’s point 5). In our study, participants were asked to rate three specific dimensions: Effort (“How much effort did you exert to complete each effort condition when earning rewards for yourself [or the other person]?”), Difficulty (“How much difficulty did you perceive in each effort condition when earning rewards for yourself [or the other person]?”), and liking (“How much did you like each effort condition when earning rewards for yourself [or the other person]?”).

      We acknowledge the Reviewer #1’s concern that the lower subjective effort ratings for others seems contradictory to the higher disliking and longer completion times. We propose that in this paradigm, subjective effort ratings are susceptible to demand characteristics and likely captured motivational engagement (e.g., “how hard I tried” or “how willing I was”) rather than perceived task demands. To disentangle these factors, we included a measure of perceived task difficulty, which is anchored in task properties and is less prone to social desirability biases (Harmon-Jones et al., 2020; Wright et al., 1990). We found no differences in perceived difficulty between self- and other-benefiting trials (Figure 2D), suggesting that the task demands were perceived as equivalent across conditions. To examine this interpretation more directly, we analyzed correlations among participants’ ratings of difficulty, effort, and liking. As illustrated in Figure S1, we found no correlation between difficulty and effort ratings. Crucially, liking ratings were negatively correlated with difficulty ratings.

      More importantly, our performance data contradict the interpretation that participants “worked less hard” for others in terms of task completion. While participants took longer to complete tasks for others, they maintained comparable, near-ceiling success rates for self (97%) and other (96%) recipients (b = -0.46, p = 0.632; Supplementary Table S1). This dissociation suggests that although participants were less motivated (e.g., lower subjective ratings, longer completion times, and greater disliking) to work for others, they ultimately exerted the necessary physical effort to achieve successful outcomes. Thus, the results consistently point to a decrease in prosocial motivation (consistent with prosocial apathy) rather than a failure of effort exertion.

      Wright, R. A., Shaw, L. L., & Jones, C. R. (1990). Task demand and cardiovascular response magnitude: Further evidence of the mediating role of success importance. Journal of Personality and Social Psychology, 59(6), 1250-1260. https://doi.org/10.1037/0022-3514.59.6.1250

      Harmon-Jones, E., Willoughby, C., Paul, K., & Harmon-Jones, C. (2020). The effect of perceived effort and perceived control on reward valuation: Using the reward positivity to test a dissonance theory prediction. Biological Psychology, 107910. https://doi.org/10.1016/j.biopsycho.2020.107910

      Reviewer #2 (Public review):

      Measurements of the reward positivity, an electrophysiological component elicited during reward evaluation, have previously been used to understand how self-benefitting effort expenditure influences the processing of rewards. The present study is the first to complement those measurements with electrophysiological reward after-effects of effort expenditure during prosocial acts. The results provide solid evidence that effort adds reward value when the recipient of the reward is the self but discounts reward value when the beneficiary is another individual.

      An important strength of the study is that the amount of effort, the prospective reward, the recipient of the reward, and whether the reward was actually gained or not were parametrically and orthogonally varied. In addition, the researchers examined whether the pattern of results generalized to decisions about future efforts. The sample size (N=40) and mixed-effects regression models are also appropriate for addressing the key research questions. Those conclusions are plausible and adequately supported by statistical analyses.

      We appreciate Reviewer #2’s positive appraisal of our manuscript. We are fortunate to receive your thoughtful and insightful suggestions and have revised the manuscript accordingly.

      (1) Although the obtained results are highly plausible, I am concerned whether the reward positivity (RewP) and P3 were adequately measured. The RewP and P3 were defined as the average voltage values in the time intervals 300-400 ms and 300-440 ms after feedback onset, respectively. So they largely overlapped in time. Although the RewP measure was based on frontocentral electrodes (FC3, FCz, and FC4) and the P3 on posterior electrodes (P3, Pz, and P4), the scalp topographies in Figure 3 show that the RewP effects were larger at the posterior electrodes used for the P3 than at frontocentral electrodes. So there is a concern that the RewP and P3 were not independently measured. This type of problem can often be resolved using a spatiotemporal principal component analysis. My faith in the conclusions drawn would be further strengthened if the researchers extracted separate principal components for the RewP and P3 and performed their statistical analyses on the corresponding factor scores.

      We thank Reviewer #2 for raising this issue. We would like to clarify that these two components were time-locked to different types of feedback and therefore reflect neural responses to distinct stages of the prosocial effort task. Specifically, the P3 was time-locked to performance feedback (the effort-completion cue; e.g., the tick shown in Figure 1B), whereas the RewP was time-locked to reward feedback (e.g., the display of “+0.6”). Thus, despite the numerical similarity in the post-stimulus windows, the components capture neural activity evoked by independent events separated in time, corresponding to the performance monitoring versus reward evaluation stages of the task. To avoid misunderstanding, we have made this distinction more explicit in the revised manuscript, which now reads, “Single-trial RewP amplitude was measured as mean voltage from 300 to 400 ms relative to reward feedback onset (i.e., reward delivery) over frontocentral channels (FC3, FCz, FC4). We also measured the parietal P3 (300–440 ms; averaged across P3, Pz, and P4) in response to performance feedback (i.e., effort completion), given its relationship with motivational salience (Bowyer et al., 2021; Ma et al., 2014)” (page 27, para. 1, lines 2–6).

      Reviewer #3 (Public review):

      This study investigates how effort influences reward evaluation during prosocial behaviour using EEG and experimental tasks manipulating effort and rewards for self and others. Results reveal a dissociable effect: for self-benefitting effort, rewards are evaluated more positively as effort increases, while for other-benefitting effort, rewards are evaluated less positively with higher effort. This dissociation, driven by reward system activation and independent of performance, provides new insights into the neural mechanisms of effort and reward in prosocial contexts.

      This work makes a valuable contribution to the prosocial behaviour literature by addressing areas that previous research has largely overlooked. It highlights the paradoxical effect of effort on reward evaluation and opens new avenues for investigating the mechanisms underlying this phenomenon. The study employs well-established tasks with robust replication in the literature and innovatively incorporates ERPs to examine effort-based prosocial decision-making - an area insufficiently explored in prior work. Moreover, the analyses are rigorous and grounded in established methodologies, further enhancing the study's credibility. These elements collectively underscore the study's significance in advancing our understanding of effort-based decision-making.

      We thank Reviewer #3 for the positive assessment. We are particularly encouraged by the reviewer’s recognition of our novel integration of ERPs to uncover the distinct effects of effort on reward evaluation for self versus others. We have carefully addressed the specific recommendations raised in the subsequent comments to further strengthen the rigor and clarity of the manuscript.

      (1) Incomplete EEG Reporting: The methods indicate that EEG activity was recorded for both tasks; however, the manuscript reports EEG results only for the first task, omitting the decision-making task. If the authors claim a paradoxical effect of effort on self versus other rewards, as revealed by the RewP component, this should also be confirmed with results from the decision-making task. Omitting these findings weakens the overall argument.

      We thank Reviewer #3 for giving us the opportunity to verify the specific roles of our two tasks. The primary aim of our study is to elucidate the neural after-effects of effort exertion on subsequent reward evaluation during prosocial acts. The prosocial effort task was specifically designed for this purpose, as it involves actual effort expenditure followed by reward outcomes. Furthermore, this task uses preset effort-reward combinations, ensuring balanced trial counts and adequate signal-to-noise ratios across conditions, a critical requirement for robust ERP analysis. In contrast, the prosocial decision-making task was included specifically to quantify behavioral preference (i.e., prosocial effort discounting) rather than neural reward processing. Specifically, this task involves choices without immediate effort execution and reward feedback, making it impossible to examine the neural after-effects of effort exertion. However, the decision-making task remains indispensable for our study structure: it provides an independent behavioral phenomenon of prosocial apathy, which allowed us to link individual differences in behavioral motivation to the neural dissociations observed in the prosocial effort tasks (as detailed in our Responses to Reviewer #3’s 2). Thus, the two tasks provide complementary, rather than redundant, insights into the behavioral and neural mechanism of prosocial effort.

      (2) Neural and Behavioural Integration: The neural results should be contrasted with behavioural data both within and between tasks. Specifically, the manuscript could examine whether neural responses predict performance within each task and whether neural and behavioural signals correlate across tasks. This integration would provide a more comprehensive understanding of the mechanisms at play.

      We thank Reviewer #3 for this insightful and helpful suggestion. We agree that linking neural signatures with behavioral patterns is crucial for establishing the functional significance for our ERP findings. Regarding within-task association, it is important to note that the prosocial effort task was designed to require participants to exert fixed, preset levels of physical effort to earn uncertain rewards. This experimental control was necessary to standardize effort exertion across self-benefiting and other benefiting trials, thereby minimizing confounds such as differences in physical or perceived effort prior to the feedback phase. Indeed, the neural after-effects remained after controlling for these behavioral measures (i.e., response speed and self-reported effort; as detailed in responses to Reviewer #1’Recommendations point 5). Furthermore, unlike the prosocial effort task, the decision-making task inherently precludes the examination of the neural after-effects of effort; therefore, within-task association in this task was not possible.

      Given these considerations, we focused on the cross-task association. We examined whether the neural after-effects of effort (indexed by the RewP) in the prosocial effort task were modulated by individual differences in effort discounting. We used the K value estimated from the prosocial decision-making task as the index of effort discounting. We entered the K value (log-transformed and z-scored) as a continuous predictor into the mixed-effects models of RewP amplitudes. The full regression estimates for the model are presented in Table S1 (left).

      We observed a significant four-way interaction among recipient, effort, magnitude, and K value (b = 0.58, p = 0.013). To decompose this complex interaction, we performed simple slopes analyses separately for self- and other-benefiting trials at high and low levels of reward magnitude and discounting rate (±1 SD). As shown in Figure S2, for self-benefiting trials, the effort-enhancement effect on the RewP was significant only for participants with high discounting rates at low reward magnitude (b = 1.02, 95% CI = [0.22, 1.82], p = 0.012). In contrast, participants with low discounting rates exhibited no significant effort effect (b = -0.37, 95% CI = [-0.89, 0.15], p = 0.159). At high reward magnitude, simple slopes analyses detected no significant effort effects for either high (b = 0.35, 95% CI = [-0.44, 1.14], p = 0.383) or low (b = 0.45, 95% CI = [-0.07, 0.97], p = 0.093) discounting individuals. These findings strongly support the cognitive dissonance account (Aronson & Mills, 1959): those who find effort most aversive are most compelled to inflate the value of small rewards to justify their exertion. For these individuals, the completion of a costly action for a small reward may trigger a stronger internal justification effect, resulting in an amplified neural reward response.

      For other-benefiting trials, participants with low discounting rates exhibited a significant effort-discounting effect at high reward magnitude (b = -0.97, 95% CI = [-1.74, -0.20], p = 0.014). In contrast, no significant effort effects were observed for participants with high discounting rates at either high (b = -0.45, 95% CI = [-0.97, 0.08], p = 0.098) or low (b = -0.16, 95% CI = [-0.69, 0.38], p = 0.564) reward magnitudes, nor for participants with low discounting rates at low reward magnitude (b = 0.14, 95% CI = [-0.64, 0.92], p = 0.729). These results suggest that the justification mechanism observed for self-benefiting effort appears absent for other-benefiting effort. Instead, we observed a persistent effort discounting before, during, and after effort expenditure, which was most pronounced in individuals with low effort sensitivity (low K) when reward magnitude was high. This seemingly paradoxical pattern might be interpreted through the lens of disadvantageous inequity aversion (Fehr & Schmidt, 1999). Specifically, the combination of high personal effort and high monetary reward for another person creates a salient disparity between the participant’s incurred cost and the recipient’s gain. Although low-K individuals are behaviorally willing to tolerate this cost, their neural valuation system may nonetheless track the “unfairness” of this asymmetry, thereby attenuating the neural reward signal (Tricomi et al., 2010). These insights suggest that facilitating prosocial behavior may require not just lowering costs, but potentially framing outcomes to trigger the effort justification mechanisms that drive the effort paradox observed in self-benefiting acts (Inzlicht & Campbell, 2022).

      To confirm this four-way interaction, we also replaced the high-effort choice proportions in the decision-making task and observed a similar four-way interaction among recipient, effort, magnitude, and high-effort choice proportions (b = -0.58, p = 0.014; see Table S1 for detailed regression estimates). Together, this cross-task analysis not only provides a more comprehensive understanding of the mechanisms at play but also justifies the inclusion of the prosocial decision-making task. We sincerely thank Reviewer #3’ for this valuable suggestion, which has significantly strengthened our manuscript. We have included this analysis (page 16, para. 2; page 17, paras. 1–2) and discussed the results (page 20, para. 2, lines 10–15; page 20, para. 3; page 21, para. 1, lines 1–8) in the revised manuscript.

      Aronson, E., & Mills, J. (1959). The effect of severity of initiation on liking for a group. The Journal of Abnormal and Social Psychology, 59(2), 177-181. https://doi.org/10.1037/h0047195

      Fehr, E., & Schmidt, K. M. (1999). A theory of fairness, competition, and cooperation. The Quarterly Journal of Economics, 114(3), 817-868. http://www.jstor.org/stable/2586885

      Tricomi, E., Rangel, A., Camerer, C. F., & O'Doherty, J. P. (2010). Neural evidence for inequality-averse social preferences. Nature, 463(7284), 1089-1091. https://doi.org/10.1038/nature08785

      (3) Success Rate and Model Structure: The manuscript does not clearly report the success rate in the prosocial effort task. If success rates are low, risk aversion could confound the results. Additionally, it is unclear whether the models accounted for successful versus unsuccessful trials or whether success was included as a covariate. If this information is present, it needs to be explicitly clarified. The exclusion criteria for unsuccessful trials in both tasks should also be detailed. Moreover, the decision to exclude electrodes as independent variables in the models warrants an explanation.

      We appreciate the opportunity to clarify these points. In the revised manuscript, we have now explicitly reported the descriptive statistics and the results of a mixed-effects logistic model on response success in the revised manuscript (page 8, para. 1, lines 2–4; Supplementary Table S1). Participants achieved similarly high success rates in both self (M = 97%) and other trials (M = 96%; Figure S3). As shown in Table S2, success rates decreased as effort increased (b = -4.77, p < 0.001). However, no other effects reached significance (ps > 0.245). These near-ceiling success rates indicate strong task engagement and effectively rule out risk aversion as a potential confound.

      Regarding model structure, we excluded unsuccessful trials from statistical analyses because they were rare and distributed equally across conditions. Given the near-ceiling performance, we did not include success rate as a covariate, as it offers limited variance.

      Finally, we did not include electrodes as an independent variable because our hypotheses focused on condition effects rather than topographic differences. Following established research (e.g., Krigolson, 2018; Proudfit, 2015), we averaged RewP amplitudes across a frontocentral cluster (FC3, FCz, and FC4) and P3 amplitudes across a parietal cluster (P3, Pz, and P4), where activity is typically maximal. Averaging across these theoretically grounded clusters improves the signal-to-noise ratio and provides more reliable estimates of the underlying components. We have explicitly included this rationale in the revised manuscript, which reads, “Data were averaged across the selected electrode clusters to improve signal-to-noise ratio and reliability” (page 27, para. 1, lines 9–10).

      Proudfit, G. H. (2015). The reward positivity: From basic research on reward to a biomarker for depression. Psychophysiology, 52(4), 449-459. https://doi.org/10.1111/psyp.12370

      Krigolson, O. E. (2018). Event-related brain potentials and the study of reward processing: Methodological considerations. Int J Psychophysiol, 132(Pt B), 175-183. https://doi.org/10.1016/j.ijpsycho.2017.11.007

      (4) Prosocial Decision Computational Modelling: The prosocial decision task largely replicates prior behavioural findings but misses the opportunity to directly test the hypotheses derived from neural data in the prosocial effort task. If the authors propose a paradoxical effect of effort on self-rewards and an inverse effect for prosocial effort, this could be formalised in a computational model. A model comparison could evaluate the proposed mechanism against alternative theories, incorporating the complex interplay of effort and reward for self and others. Furthermore, these parameters should be correlated with neural signals, adding a critical layer of evidence to the claims. As it is, the inclusion of the prosocial decision task seems irrelevant.

      We thank Reviewer #3 for this thoughtful suggestion regarding the value of computational modelling. We fully agree that formalizing mechanisms is crucial, but we would like to clarify why a computational model of decision-making cannot directly capture the paradoxical after-effects observed in our neural data. The paradoxical after-effect of effort exertion we report refers to experienced utility (i.e., how prior costs modulate the hedonic consumption of a reward), whereas the decision task measures decision utility (i.e., how prospective costs and benefits are integrated to guide choice). We included the prosocial decision task to establish a behavioral baseline and replicate the well-documented phenomenon of prosocial apathy. Consistent with prior work (e.g., Lockwood et al., 2017; Lockwood et al., 2022), our data show that at the decision stage (ex-ante), effort functions as a universal cost: participants discounted rewards for both self and others, differing only quantitatively (steeper discounting for others). It is only after effort is exerted (ex-post) that the pattern reverses: effort is valued for self but remains costly for others, representing a qualitative shift. Crucially, incorporating a "paradoxical valuation" parameter (i.e., effort as a reward) into our decision model would mathematically contradict the behavioral reality. Since participants actively avoided high-effort options, a model assuming effort adds value might fail to fit the choice data. The theoretical novelty of our study lies precisely in this temporal dissociation: whereas self-benefiting effort paradoxically enhances reward valuation, other-benefiting effort induces a persistent reward devaluation.

      To address the reviewer’s interest in bridging these two domains, we examined whether these distinct stages are linked at the level of individual differences. We hypothesized that an individual’s sensitivity to prospective effort cost (discounting rate K) might modulate their susceptibility to the retrospective neural after-effect. As detailed in our Responses to Reviewer #3’s point 2, we found that for self-benefiting trials, high-discounting individuals showed an effort-enhancement effect on the RewP at low reward magnitude, while for other-benefiting trials, low-discounting individuals exhibited effort-discounting effects at high reward magnitude. We sincerely thank Reviewer #3’ for this valuable suggestion, which has successfully correlated the two tasks and facilitated our understanding of the mechanisms at play.

      Lockwood, P. L., Hamonet, M., Zhang, S. H., Ratnavel, A., Salmony, F. U., Husain, M., & Apps, M. A. J. (2017). Prosocial apathy for helping others when effort is required. Nat Hum Behav, 1(7), 0131. https://doi.org/10.1038/s41562-017-0131.

      Lockwood, P. L., Wittmann, M. K., Nili, H., Matsumoto-Ryan, M., Abdurahman, A., Cutler, J., Husain, M., & Apps, M. A. J. (2022). Distinct neural representations for prosocial and self-benefiting effort. Curr Biol, 32(19), 4172-4185 e4177. https://doi.org/10.1016/j.cub.2022.08.010.

      (5) Contradiction Between Effort Perception and Neural Results: Participants reported effort as less effortful in the prosocial condition compared to the self condition, which seems contradictory to the neural findings and the authors' interpretation. If effort has a discounting effect on rewards for others, one might expect it to feel more effortful. How do the authors reconcile these results? Additionally, the relationship between behavioural data and neural responses should be examined to clarify these inconsistencies.

      This point aligns with the issues raised in Reviewer #1’s point 2. We acknowledge the apparent discrepancy between lower reported effort in the prosocial condition and the neural discounting effect. As detailed in our Responses to Reviewer #1’s point 2, we reconcile this by proposing that subjective effort ratings in this paradigm likely reflect motivational engagement (e.g., “how hard I tried” or “how willing I was”) rather than perceived task demands. Under this interpretation, the lower effort ratings for others reflect a withdrawal of engagement (consistent with prosocial apathy), which conceptually aligns with, rather than contradicts, the neural discounting effect. To validate this, we contrasted effort ratings with difficulty ratings (a more reliable index of objective demand). Our correlational analysis revealed no significant relationship between difficulty and effort ratings (r = -0.21, p = 0.196), suggesting that they capture distinct constructs. Furthermore, liking ratings were negatively correlated with difficulty ratings (r = -0.43, p = 0.011) but not with effort ratings (r = 0.32, p = 0.061), further dissociating the two measures. Crucially, as detailed in our Responses to Reviewer #1’s Recommendations point 5, our RewP effects remained significant even after controlling for individual effort ratings. This demonstrates that the neural effort-discounting effect for others is a physiological signature that operates independently of the subjective report bias.

      (6) Necessary Revisions to Manuscript: If the authors address the issues above, corresponding updates to the introduction and discussion sections could strengthen the narrative and align the manuscript with the additional analyses.

      We thank Reviewer #3 for the above insightful and helpful comments. We have carefully addressed these issues raised above and have updated the manuscript accordingly, including abstract, introduction, result, and discussion sections.

      Recommendations for the Authors:

      Reviewer #1 (Recommendations for the authors):

      Major comments:

      (1) The two biggest concerns I have are

      - Whether the mixed-effect models are properly specified, and

      - Whether the main interaction between the Recipient and effort on the reward positivity (RewP) reflects different levels of effort exertion when working for self versus others.

      We thank Reviewer #1 for identifying these two critical issues. We have carefully considered these points and conducted additional analyses to address them. Below, we provide a detailed response to each concern, explaining how we have improved the model specification and ruled out alternative interpretations regarding effort exertion.

      (2) On the first point, I noticed that the authors selectively excluded random effects for Effort and Magnitude when regressing RewP on Effort, Magnitude, Recipient, and Valence. This is important because the key result in the paper is a fixed effect two-way interaction between Recipient and Effort and a three-way interaction between Recipient, Effort, and Magnitude. It is not clear that these results will remain significant when Effort and Magnitude are included as random effects in the model. Thus the authors should justify their exclusion as random effects, and/or show that the results don't depend on including those random effects in the model. The same logic applies to the specification of other mixed effects models (e.g. the effect of Magnitude in the model predicting RTs).

      We thank Reviewer #1 for raising this important methodological point. We fully agree that including random slopes wherever possible reduces Type 1 error rates and yields more conservative tests of fixed effects. In our analyses, we determined the random effects structure for each model using singular value decomposition (SVD). Specifically, we began with a maximal model that included by-participant random slopes for all main effects and interactions as well as a participant-level random intercept. When the model failed to converge or yielded a singular fit, we applied SVD to identify redundant dimensions (i.e., components explaining zero variance) and iteratively removed these terms until convergence was achieved. This procedure allowed us to retain the maximal converging random-effects structure while ensuring model stability. We have clarified this procedure in the revised manuscript as follows, “For each model, we fitted the maximal random-effects structure and, when the model was overparameterized, used singular value decomposition to simplify the random-effects structure until the model converged” (page 28, para. 1, lines 5–8).

      Regarding the RewP model, including all variables (i.e., Recipient, Effort, Magnitude, and Valence) in the random-effects structure resulted in a boundary (singular) fit. Examination of the variance-covariance structure of the random effects revealed that the random slopes for Valence and Magnitude were perfectly negatively correlated (r = -1.00), indicating severe overparameterization. In our original submission, we removed the random slopes for Effort and Magnitude because the SVD analysis indicated redundant dimensions in the model structure.

      However, we agree with the Reviewer that retaining slopes for variables involved in key interactions is crucial. Therefore, we re-evaluated the model strategy: instead of removing Effort and Magnitude, we removed the random slope for Valence (which was the primary source of the perfect correlation). This modification successfully resolved the singularity while allowing us to retain the random slopes for the critical variables (i.e., Effort and Magnitude).

      Critically, this updated model yielded the same pattern of results as our original submission: the two-way interaction between Recipient and Effort and the three-way interaction between Recipient, Effort, and Magnitude remained significant (see Table S3). As expected, including the random slopes for Effort and Magnitude yielded a more conservative test of the fixed effects. While the critical three-way interaction remained significant (p = 0.019), the simple slope for the Self condition at high reward magnitude shifted slightly from significant (p = 0.041) to marginally significant (p = 0.056). However, the effect size remained largely unchanged (b = 0.42 vs. original b = 0.43), and the dissociation pattern, where self-benefiting trials show a positive trend while other-benefiting trials show a significant negative slope, remains robust and is statistically supported by the significant interaction. We have adopted this updated model in the revised manuscript and updated the relevant sections accordingly. Finally, note that we have removed the RewP table from the Supplementary Materials because the RewP model results are now presented as a figure in the main text (as suggested by Reviewer #1’s Recommendations point 3).

      We have also carefully verified the random effects structures for other mixed-effects models, including the RT and Performance-P3 models in the prosocial effort task, as well as the decision time and decision choice models in the prosocial decision-making task. The updated information is detailed as follows:

      Regarding the RT model, we replaced it with a more reasonable model of response speed (button presses per second), as suggested by Reviewer #1 (see our responses to Reviewer #1’s Recommendations point 4 for details).

      Regarding the performance-P3 model, the random-effects structure could only support Effort, as in our original submission; thus, the results remain unchanged.

      Regarding the decision time model, we have updated our results to include the quadratic effort term, as suggested by Reviewer #1 (see our responses to Reviewer #1’s Recommendations point 6 for details).

      Regarding the decision choice model, we included Recipient, Effort, and Magnitude in the random-effects structure. As shown in Table S4, the results remain largely consistent with the original model, except for a newly significant interaction between effort and magnitude. Follow-up simple slopes analyses revealed that the discounted effect of effort was more pronounced at low reward magnitude (M − 1SD: b = -2.69, 95% CI = [-3.09, -2.29], p < 0.001) than at high reward magnitude (M + 1SD: b = -2.38, 95% CI = [-2.82, -1.94],p < 0.001).

      In summary, we have improved the model specification following Reviewer #1’s suggestion. Crucially, the results remain qualitatively consistent with our original findings. We have updated the Results section, figures (Figures 2, 4, and 5), and OSF documents (including a new R Markdown file and an HTML output file detailing the final results) to reflect these analyses. Additionally, we have explicitly stated the method used for calculating p-values in the mixed-effects models (page 28, para. 1, lines 8–10), which was omitted in the original submission.

      (3) Regarding the mixed models, it would also be good to show a graphical depiction summarizing key effects (e.g. the Recipient by Effort interaction on RewP) rather than just showing the predictions of the fitted mixed effects models.

      This point is well-taken. Please see Figure S4, which visualizes the key effects and has now been included in the revised manuscript as Figure 4A.

      (4) Finally, regarding the mixed effect models of RTs - given the common finding that RTs are not normally distributed, the Authors might be better off regressing 1/RT (interpreted as speed rather than latency) since 1/RT will often make distributions less asymmetric and heavy-tailed.

      We thank Reviewer #1 for this helpful suggestion regarding data distribution. In our original analysis, the dependent variable was “completion time” (i.e., the latency to complete the required button presses with the 6-s window). We agree that these raw latency data exhibited characteristic non-normality (see Figure S5, Left). Based on Reviewer #1’s suggestion, we adopted “response speed” (calculated as button presses per second) as the dependent variable. As expected, this transformation substantially improved the normality of the distribution (see Figure S5, Right). We have refitted the mixed-effects model using this speed metric. Critically, the results largely replicated the patterns observed in our original model, with the exception that the main effect of reward magnitude did not reach significance in the speed model (see Table 5). Given the superior distributional properties of the speed metric, we have replaced the original latency analysis with the response speed model in the revised manuscript. We have updated the Results section (page 8, para. 1, lines 4–9) and Figures 2B–C accordingly.

      (5) Regarding the level of effort exerted, there are two reasons to suspect that participants exerted less for others versus themselves. The first is that they were slower to complete the button pressing for others versus themselves. The second is that they reported paradoxically less subjective effort for others versus self (paradoxical because they also reported liking the task less for others versus self). The explanation for both may be that they exerted less effort for others versus self and this has important implications for interpreting the main effects. If they exerted less effort for others, this may partly account for the key Recipient:Effort and Recipient:Effort:Magnitude interactions in the mixed effects regression of RewP. Do either median effort durations or self-reported effort predict the magnitude of the Recipient:Effort and Recipient:Effort:Magnitude interactions (if these were included as random effects)? If so, that would provide evidence supporting this story. Alternatively, if median durations or self-reported effort were included as covariates, do these interactions still obtain? In any case, the Authors should include caveats regarding this potential explanation of the self-versus-other interactions with effort and magnitude on the RewP" (or explain why this can not explain the interactions).

      We thank Reviewer #1 for raising this important interpretational issue. We acknowledge the concern that differences in physical exertion or perceived effort could potentially confound the neural findings. However, we argue that the observed RewP effects are not driven by these factors for several reasons.

      First, the prosocial effort task enforced fixed effort thresholds (10%–90% of their maximum effort level) across self-benefiting and other-benefiting trials. Importantly, participants achieved ceiling-level success rates that were highly comparable between self-benefiting (97%) and other-benefiting (96%) trials, indicating that they successfully exerted the required effort across conditions.

      Second, regarding the slower response speed for others (we used response speed instead of completion time, as the former is more suitable for statistical analysis; see details in Responses to Reviewer #1’s Recommendations point 4), we interpret this as a reduction in motivation rather than a reduction in the amount of effort exerted. Similarly, as detailed in our Responses to Reviewer#1’s point 2, subjective effort ratings in this paradigm appear to be influenced by demand characteristics and do not reliably track physical exertion. For instance, liking ratings were associated with difficulty (r = -0.43, p = 0.011) instead of effort (r = 0.32, p = 0.061) ratings.

      To empirically rule out the possibility that these behavioral differences account for the neural effect, we followed the reviewer’s suggestion and re-ran the mixed-effects model predicting RewP amplitudes with trial-by-trial response speed and subjective effort rating included as covariates. These control analyses revealed that neither response speed (b = -0.07, p = 0.614) nor self-reported effort (b = 0.10, p = 0.186) significantly predicted RewP amplitudes (see Table S6). Most importantly, the key interactions of interest (Recipient × Effort and Recipient × Effort × Magnitude) remained significant and virtually unchanged. These findings suggest that the observed neural after-effects of prosocial effort are not driven by variations in motor execution or perceived effort.

      Minor comments:

      (6) In Figure 5A a quadratic effect (not a linear effect) seems fairly obvious in decision times as a function of effort level. This makes sense given that participants are close to indifference, on average, around the 50-70% effort level. I recommend fitting a model that has a quadratic predictor and not just a linear predictor when regression decision times on effort levels.

      We thank Reviewer #1 for this insightful suggestion. We agree that decision times likely track decision conflict, which typically peaks near indifference points (e.g., moderate effort levels). Accordingly, we reanalyzed the decision time data using a mixed-effects model that included both linear and quadratic terms for effort. As detailed in Table S7, this analysis revealed a significant quadratic main effect of effort, which was further qualified by a significant interaction between the quadratic effort term and reward magnitude. Decomposition of this interaction (Figure S6) revealed that the quadratic effort effect was more pronounced at low reward magnitude (M − 1SD: b = -160.10, 95% CI = [-218.30, -101.90], p < 0.001) than at high reward magnitude (M + 1SD: b = -99.50, 95% CI = [-157.60, -41.40], p = 0.001). However, we found no significant interactions involving the quadratic effort term and recipient. We have updated the Results section (page 13, para. 2; page 14, para. 1) and Figures 5A–B (right panel) to reflect these findings.

      (7) The distinction between the effort and decision-making tasks wasn't super clear from the main text. A sentence early on in the results section could be useful for readers' understanding.

      This point is well taken. In the revised manuscript, we have clarified this distinction at the beginning of the Results section (page 6, para. 2, lines 1–10). In addition, we have explicitly indicated the corresponding task within each subsection heading in the Results:

      “2.1 Investing effort for others is less motivating than for self in the prosocial effort task” (page 7)

      “2.2 Effort adds reward value for self but discounts reward value for others in the prosocial effort task” (page 9)

      “2.3 Reward is devalued by effort to a higher degree for others than for self in the prosocial decision-making task” (page 13)

      (8) To what does "three trials" refer to on lines 143-144?

      Thank you for raising this point. Participants completed three trials in which they were asked to press a button as rapidly as possible with their non-dominant pinky finger for 6000 ms. The maximum effort level was operationalized as the average button-press count across the three trials. To improve clarity, we have also provided more detailed description in the Results section, which reads: “The mean maximum effort level (i.e., the average button-press count across three 6000-ms trials; see Procedure for details) ….” (page 7, para. 1, lines 1–2).

      (9) It is unclear how the authors select their time windows for ERP analyses.

      We thank Reviewer #1 for this comment. Measurement parameters (i.e., time windows and channel sites) were determined based on the grand-averaged ERP waveforms and topographic maps collapsed across all conditions. This procedure is orthogonal to the conditions of interest and prevents bias in the selection of measurement windows and channels, consistent with the “orthogonal selection approach” (Luck & Gaspelin, 2017). We have clarified this point in the revised manuscript, which now reads, “Measurement parameters (time windows and channel sites) were determined from the grand-averaged ERP waveforms and topographic maps collapsed across all conditions, which was thus orthogonal to the conditions of interest (Luck & Gaspelin, 2017)” (page 27, para. 1, lines 6–9).

      Luck, S., & Gaspelin, N. (2017). How to get statistically significant effects in any ERP experiment (and why you shouldn't). Psychophysiology, 54(1), 146-157.

      (10) There are a few typos throughout. For example, Line 124 should read "other half benefitted...", Line 127 should read "interest at each effort level...", "following" on Line 369, and Supplemental table titles incorrectly spell the word "Results".

      We thank Reviewer #1 for catching these errors. We have corrected all the specific typos noted (page 6, para. 2, lines 11 and 15; page 22, para. 3, line 2; Supplementary Table S2). Furthermore, we have conducted a thorough proofreading of the entire text and supplementary materials to ensure linguistic accuracy and consistency throughout the manuscript.

      Reviewer #2 (Recommendations for the authors):

      Minor comments:

      (1) Lines 84-86. "The RewP ... has its neural sources in the anterior cingulate cortex (Gehring & Willoughby, 2002) and ventral striatum (Foti et al., 2011)." This is a better reference for the ACC source: https://pubmed.ncbi.nlm.nih.gov/23973408/. And perhaps remove the reference to the ventral striatum; most people would agree that activity in the ventral striatum cannot be measured with scalp EEG.

      We thank Reviewer #2 for providing the updated reference, which has been cited in the revised manuscript. We agree that activity in the VS cannot be reliably measured with scalp EEG and thus have removed the reference to the VS. The revised sentence now reads, “… has its neural sources in the anterior cingulate cortex (Gehring & Willoughby, 2002; Hauser et al., 2014)” (page 4, para. 2, lines 12–13).

      (2) Lines 152-153. What exactly is shown in Figure 2A? How did the authors average across subjects?

      We thank Reviewer #2 for raising this issue. Figure 2A depicts the distribution of the maximum effort level, defined as the average button-press count across three 6000-ms trials completed before the prosocial effort task. In these trials, participants were instructed to press the button as rapidly as possible with their non-dominant pinky fingers. To improve clarity, we have revised the figure caption as: “(A) Distribution of the maximum effort level (i.e., the average button-press count across three 6000-ms trials) across participants” (Figure 2).

      (3) Lines 160-164. "As expected (Figure 2D), participants perceived increased effort as more difficult ... and more disliking (b = -0.62, p < 0.001) when the beneficiary was others than themselves." Does this sentence describe the main effect of the beneficiary or the interaction between beneficiary and effort level, as the start of the sentence ("increased effort") suggests?

      We thank Reviewer #2 for pointing out this ambiguity. The sentence describes the main effect of beneficiary rather than the interaction between beneficiary and effort level. In the revised manuscript, we have rephrased the sentence as: “They felt less effort (b = -0.32, p = 0.019) and more disliking (b = -0.62, p = 0.001) for other-benefiting trials compared to self-benefiting trials” (page 9, para. 1, lines 4–6).

      (4) Lines 195-196. "..., we conducted post-hoc simple slopes analyses at -1 SD ("Low") and + SD ("High") reward magnitude." I did not understand what the authors meant with these reward magnitudes, given that the actual potential rewards were ¥0.2, ¥0.4, ¥0.6, ¥0.8, and ¥1.0.

      In our analyses, the actual reward magnitudes (¥0.2, ¥0.4, ¥0.6, ¥0.8, and ¥1.0) were z-scored and entered as a continuous regressor in the mixed-effects models. Post-hoc simple slopes analyses were then conducted at ±1 SD from the mean of the z-scored reward magnitude. To clarify, we have revised the sentence as “… we conducted post-hoc simple slopes analyses at 1 standard deviation (SD) below (“Low”) and above (“High”) the mean reward magnitude” (page 11, para. 2, lines 8–9). This standard method for testing simple effects for continuous predictors is recommended by Aiken and West (1991). Aiken, L. S., West, S. G., & Reno, R. R. (1991). Multiple regression: Testing and interpreting interactions. Sage.

      (5) Lines 253 and 275. I would not call this a computational model. The authors fit a curve to data, there is no model of the computations involved.

      This point is well taken. We have replaced “computational model” with “discounting” (Figure 5) and “parabolic discounting model” (page 15, para. 1, line 15).

      (6) Line 710. Figure S1 does not show topographic maps of the P3, as the figure caption suggests.

      We thank Reviewer #2 for identifying this oversight. We have now included topographic maps of the P3 in Figure S1.

      (7) Please check language in lines 33 (effect between), 38 (shape), 49 (highest cost form?), 74 (tunning), 90 (omit following), 127 (interest on at each effort level), 135 (press buttons >> rapidly press a button?), 142 (motivated), 219 (should low be high?), 265-266 (missing word), 275 (confirmed by following), 292 (an action can be effortful, a feeling cannot), 315 (when it comes into), 330-331 (data is plural; the aftereffect of prosocial effect), 387 (interest on at each effort level), 405 (should quickly be often?).

      We thank Reviewer #2 for the careful review and feedback about these language issues. We have revised all the phrasing you identified. The corrections are as follows:

      Line 33: “effect between” has been changed to “effects for” (page 2, para. 1, line 6).

      Line 38: “shape” has been updated to “shapes” (page 2, para. 1, line 13).

      Line 49: “highest cost form?” has been revised to “the most common cost type” (page 3, para. 1, lines 7–8).

      Line 74: “tunning” has been corrected to “tuning” (page 4, para. 2, line 1).

      Line 90: omit following. Done (page 5, para. 1, line 2).

      Line 127: “interest on at each effort level” has been corrected to “liking for each effort level” (page 6, para. 2, line 15).

      Line 135: “press buttons” has been updated to “rapidly press a button” (the caption of Figure 1).

      Line 142: “motivated” has been revised to “motivating” (page 7).

      Line 219: should low be high? Yes, we have corrected this (the caption of Figure 4).

      Lines 265–266: The missing word “with” has been inserted (page 15, para. 1, line 2).

      Line 275: “confirmed by following” has been revised as “corroborated by a parabolic …” (page 15, para. 1, line 15).

      Line 292: an action can be effortful, a feeling cannot. We have changed the word “effortful” to “effort” (page 18, para. 2, line 3).

      Line 315: “when it comes into” has been revised to “when it came to” (page 19, para. 1, line 10).

      Lines 330–331: These two expressions have been revised to “our data establish …” and “the after-effect of prosocial effort” (page 20, para. 1, lines 2–3).

      Line 387: “interest on at each effort level” has been corrected to “interest at each effort level” (page 23, para. 2, line 5).

      Line 405: should quickly be often? We agree that “quickly” might imply latency or speed of a single press, whereas the task required maximizing the frequency of presses within the time window. To capture this meaning accurately, we have revised the phrase to “pressed a button as rapidly as possible” (implying repetition rate) in the revised manuscript (page 24, para. 2, lines 3–4).

    1. con diferencias de estructura, nomenclaturas no homogéneas, vacíos derivados de celdas combinadas, duplicados operativos, filas separadoras o sin contenido analítico y codificaciones de indicadores que no eran directamente comparables entre sí.

      acá punto seguido. Y bajar el tono, tipo: Una revisión preliminar de estos archivos hizo evidente la necesidad de armonizar y consolidar una base de datos que permitiera los análisis solicitados

    2. A ello se suma que la base final no presenta duplicados globales ni de row_uid ni de row_id, que no registra faltantes globales en los campos esenciales module, pais, documento y cita, y que los indicadores quedaron contenidos dentro del dominio esperado, sin valores inválidos fuera de {0,1,NA}.

      Para hablar de estos códigos se deberían anticipar o dejar esta parte de la explicación para el texto extendido y no aquí en el resumen ejecutivo. Propongo sacar esta parte del resumen. Este párrafo inciaría en: En materia de completitud...

    3. La base master constituye el insumo principal para el análisis cuantitativo, mientras que la tabla notes se mantuvo como una estructura auxiliar alineada registro a registro. Esta correspondencia uno a uno asegura que, cuando existe información textual o complementaria asociada a una observación, ésta pueda vincularse sin desalineación con la fila analítica correspondiente. No obstante, dado que notes no contiene contenido sustantivo en todos los casos, su valor en esta etapa radica principalmente en la conservación ordenada de esa estructura paralela, más que en aportar evidencia cualitativa completa para cada registro.

      Esta explicación no es necesaria. Dejaría sólo:

      El resultado final fue una base maestra de 7.410 filas, que corresponde al número de citas disponibles en los once modulos temáticos. La base consolidada tiene una unidad de análisis explícita: cada fila corresponde a una evidencia o cita curricular específica ubicada en un documento, módulo y página determinados, organizando la evidencia curricular bajo una estructura común. Sobre esa unidad de análisis se articulan variables núcleo, variables de trazabilidad e indicadores recodificados.

    1. Seamos sinceros, muchos estudiantes se quejarán de que tu curso no usa Python. ¡Pues aprender a Julia también es una excelente forma de aprender Python!

      Personalmente es muy acertado lo que se comenta ya que en ciertos ecosistemas digitales se impone Python o simplemente no se utiliza , teniendo en cuenta estas herramientas nos podemos desenvolver mucho mejor en entornos de programación

    2. Julia users are much more likely to contribute to open source projects

      Así mismo como pasa en la ciencia, la comunidad de los diferentes lenguajes de programación (en este caso Julia) busca hacer una integración a partir de proyectos de código abierto en colaboración de sus mismos usuarios o comunidad, lo cual genera proyectos de un gran potencial y desarrollo desde el mismo. Tal cual como cuando hay un proyecto de cualquier tipo (ya sea videojuego, herramienta, u otro) en línea y eso apoyado desde los mismos interesados o comunidad.

    3. tools for advanced users, but that a lot can be done to make programming more accessible to beginners.

      Me llama la atención la idea de que estén enfocados a un público principiante, puesto a que si considero muy cierto que hay suficientes herramientas avanzadas para usuarios avanzados, sin embargo es importante enfocarse en aquellos que son principiantes en el campo, o ¿que herramientas de programación accesible conocen?

    4. Facilitamos

      La idea de facilitar y ser amigable con la tematica de programación y a la vez exploración es interesante, pues muchas de las cosas a las que les tenemos miedo es por la forma en que nos acercamos por primera vez a ello, si ruvimos un evento traumante en la programación nos cerramos al aprendizaje del tema, si se facilita o se convierte algo que esta en chino a un lenguaje amigable podemos aprender y aportar sobe este campo.

    1. El impulso inicial detrás de Julia fue el deseo de un lenguaje de programación que combinara elementos de la funcionalidad de alto nivel de MATLAB y R con la velocidad de C o Ruby, como lo expresó Karpinski

      Esto es bastante real, ya que la mayoría de lenguajes de programación nacen de una necesidad.

    2. Como muchos cambios revolucionarios en la historia de la humanidad, comenzó con un arrebato de frustración.

      Cuando algo interrumpe lo que es conocido es como si en medio de un engranaje le pusieran un gran obstáculo eso hace que todo cambie de camino o ritmo. Puede resultar en un primer momento molesto o aturdidor peor es fundamental para tener un cambio, una nueva visión.

    1. Del mismo modo, los residuos no binarios que no podían interpretarse de manera defendible como presencia o ausencia fueron preservados como NA.

      Ejemplo, ¿en cuantos casos ocurre?

    2. La heterogeneidad del corpus no era un problema meramente estético o de formato.

      Propongo: El corpus orginal presenta una alta heterogeneidad entre archivos. En la práctica,...

    3. Desde el punto de vista analítico, mantener los insumos tal como estaban implicaba varios riesgos

      Desde el punto de vista analítico, mantener los insumos originales implicaba una serie de consecuencias. Primero, sobreconteo o subconteo: si existían duplicados no resueltos o filas separadoras tratadas como observaciones reales, los descriptivos y frecuencias podían distorsionarse. Segundo, pérdida de trazabilidad: si no existía una llave operativa estable para seguir cada registro a través de las distintas transformaciones, se debilitaba la posibilidad de auditar el proceso completo. Tercero, la posibilidad de comparación inválida: si los indicadores no compartían un dominio común o si columnas análogas estaban definidas de forma distinta entre módulos, cualquier intento de producir síntesis comparables podía volverse metodológicamente frágil. Finalmente, opacidad: incluso si el procesamiento lograba “funcionar”, sin documentación explícita de las decisiones sería difícil defender por qué determinadas reglas fueron aplicadas y otras descartadas.

    1. H

      La posibilidad de que internet algún día pueda transformar los gobierno lleva a la pregunta de cómo democratizar la información o el acceso a ella. Y esta cuestión de la posibilidad del codigo abierto tambien lleva a la pregunta por la desigual en el acceso a las herramientas que podrian hacer el mundo mas democratico y vivble para todos. Entretanto, el desafio de la educación y la pedagogica sería justamente ese: entregar a los educando, de la manera mas completa y perfecta la mayor cantidad de herramientas posibles para transformar sus vidas y sus entornos, sobre todo alli donde mas falta hace.

    1. There was no answer, and she continued in a trembling voice: “I went to get those powders I’d put away in father’s old spectacle-case, top of the china-closet, where I keep the things I set store by, so’s folks shan’t meddle with them—” Her voice broke, and two small tears hung on her lashless lids and ran slowly down her cheeks. “It takes the stepladder to get at the top shelf, and I put Aunt Philura Maple’s pickle-dish up there o’ purpose when we was married, and it’s never been down since, ’cept for the spring cleaning, and then I always lifted it with my own hands, so’s ’t it shouldn’t get broke.” She laid the fragments reverently on the table. “I want to know who done this,” she quavered.

      represents Zeenas and Ethan's marriage breaking.

    1. “seres vivos que viven temporal o permanentemente en la superficie o en el in- terior de otros seres vivos (por lo general de mayor tamaño) de otra especie a la cual le producen daño en mayor o menor gra- do (o tienen la potencialidad de provocar daño)”

      Def. de parasito

    1. GLAM

      Trobo a faltar l'anomenar el domini públic català. El domini públic no son "llicències obertes", sinó, més aviat contingut amb drets morals exhaurits i, per tant moltes vegades més obert que les llicències amb restriccions d'embargo o de restriccions comercials.

    2. Cohesionar nous agents del coneixement i les tecnologies lliures, de manera que puguin vehicular els seus espais de trobada, confluència i col·laboració en els projectes Wikimedia.

      Que vol dir "nou agents"? Suposso que és gent de llocs com a Free Software Barcelona, però sense una referència directa, no sé si son només les participants d'aquest grup o si hi ha d'altres.

    3. Diversitat: Prestar suport en activitats que tinguin el focus en regions i comunitats de fora d’Europa occidental, tradicionalment menys representades, per trencar amb les bretxes de continguts.

      Em sembla molt interessant aquesta proposta, per exemple de cara a la poca, o fins i tot nula participació de catalanoparlans a espais com a Wikimania.

    4. Rellançar viquiprojectes vinculats a comunitat LGBTIQA+ i estabilitzar-los. Treballar per a una major cohesió i la creació d'espais segurs.

      És interessant perquè entenc que aquesta iniciativa, si es mesura amb indicadors, va caure en el pla anterior. Com que no tenim indicadors, no es pot veure què tan bé o malament implica el "Rellançar". Pot ser s'ha fet una primera acció, que va anar molt bé i aquí busquem continuitat, o potser que teniem una bona quantitat de viquiprojectes LGBTQIA+ i van desapareixer, que seria catastròfic. Sense indicadors, no sabem.

    5. Fomentar les trobades presencials com la Viquitrobada, punts presencials d'edició i trobades puntuals més llargues amb els viquipedistes per tal de teixir noves aliances i enfortir la comunitat editora. La salut de la comunitat és un punt clau en aquesta estratègia.

      Hi ha un protocol, procés o cap pas a pas per les aliances? Penso per exemple en si hem de fer un conceni amb el Centre Cívic Palmira Domènech, per institucionalitzar el Punt d'edició El Prat, perquè fer-ho pot ajudar a les participants, encara que no sigui amb pagaments de diners.

    6. Definició de les noves dinàmiques

      M'agrada que tenim les dinàmiques, però m'agradaria tenir accés a indicadors. Per exemple: saber si abans hem assolit un indicador i creixem en aquest nou cicle o si és crític i hem de pujar un indicador que abans estava malament.

  2. www.planalto.gov.br www.planalto.gov.br
    1. processo de responsabilização

      Processo de Responsabilização

      • Comissão de <u>2 ou +</u> servidores estáveis conduzem o processo. Se empregados, devem pertencer ao quadro permanente com pelo menos 3 anos de tempo de serviço;

        • Obs.: Não confundir com quantidade de membros da comissão de contratação, que contará com 3 servidores.
      • Prazo de 15 dias úteis para contestação;

      • Prazo de 15 dias úteis para alegações finais;
      • Se houver atos ilícitos previstos na Lei Anticorrupção, deverá haver apuração conjunta no mesmo processo.
      • Aplicação de sanção de declaração de inidoneidade para contratar e licitar é de competência exclusiva de Ministro de Estado/Secretário do Estado;
      • Contra aplicação de declaração de inidoneidade para contratar e licitar somente cabe pedido de reconsideração no prazo de 15 dias úteis;
      • Prazo recursal é de 3 dias úteis;
      • Tanto recurso, quanto pedido de reconsideração terão efeito suspensivo.
    2. Art. 95
      • O uso do contrato é a regra para as contratações públicas. No entanto, admite-se exceções.

      • As exceções são: contratação por dispensa de licitação e compra de entrega imediata e integral.

    3. direito privado

      JURISPRUDÊNCIA EM TESES - EDIÇÃO Nº 160 - DIREITO DO CONSUMIDOR - IV

      • 8) O Código de Defesa do Consumidor - CDC, em regra, é inaplicável aos contratos administrativos, tendo em vista as prerrogativas já asseguradas pela lei à administração pública.

      • 9) Em situações <u>excepcionais</u>, a administração pública pode ser considerada consumidora de serviços (art. 2º do CDC) por ser possível reconhecer sua vulnerabilidade, <u>mesmo em relações contratuais regidas, preponderantemente, por normas de direito público</u>, e por se aplicarem aos contratos administrativos, de forma supletiva, as normas de direito privado (art. 54 da Lei n. 8.666/1993).

      • 10) O Código de Defesa do Consumidor é inaplicável a contrato acessório de contrato administrativo, pois não se origina de uma relação de consumo.


      • Por essa previsão, também é pertinente destacar que será possível o emprego da compensação pela Administração Pública em contratos administrativos, a despeito da inexistência de prévio ajuste ou de autorização do particular. Nesse sentido:

      • Informativo nº 789

      • 3 de outubro de 2023.
      • SEGUNDA TURMA
      • Compartilhe:
      • Processo: REsp 1.913.122-DF, Rel. Ministro Francisco Falcão, Segunda Turma, por unanimidade, julgado em 12/9/2023, DJe 15/9/2023.

      Ramo do Direito DIREITO ADMINISTRATIVO, DIREITO CIVIL

      TemaPaz, Justiça e Instituições Eficazes <br /> Contrato administrativo. Aplicação supletiva das normas de direito privado. Art. 54 da Lei n. 8.666/1993. Compensação. Possibilidade. Autorização do particular. Prescindibilidade.

      Destaque - É possível a compensação de créditos decorrentes da aquisição de imóveis em contrato administrativo firmado entre empresa pública e particular, mesmo sem autorização deste.

      Informações do Inteiro Teor - No caso, o particular ajuizou ação ordinária com pedido de tutela de urgência, pretendendo reaver valores pagos no contrato de compra e venda do imóvel, considerando que, após a rescisão unilateral do contrato, a empresa pública compensou valores devidos por ele. Sustenta que não requereu nem deu anuência com essa compensação, razão pela qual ela não poderia ocorrer.

      • Quanto à possibilidade de compensação, o art. 54 da Lei n. 8.666/1993 estabelece que as regras do Direito Privado podem ser utilizadas supletivamente no âmbito dos contratos admirativos.

      • À luz dessa previsão legal, é possível que o instituto da compensação, modalidade de extinção das obrigações, seja aplicado ao caso concreto, permitindo-se que a recorrente compense seus débitos com os créditos do particular, na forma prevista no art. 368 do Código Civil.

      • A compensação ocorre quando duas pessoas forem, ao mesmo tempo, credoras e devedoras uma da outra, de modo que as respectivas obrigações se extinguem até onde se compensarem.

      • Nesse contexto, a norma civilista exclui a possibilidade da compensação, somente no caso de mútuo acordo ou quando ocorrer renúncia prévia de uma das partes, na forma prevista no art. 375 do CC.

    4. Art. 84
      • A ata de registro de preço tem validade por 1 ano. Observe que poderá ser prorrogado pelo mesmo período, uma única vez, se comprovado que o preço é vantajoso para a administração
    1. Art. 97

      Esse artigo visa distinguir as acessões das benfeitorias. Vide art. 1.219. Isto é, não serão benfeitorias as melhorias ou intervenções não autorizadas pelo proprietário, detentor ou possuidor.

      No mais, de suma importância distinguir o que é legalmente entendido como acessão e benfeitoria. Nesse sentido, é o REsp 1.109.406 - SE:

      REINTEGRAÇÃO DE POSSE. DIREITO CIVIL. RECURSO ESPECIAL. POSSUIDORA DE MÁ-FÉ. DIREITO À INDENIZAÇÃO. DISTINÇÃO ENTRE BENFEITORIA NECESSÁRIA E ACESSÕES. ALEGADA ACESSÃO ARTIFICIAL. MATÉRIA FÁTICO-PROBATÓRIA. SÚMULA 7/STJ. - 1. As benfeitorias são obras ou despesas realizadas no bem, com o propósito de conservação, melhoramento ou embelezamento, tendo intrinsecamente caráter de acessoriedade, incorporando-se ao patrimônio do proprietário. - 2. O Código Civil (art. 1.220), baseado no princípio da vedação do enriquecimento sem causa, conferiu ao possuidor de má-fé o direito de se ressarcir das benfeitorias necessárias, não fazendo jus, contudo, ao direito de retenção. - 3. Diferentemente, as acessões artificiais são modos de aquisição originária da propriedade imóvel, consistentes em obras com a formação de coisas novas que se aderem à propriedade preexistente (superficies solo cedit), aumentando-a qualitativa ou quantitativamente. - 4. Conforme estabelece o art. 1.255 do CC, na acessões, o possuidor que tiver semeado, plantado ou edificado em terreno alheio só terá direito à indenização se tiver agido de boa-fé. - 5. Sobreleva notar a distinção das benfeitorias para com as acessões, sendo que "aquelas têm cunho complementar. Estas são coisas novas, como as plantações e as construções" (GOMES, Orlando. Direitos reais. 20. ed. Atualizada por Luiz Edson Fachin. Rio de Janeiro: Forense, 2010, p. 81). - 6. Na trilha dos fatos articulados, afastar a natureza de benfeitoria necessária para configurá-la como acessão artificial, isentando a autora do dever de indenizar a possuidora de má-fé, demandaria o reexame do contexto fático-probatório dos autos, o que encontra óbice na Súmula n. 07 do STJ. - 7. Recurso especial a que se nega provimento.

      [...]

      Processo na íntegra:

      • 2.2. Diferentemente, as acessões artificiais são modos de aquisição originária da propriedade imóvel, consistentes em obras com a formação de coisas novas que se aderem à propriedade preexistente (superficies solo cedit), aumentando-a qualitativa ou quantitativamente.

      • É obra nova sobre propriedade imóvel alheia que cria coisa distinta.

      • Deveras, são "construções e plantações que têm caráter de novidade, pois não procedem de algo já existente, uma vez que objetivam dar destinação econômica a um bem que até então não tinha repercussão social. Por seu caráter inovador, são tratados com regras próprias, entre os modos originários de aquisição da propriedade" (FARIAS, Cristiano Chaves; ROSENVALD, Nelson. Direitos Reais. 5ª ed. Rio de Janeiro: Lumen Juris, 2008, p. 98).

      [...]

      • Dessarte, para a solução da controvérsia, sobreleva notar a distinção das benfeitorias para com as acessões, sendo que "aquelas têm cunho complementar. Estas são coisas novas, como as plantações e as construções".

      • Nessa ordem de idéias, Maria Helena Diniz acentua que "não consitui uma acessão a conservação de plantações já existentes, pela substituição de algumas plantas mortas. Esse caso é uma benfeitoria por não haver nenhuma alteração na substância e destinação da coisa. Se fizermos um pomar em um terreno alheio, onde nada havia anteriormente, teremos uma acessão por plantação, que se caracteriza pela circunstância de produzir uma mudança, ainda que vantajosa, no destino econômico do imóvel" (Curso de Direito Civil Brasileiro - Direito das coisas. 17ª ed. São Paulo: Saraiva, 2002, p.137/138).

      • Certo é que o critério de distinção é sutil porque ambas decorrem da intervenção humana, tornando-se muitas vezes delicado o enquadramento de uma obra como acessão ou benfeitoria, exatamente por se encontrarem em uma região fronteiriça.


      RECURSO ESPECIAL. DIREITO CIVIL. OFENSA AO DEVIDO PROCESSO LEGAL. AUSÊNCIA DE PREQUESTIONAMENTO. CONTRATO DE LOCAÇÃO DE IMÓVEL URBANO NÃO RESIDENCIAL. CLÁUSULA DE RENÚNCIA À INDENIZAÇÃO POR BENFEITORIAS. VALIDADE. EXTENSÃO À ACESSÃO. IMPOSSIBILIDADE. RECURSO ESPECIAL PARCIALMENTE CONHECIDO E, NESSA EXTENSÃO, PROVIDO.

      • 1. O propósito recursal consiste em definir se houve ofensa ao princípio do devido processo legal e se a cláusula de renúncia às benfeitorias constante em contrato de locação pode ser estendida às acessões.
      • 2. A questão referente à ofensa ao princípio do devido processo legal não foi debatida pelas instâncias ordinárias, não havendo, portanto, o devido prequestionamento, tampouco arguiu-se ofensa ao art. 1.022 do CPC/2015, o que atrai o óbice das Súmulas 282/STF e 211/STJ.
      • 3. Consoante o teor da Súmula n. 335/STJ, "nos contratos de locação, é válida a cláusula de renúncia à indenização das benfeitorias e ao direito de retenção".
      • 4. Os negócios jurídicos benéficos e a renúncia interpretam-se <u>estritamente</u> (art. 114 do CC). Assim, a renúncia expressa à indenização por benfeitoria e adaptações realizadas no imóvel não pode ser interpretada extensivamente para a <u>acessão</u>.
      • 5. Aquele que edifica em terreno alheio perde, em proveito do proprietário, a construção, mas se procedeu de boa-fé, terá direito à indenização (art. 1.255 do CC). Na espécie, a boa-fé do locatário foi devidamente demonstrada.
      • 6. Recurso especial parcialmente conhecido e, nessa extensão, provido. (REsp n. 1.931.087/SP, relator Ministro Marco Aurélio Bellizze, Terceira Turma, julgado em 24/10/2023, DJe de 26/10/2023.)
    2. Do Enriquecimento Sem Causa

      REsp 1361182 / RS - Tema Repetitivo nº 610

      1. É da invalidade, no todo ou em parte, do negócio jurídico, que nasce para o contratante lesado o direito de obter a restituição dos valores pagos a maior, porquanto o reconhecimento do caráter ilegal ou abusivo do contrato tem como consequência lógica a perda da causa que legitimava o pagamento efetuado. A partir daí fica caracterizado o enriquecimento sem causa, derivado de pagamento indevido a gerar o direito à repetição do indébito (arts. 182, 876 e 884 do Código Civil de 2002).
      2. A doutrina moderna aponta pelo menos três teorias para explicar o enriquecimento sem causa: a) a teoria unitária da deslocação patrimonial; b) a teoria da ilicitude; e c) a teoria da divisão do instituto. Nesta última, basicamente, reconhecidas as origens distintas das anteriores, a estruturação do instituto é apresentada de maneira mais bem elaborada, abarcando o termo causa de forma ampla, subdividido, porém, em categorias mais comuns (não exaustivas), a partir dos variados significados que o vocábulo poderia fornecer, tais como o enriquecimento por prestação, por intervenção, resultante de despesas efetuadas por outrem, por desconsideração de patrimônio ou por outras causas.
      3. No Brasil, antes mesmo do advento do Código Civil de 2002, em que há expressa previsão do instituto (arts. 884 a 886), doutrina e jurisprudência já admitiam o enriquecimento sem causa como <u>fonte de obrigação</u>, diante da vedação do locupletamento ilícito.
      4. O art. 884 do Código Civil de 2002 adota a doutrina da divisão do instituto, admitindo, com isso, interpretação mais ampla a albergar o termo causa tanto no sentido de atribuição patrimonial (simples deslocamento patrimonial), como no sentido negocial (de origem contratual, por exemplo), cuja ausência, na modalidade de enriquecimento por prestação, demandaria um exame subjetivo, a partir da não obtenção da finalidade almejada com a prestação, hipótese que mais se adequada à prestação decorrente de cláusula indigitada nula (ausência de causa jurídica lícita).
      5. Tanto os atos unilaterais de vontade (promessa de recompensa, arts. 854 e ss.; gestão de negócios, arts. 861 e ss.; pagamento indevido, arts. 876 e ss.; e o próprio enriquecimento sem causa, art. 884 e ss.) como os negociais, conforme o caso, comportam o ajuizamento de ação fundada no enriquecimento sem causa, cuja pretensão está abarcada pelo prazo prescricional trienal previsto no art. 206, § 3º, IV, do Código Civil de 2002.
    1. Note: This response was posted by the corresponding author to Review Commons. The content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Point-by-point response to Reviewer comments:

      We copied the Reviewer comments below in italics. Revisions we propose in response to Reviewer comments are underlined.

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      The manuscript by Yin et al investigates how epidermal cells shape somatosensory neuron (SSN) morphology and function through selective ensheathment in Drosophila. This study builds on earlier work by another group showing that the phagocytic receptor Draper (Drpr) as a crucial epidermal factor that is important for dendrite pruning and clearance. In the present study, the authors how that Drpr also functions in the epidermis to establish the characteristic stretches of epidermal ensheathment of dendrite arborization neurons in the fruit fly Drosophila melanogaster. This is particularly true for highly branched types of dendrites but ont dendrites that show simpler branching patterns. Overexpression of Drpr increases ensheathment and nociceptor sensitivity, linking molecular recognition to sensory modulation. Further, Drpr is known to recognize phosphatidylserine (PS) on neurites to promote ensheathment and the authors show localization of a reporter for PS with epidermal membranes. Genetic manipulations that reduce PS results in a reduction in epidermal sheaths and the chemokine-like protein Orion promoting Drpr/PS interactions is required for these processes. Overall, the manuscript is well written, although at times maybe primarily for a fly audience. Reach could be improved by making it more accessible to a non-fly audience. The observation that Drpr is not only required for removing damaged or degenerating dendrites but also for their correct ensheathment of highly branched dendrites presents an important finding that could be of interest for a wider audience provided the following points are adequately addressed:

        • The Introduction could be further elaborated to help readers understand the significance of epidermal dendrite ensheathment. Addressing the following points may achieve this: (i) The Introduction would benefit from including details on developmental disorders and neurological diseases associated with defects or abnormalities in dendrite ensheathment.*

      We appreciate this suggestion. We allude to possible connections between ensheathment defects and human disease in the discussion but agree that it would be appropriate for the introduction; we will underscore this possible connection more clearly in our revised manuscript. We note studies of epidermal ensheathment are limited in mammalian systems, so links between dysregulation of epidermal ensheathment and disease have not been firmly established.

      (ii) In lines 74-79, it is unclear whether the described findings are conserved across evolution or were demonstrated in a specific model organism.

      The Reviewer refers to our statement about similarities in the cellular mechanism of epidermal ensheathment and phagocytosis. Indeed, these features are evolutionarily conserved in vertebrates, and we agree that it is worthwhile to emphasize this point. We added a statement underscoring the evolutionary conservation of the morphogenetic mechanism along with the relevant citation.

      (iii) Including a description of the known literature on phagocytosis in this process would help readers better understand the novelty and significance of this study.

      We agree with the Reviewer. In our revised introduction we will include a more detailed description of key features of phagocytic engulfment and highlight the salient differences between ensheathment and phagocytosis including the failure to complete the endocytic event in ensheathment and the persistence of PIP2 at the membrane.

      (iv) Details of published Draper function in Han et al 2014 should be elaborated along with unanswered question that is addressed in this study.

      The Han et al 2014 study established that epidermal cells, not Drosophila hemocytes (professional phagocytes), are primarily responsible for phagocytic clearance of damaged dendrites in the periphery. Similarly, the Rasmussen et al 2015 study we cite established that skin cells in vertebrates (zebrafish) act as primary phagocytes in removal of damaged peripheral neurites. These studies demonstrate the phagocytic capacity of epidermal cells, particularly in recognition of somatosensory neurites, and the Han study demonstrates that Draper is required for this epidermal phagocytosis. Neither of these studies addresses mechanisms of epidermal ensheathment; we will clarify this point in our revised introduction.

      • It is unclear why the authors focus exclusively on Drpr and Crq, without addressing emp and CG4006, both of which show higher expression levels than the former. Moreover, the conclusion that 14 out of 16 engulfment receptor genes have no role based solely on RNAi knockdown experiments is a very strong statement that may requires additional validation. The authors should provide evidence that the RNAi knockdowns achieved complete loss of gene function to support their claim about 16 engulfment receptors. In addition, at most the authors can conclude that the tested genes are individually not required.*

      The Reviewer makes several points that warrant discussion. First, the Reviewer asks “why the authors focus exclusively on Drpr and Crq, without addressing emp and CG40066.” The rationale for focusing on Drpr and Crq in our discussion of the expression data is that both Drpr and Crq function in phagocytic engulfment of damaged neurites. Our focus on Drpr for the remainder of the study is guided by the knockdown phenotypes; if either emp, CG40066, or any other receptor showed robust and reproducible effects on ensheathment we would have discussed them at length. Indeed, we identified a potentially novel ensheathment phenotype for NimB4 and devote a small portion of our discussion to its possible function. However, our primary focus in this study was to identify phagocytic receptors required for epidermal ensheathment of somatosensory neurites and drpr was the top hit from our RNAi screen.

      Second, we acknowledge that RNAi knockdown is often incomplete and without additional validation a negative result using RNAi is difficult to interpret. In our original text we state: “epidermal RNAi of 14/16 engulfment receptor genes had no significant effect on the extent of dendrite ensheathment in third instar larvae (Figure 1, F and G), consistent with the notion that most epidermal engulfment receptors are dispensable for dendrite ensheathment.” We do not claim that other receptors have “no role”, simply that our results are consistent with the interpretation that most receptors are dispensable. Furthermore, we acknowledge that multiple other receptors likely contribute to other aspects of ensheathment (lines 131-145; NimB4 knockdown causes an “empty sheath” phenotype). However, the Reviewer’s comments convince us that we should more clearly word our interpretation of the negative RNAi results more to reflect the limitations of the approach; we will incorporate this into our revision.

      Third, the Reviewer brings up the very important point that receptor redundancy could mask phenotypes. Indeed, our studies suggest that additional pathways likely function in parallel with Drpr. We agree that potential redundancy is an important consideration and absolutely warrants discussion in this section of the results; we will add this to our revised text and we have already updated the statement in the results to read “most epidermal phagocytic receptors are individually dispensable for dendrite ensheathment.”

      The final point the Review makes is that analysis of the knockdown efficacy is warranted if we want to make strong claims about gene function for other receptors. We agree that this would be an important first step, but in many cases protein perdurance masks RNAi phenotypes as well. So, efficient knockdown alone is not enough to make concrete conclusions about gene function in this developmental context.

      • What kind of genes are crq and ea?*

      Crq is a Scavenger receptor and Eater is a Nimrod-family receptor (indicated in Figure 1A).

      • Comparing Figures 1C and 1E, it appears that drpr knockdown has a differential effect on epidermal dendrite ensheathment between main and secondary branches. If this observation is correct, separate quantification for each branch type would be more appropriate, along with an explanation for the observed differences.*

      We agree with the Reviewer’s assessment that ensheathment appears to be largely absent on terminal dendrites following drpr knockdown but some ensheathment persists on major dendrites. In prior published studies we demonstrated that terminal branches are less extensively ensheathed than primary dendrites in wild-type larvae (Jiang et al 2019 eLife). We will provide this important context in our revised submission. We hypothesize that Drpr uniformly affects ensheathment across the arbor but agree with the Reviewer that quantification is warranted to evaluate this hypothesis. We will add this analysis to our revised submission.

      • For Figure 1K, it would be informative to examine how drpr knockdown affects dendrite length in these neurons.*

      We agree with the Reviewer. We demonstrate that drpr null mutants have exuberant terminal branching, but we have not yet analyzed effects of epidermal drpr RNAi. We will add this analysis to our revised manuscript.

      • For Drpr expression (Figure 3), it would be valuable to highlight any differences in expression between primary and secondary dendritic branches.*

      The Reviewer’s question about Drpr distribution at sites of ensheathment will be particularly relevant if we observe differential impacts of Drpr knockdown on ensheathment at primary and higher order dendrites. In our initial submission we showed that >70% of PIP2+ (Fig. 3B) and cora+ (Fig. 3D) epidermal sheaths also exhibited Drpr accumulation; we likewise showed that Drpr accumulation adjacent to dendrites only occurred at sites labeled by the sheath marker cora (Fig. 3G). In our revised submission, we will examine whether Drpr accumulation is more prevalent at sites of PIP2 accumulation on main branches compared to terminal branches.

      • Removing drpr leads to excessive branching of SSN dendrites. Does overexpression of drpr affect dendrite morphology in the opposite manner?*

      The Reviewer asks an intriguing question about effects of drpr overexpression. We have not examined effects of epidermal drpr overexpression on dendrite morphogenesis, but we will add these experiments to our revised manuscript.

      • Although drpr role in dendrite ensheathment is well explored, the interactions between drpr and PS seem underexplored. For example, do the changes in ensheathment as a result of manipulating PS levels require drpr? Does changing PS levels affect Drpr localization or levels?*

      The Reviewer raises two questions about the relationship between PS exposure and Drpr.

      First, they inquire whether changes in ensheathment resulting from manipulating PS levels require Drpr. We show that overexpressing the ATP8a flippase in C4da neurons, which limits PS exposure, limits the extent of ensheathment. Similarly, we show that sheath formation requires Drpr. In principle, we could assay effects of simultaneously overexpressing ATP8a in neurons and inactivating Drpr (using the Drpr null mutation), but such an experiment will likely be difficult to interpret because the individual treatments cause an almost complete loss of sheaths. We did not investigate whether increasing PS exposure increases ensheathment because prior studies demonstrated that ectopic PS exposure induces membrane shedding in C4da dendrites.

      Second, they inquire whether PS levels affect Drpr localization or levels. We demonstrate that inactivation of the PS bridging molecule Orion prevents Drpr localization at sheaths, hence we predict that neuronal overexpression of the ATP8a flippase should have a similar effect. In the revised manuscript, we will examine this possibility (monitoring Drpr distribution at epidermal contact sites with neurons overexpressing ATP8a).

      Minor Points:

        • Why there is no gene in bold category for hemocytes in Figure 1A*

      The bold type was used to indicate the receptors that were selected for screening, using a relaxed criteria for identifying receptors that were “expressed”: any receptor detected at a level of 0.1 TPM. To this point, the figure legend states: “Epidermal candidate genes in bold exhibited a TPM value > 0.1 in at least one biological sample and were selected for inclusion in RNAi screen for epidermal phagocytic receptors required for ensheathment.”

      We acknowledge that this is a relaxed criteria for “expression” and likely includes receptors that are not appreciably expressed in epidermal cells. Within the text we compare the repertoire of hemocyte and epidermal phagocytic receptors using a more standard (albeit still relatively relaxed) threshold of 0.5 TPM. We added shading to the histograms in Fig. 1A to facilitate comparison of phagocytic receptor gene expression in hemocytes and epidermal cells.

      • Line 67: "neurons BEING the most extensively..."*

      • Line 126: should read "epidermal engulfment receptors are INDIVIDUALLY dispensable"*

      • Line 216: "THE DrprD 5 mutation had no significant..."*

      • Line 230: "overexpression" instead of "overexpressed"*

      • Line 385: similar "TO"*

      These grammatical errors have been corrected. We thank the Reviewer for their careful reading of the manuscript.

      Reviewer #1 (Significance (Required)):

      This is an interesting study that adds to our understanding of the role of phagocytic receptors in shaping dendrites. Specifically, the role of Drpr (Draper) is studied, a gene previously known as an important for removal degenerating dendrites. The limitations of the manuscript as is is that it seems to be written primarily for a fly audience. Contextualizing the results and in the significance of this like conserved pathway could increase the significance.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      Summary:

      Innervation of the skin by somatosensory neurons is a conserved process that enables perception and discrimination of mechanical stimuli. How do molecules exposed by neurons and skin cells collaborate to promote neurite-induced epidermal sheath formation? Here, the authors combine fruit fly molecular and genetic tools with high resolution imaging to address this fundamental question. Based on morphological similarity between phagocytosis and SSN ensheathment, the authors hypothesized that one or more phagocyte receptors might promote ensheathment through ligand-driven interactions with neurites. To test this hypothesis, the authors systematically screened phagocytic receptors expressed in the epidermis for functional roles in ensheathment. Through this screening approach, the authors found that the Draper (Drpr) receptor functions in epidermal cells as a significant factor required to promote ensheathment. They support this conclusion using a suite of cell- and tissue-specific RNAi tools and mutant fly lines in conjunction with elegant mechanistic work that establishes a role for the conserved "eat-me" signal phosphatidylserine (PS) in driving ensheathment.

      Major comments:

      Are the claims and the conclusions supported by the data or do they require additional experiments or analyses to support them?

      The seven key claims presented in the abstract are strongly supported by experimental data and analyses presented in the manuscript. At least one experimental result displayed in a main figure in support of the indicated key claim is summarized below. This summary does not present a comprehensive list of all data in support of a particular claim. Rather, it is an effort to confirm that each key result presented to the readership in the abstract is supported by at least one rigorously analyzed experimental result.

      We concur with the Reviewer’s interpretations of our work and appreciate the clarity of their summaries below.

        • Drpr functions in epidermal cells to promote ensheathment: Expressing a Draper RNAi under control of a larval epidermal driver (A58) led to significant reduction in total sheath length (Fig 1H), average sheath length (Fig 1I), and fraction ensheathed (Fig 1J). Similar results were obtained using two different Draper RNAi constructs.*

      The argument presented through RNAi results in Fig 1 is bolstered by data using an existing validated Draper mutant line in Fig 2A-E. A question of interest to this reviewer upon receiving the paper was whether Draper functions at initial stages of sheath formation, maintenance of existing sheaths, or both. The timelapse data in Fig 2F suggests that Draper activity is dispensable for maintaining existing sheaths.

      • ...that Draper accumulates at sites of epidermal ensheathment but not contact sites of unsheathed neurons:*

      Immunostaining experiments demonstrate that Drpr immunoreactivity is enriched at PIP2-positive membrane domains in epidermal cells (Fig 3A-B). Is this accumulation selective for epidermal sheaths? Yes. In Fig. 3E-G, the authors show that Drpr enrichment overlaps with the sheath marker cora but not with dendrites of C1da neurons or from unsheathed portions of C4da dendrite arbors. The authors confirm specificity of Drpr immunoreactivity through control experiments using a Drpr mutant (Supplementary Fig 2).

      • ...that Drpr overexpression increased ensheathment:*

      Enforced overexpression of Draper in epidermal cells via Epidermal GAL4 driving UAS-Drpr (Fig 5A) shows significantly higher levels of ensheathment of C4da neurons as compared to controls. The authors demonstrate specificity by showing that epidermal Drpr overexpression did not induce ectopic sheath formation in C1da neurons (Fig 5E-G).

      • ...that extracellular PS accumulates at sites of ensheathment:*

      Using a previously developed secreted AnnV-mScarlet reporter (Ji et al. 2023 https://doi.org/10.1073/pnas.2303392120), the authors demonstrate that PLC-PH-GFP labeled stretches were also labeled by AnnV-mScarlet (Fig 6A-B), consistent with their model that ensheathment by Drpr is mediated by PS exposure on dendrites.

      • ...that overexpression of the PS Flippase ATP8a blocks ensheathment:*

      This claim is supported by demonstrating that overexpression of ATP8A, a protein that drives drives unidirectional PS translocation from the outer to the inner leaflet of the plasma membrane, impacts C4da neurite ensheathment. Selective overexpression of ATP8A in C4da neurons using a ppk-GAL4 induced a significant reduction in epidermal sheaths (Fig 6C).

      • ...that Orion is required for sheath formation:*

      Inactivation of the chemokine-like PS bridging molecule Orion significantly reduces fraction of ensheathment (Fig 6I-L).

      • Overexpression of Draper enhanced nociceptor sensitivity to mechanical stimulus*

      Consistent with a functional role for epidermal ensheathment in responses to mechanical stimuli, the authors report a significant reduction in nocifensive responses in a behavioral assay presented in Fig 6H.

      In conclusion, the authors' claims are supported by the data as presented in this version of the manuscript.

      • Please request additional experiments only if they are essential for the conclusions. Alternatively, ask the authors to qualify their claims as preliminary or speculative, or to remove them altogether.

      n/a

      • If you have constructive further reaching suggestions that could significantly improve the study but would open new lines of investigations, please label them as "OPTIONAL".

      n/a

      • Are the suggested experiments realistic in terms of time and resources? It would help if you could add an estimated time investment for substantial experiments.

      n/a

      • Are the data and the methods presented in such a way that they can be reproduced?

      Yes. The quality of the cell imaging data presented in the figures is high. The figure legends are sufficient to follow the investigators' conceptual approach and technical progress as they build their model. Transparent presentation of the screening data in Fig. 1 F-G was particularly appreciated by these reviewers.

      Are the experiments adequately replicated and statistical analysis adequate?

      Yes. We specifically commend the table outlining all statistical tests presented in the supplementary methods and linked to each figure.

      Do you have suggestions that would help the authors improve the presentation of their data and conclusions?

      Minor comments:

      1. Could the authors further clarify Drpr's anticipated window of activity during sheath formation and/or speculate further on this point in the discussion? Live imaging in Fig. 2 suggest that Drpr is dispensable for maintenance of existing sheaths. Given that Drpr is proposed to be activated through transient phosphorylation that recruits the binding partner Shark (PMCID PMC2493287), it might be useful to clarify Drpr's window of activation (ie transient or constitutive) for an audience more familiar with Drpr's canonical functions in engulfment. The section prior to speculation about a possible role for negative regulators of phagocytosis (Line 360) might be a possible location for this addition.

      We appreciate the insightful suggestion. As the Reviewer notes, our results are consistent with a model in which Drpr is required for formation but not maintenance of sheaths. Our original hypothesis was that Drpr would transiently localize to sheaths and be largely absent from mature sheaths. However, our antibody staining suggests that Drpr persists at mature sheaths (signal from endogenously labeled Drpr protein was too dim for live imaging in our hands). We therefore favor a model in which Drpr is transiently activated to promote sheath assembly.

      In the context of engulfment, Src42A-dependent tyrosine phosphorylation of Draper promotes association of Shark and Draper pathway activation. Src42A activation is regulated by integrins and RTKs, providing a potential point of crosstalk with other pathway(s) likely involved in ensheathment. Intriguingly, membrane recruitment and activation of Talin depends in part on PIP2, and Talin promotes both Integrin activation and recruitment of PIP2-prodicing PIP5K Kinases, providing a potential feed-forward mechanism for increasing PIP2 accumulation, Talin recruitment, and Integrin activation, which can promote Src42A activation. In our revised discussion we will provide a more thorough treatment of mechanism(s) of Drpr activation.

      • The authors might consider developing their conclusion a bit further for a broad audience. For example, the gesture to Piezo dependence in the current final sentence might provide an opening to discuss an exciting future avenue focused on integrating molecular mechansensors into a comprehensive model of selective SSN ensheathment important for the perception and discrimination of touch and pain.*

      We appreciate the suggestion and agree that it is worthwhile to expand on the potential links between ensheathment and sensory neuron function in our revised discussion. Our studies thus far have largely explored mechanosensation, but it’s worth noting that the nociceptive neurons under study here are polymodal, and other functional classes of somatosensory neurons are ensheathed to differing degrees, so an intriguing open question is whether ensheathment selectively potentiates the function of mechanosensors or more generally enhances functional coupling of somatosensory neurons to the epidermis. Our finding that ensheathment levels can be bidirectionally regulated by drpr levels provides an entry point to more broadly characterizing functions for ensheathment.

      • Word missing or extra "in" in Line 69 after ECM?*

      Corrected.

      • In Fig 1 and Fig 3, the PLC(delta)-PH-GFP reporter contains the delta symbol, in other throughout the paper it does not. In addition, Fig 5 is denoted "PIP2 (PLC-PH-GFP)". For consistency the authors might consider using PLC(delta)-PH-GFP across all figures.*

      As suggested, we updated the figures and text to include the delta symbol in the reporter PLC(delta)-PH-GFP.

      • Fig 6P - do the authors suggest Orion is distributed at high concentration throughout the entire upper portion of the figure? Perhaps the coloration could be changed if Orion binding is suggested to occur between Drpr and PS.*

      We have not examined Orion distribution in the periphery, though prior studies demonstrate that it is secreted into the hemolymph from multiple sources. Our schematic focuses on sites of contact between epidermal cells and dendrites but omits the hemolymph, muscle, and other cell types in the periphery. In our initial schematic epidermal cells and Orion were shaded similarly; in our revision we chose a different color for epidermal cells to prevent confusion.

      Optional suggestions for consideration to provide further context for a broad audience:

      Optional 6. The authors might consider placing their work in the context of an emerging literature focused developmental roles for immune cell signaling molecules/other phagocyte receptors at steady state. While the present study focused on epidermal ensheathment of SSNs stands on its own as a notable contribution and does not require these citations to support its conclusions, context from an emerging literature bridging immunity and development might be of interest to a broad readership. Should the authors wish to strengthen the link between their work and findings from other systems indicating a shared role in immunity and development for key immunoreceptors and their binding partners, they might consider adding citations/phrasing indicating that Draper's molecular collaborator Shark kinase (PMCID PMC2493287) was initially discovered as a developmental gene required for dorsal closure (PMCID PMC316420). They might also consider highlighting the role of Draper's mammalian orthologs Megf10/Megf11 in regulating mosaic spacing of retinal neurons (PMCID PMC3310952).

      We appreciate the Reviewer’s suggestions, in particular the value of further highlighting relevant links between immunity and development. Not including Megf10/Megf11 (Drpr vertebrate orthologue) in our discussion was an oversight as we predict that Megf10/Megf11 serves a similar role in ensheathment of vertebrate somatosensory neurons. In our revised manuscript we will incorporate a more thorough discussion of the emerging literature bridging immunity and development.

      Optional 7. The authors might consider tying their extended discussion of integrins (~Line 320-Line 335) into their overall argument in a more cohesive manner. For example, how (if at all) do the authors see Drpr collaborating with other receptors to regulate initiation versus maintenance of sheaths? Is a model in which Drpr initiates ensheathment maintained by other molecules possible? Speculation on this point in the discussion might integrate other molecules into the authors' model in a cohesive manner and/or bolster the authors' discussion of Drpr's window of activation/deactivation during ensheathment.

      Indeed, we envision a model in which Drpr cooperates with other receptors; we discussed one possible connection to integrins above and will incorporate a fuller treatment of the possible crosstalk between these pathways in our discussion. Regarding a model in which Drpr initiates ensheathment maintained by other molecules: yes, we agree that this is possible, but our results suggest that additional receptors likely participate in sheath initiation as well. Drpr inactivation substantially reduces but does not totally eliminate ensheathment, however the sheaths that form in drpr mutants are structurally distinct from mature sheaths (shorter, narrower, appear to recruit less Cora). Hence, we favor a model in which drpr signaling cooperates with a parallel, partially redundant pathway for initiating sheath formation in response to sheath-promoting signals. Integrin signaling is a plausible candidate for this parallel pathway for reasons we discuss in our original submission (and above); in our revised discussion we will more extensively discuss the potential cross-talk between Drpr signaling and Integrin signaling in initiation and maintenance of epidermal sheaths.

      Reviewer #2 (Significance (Required)):

      This study provides a new link between a conserved phagocyte receptor (Drpr) and epidermal ensheathment of somatosensory neurons, an important process at the heart of the regulated development and function of the nervous system. As such, the Yin et al. submission is a significant contribution to a rapidly moving research area of broad interest to an intellectually diverse readership interested in the molecular and cellular basis of neurodevelopment and interactions between the nervous system and the immune system.* *

      An important strength of this study is the striking degree of the epidermal ensheathment phenotypes observed when normal Drpr expression is disrupted either through depletion, mutation, or targeted overexpression. For example, depletion of Drpr via RNAi induces a ~three fold reduction in total sheath length (Fig 1F - ~1.45 mm in controls as compared to ~0.5 mm with Drpr RNAi). Notably, epidermal enforced overexpression of Drpr induces a notable increase in the fraction of ensheathed neurons (Fig 5A-D). This strength of phenotype enables the investigators to deploy an elegant sequence of molecular and genetic tools to further probe mechanism and implicate extracellular PS in this process.* *

      Reviewer area keywords as requested: phagocytes, immune cell signaling, signal transduction

      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      The study by Yin and colleagues investigates how epidermal cells recognize and ensheath somatosensory neuron (SSN) dendrites in Drosophila larvae. The authors identify the phagocytic receptor Draper (Drpr) as a key mediator of selective epidermal ensheathment and demonstrate that this process relies on phosphatidylserine (PS) exposure on dendrites and the bridging molecule Orion. The work significantly advances our understanding of neuron/epidermis interactions and reveals a novel role for phagocytic recognition pathways in non-glial ensheathment.

      The manuscript is clearly written, methodologically solid and supported by compelling data. The authors combine genetic, imaging and functional approaches to uncover a mechanism of structural and functional modulation of nociceptive neurons. The results will interest researchers studying neuronal morphogenesis, epithelial biology and non-glial phagocytic pathways.

      Specific Critiques:

      While the study is strong and timely, several issues should be addressed prior to acceptance:

      Figure 1: The authors refer to the receptors as "engulfment receptors." I recommend calling them "phagocytic receptors" since not all are required for the engulfment step (e.g., Crq).

      The Reviewer makes an important distinction. We have updated our manuscript to reflect this point, replacing “engulfment receptor” with “phagocytic receptor” in the text and in our title.

      Figure 2: The title states "Drpr is required in epidermal cells..." yet the authors analyze a drpr null mutant, which lacks Drpr in all expressing cells (glia, macrophages and epidermal cells). The rationale for using the null mutant instead of epidermal-specific RNAi should be explained.

      The increased dendrite number in drpr RNAi larvae should also be noted here.

      We agree – the title is not appropriate for this version of the figure; we changed the title to better reflect the experiments being portrayed.

      Our RNAi experiments in Figure 1 and 2 demonstrate that drpr is cell autonomously required in epidermal cells for dendrite ensheathment. Here, we include analysis of an amorphic drpr allele to (1) provide further genetic support underscoring the requirement for drpr in dendrite ensheathment and (2) to underscore the observation that a small number of immature sheaths form in the complete absence of drpr, arguing for the presence of an additional pathway that contributes to sheath formation.

      Effects of epidermal drpr RNAi on dendrite number is not something we evaluated with our time-lapse studies in Figure 2. Instead, we monitored the effects of drpr knockdown on growth behavior of epidermal sheaths and found that epidermal drpr RNAi triggered an increase in the frequence of sheath retraction events and a decrease in sheath growth events.

      Figure 3: Explain the numbers on the X-axis in panels B and D. Add a panel without blue dashed outlines to better visualize Drpr expression. Adjust the red boxes to precisely match the enlarged regions.

      Each bar represents a single neuron; the numbers denote the number of sheaths sampled from each neuron. We added this to the figure and figure legend in our manuscript. We thank the Reviewer for identifying this oversight.

      We appreciate the Reviewer’s perspective on the blue hatched lines; we removed the hatched lines from the ROI and adjusted the position of the red hatched box.

      Figure 4: Why is the drpr mutant used here rather than RNAi? Please clarify the reasoning for choosing mutants in some experiments and knockdown in others.

      In Figure 2, we show analysis of the amorphic allele to further corroborate our RNAi studies, as described above. We chose to use the drpr amorphic mutant for these studies because we have no GAL4-independent reporter to label C1da neurons for analysis of dendrite arborization patterns. Although we could use HRP staining in combination with epidermal drpr RNAi, live imaging of dendrite arbors labeled by a C1da neuron GAL4 driver provides a more sensitive and reliable readout for morphogenesis studies.

      In our revised manuscript we will add analysis of C4da dendrite patterns in larvae expressing drpr RNAi in epidermal cells to evaluate whether the dendrite defects reflect epidermal requirements for drpr function.

      Figure 5: Correct the placement of white boxes in panels E-F′.

      We thank the Reviewer for identifying the mismatch. We corrected the placement to match the size of the ROIs.

      *Figure 6: AnnV staining in B is difficult to detect. Please add a version of the panel showing AnnV alone. *

      In our initial submission we include the overlay of PLC-PH-GFP and AnnV-mScarlet (B), an image showing the PLC-PH-GFP alone (B’) and an image showing the AnnV-mScarlet alone (B”).

      AnnV labeling appears weak on sheaths. Since epidermal membranes are strongly labeled, confirm PS exposure on dendrites with a commercial fluorescent Annexin V reagent.

      We appreciate the suggestion to use a commercial fluorescent Annexin V reagent and agree that it would strengthen our findings if such a reagent labeled sheaths. However, we intentionally prioritized analysis using the in vivo reporter because numerous studies indicate that epidermal sheaths are inaccessible to large molecules in solution (in the absence of detergent). One of the first assays used to monitor the in vivo distribution of sheaths was based on the inaccessibility of antibodies to ensheathed neurites (Kim et al, Neuron, 2012; also Tenenbaum et al, Current Biology, 2017; Jiang et al, eLife, 2019). More recently, we demonstrated that 10kDa dextran dyes are excluded from epidermal sheaths (Luedke et al, PLoS Genetics, 2024). Nevertheless, as part of our revision we will examine whether commercially available Annexin V reagents label sheaths.

      In F and F" sheaths are labeled in areas without visible dendrites. Please clarify.

      We note that although C4da dendrites are the most extensively ensheathed among da neurons, other neurons (most prominently C3da neurons) also exhibit significant ensheathment (Jiang et al, eLife, 2019). We use established markers of epidermal sheaths (Cora immunoreactivity in this panel; PIP2 reporters and/or Cora-GFP localization in other panels), hence Drpr accumulates at Cora+ sheaths on C4da neurons and Cora+ sheaths that form on other da neurons. We will clarify this point in the text of our revised manuscript.

      In O and P, show Drpr staining without blue dashed sheath outlines.

      We have removed the blue dashed outlines from the figure panels.

      The legend contains numerous labeling errors: there is no B′ or B"; C-G should be E-G; G-I should be H-J; I-L should be K-N; M-O should be O-R. Please revise carefully.

      The labeling errors have been corrected.

      Sup Fig 1: Add a panel with only c4da labeling to visualize dendrites.

      We have added a panel displaying only C4da dendrites to this figure.

      Sup Fig 2: The anti-Drpr signal is unexpected in the null mutant. Validate with an additional antibody (e.g., mouse monoclonal anti-Drpr from the DSHB).

      We appreciate the suggestion and have already tested the mouse monoclonal anti-Drpr antibody from DSHB and found that it is unsuitable for use in our preparations (ie, no Drpr-dependent immunoreactivity, even in specimens overexpressing Drpr).

      With respect to the comment about the unexpected signal in the null mutant, we note that the antibody is a rabbit polyclonal and is not purified. In our experience it is not uncommon for rabbit serum (even pre-immune serum) to recognize multiple antigens in the larval skin. Nevertheless, our control studies demonstrate that Drpr immunoreactivity is eliminated at epidermal sheaths in Drpr null mutants.

      Sup Fig 3: No panels A or B are shown; no PIP2 marker is present despite the legend. Please revise. Drpr overexpression appears to increase Cora levels in some cell. Could Drpr affect Cora expression or distribution? This should be addressed. Also dendrite number appears higher in Drpr-overexpressing larvae. Please state whether this is significant.

      The labeling errors in the legend have been corrected; the corresponding studies with the PIP2 marker are presented in Figure 5.

      All epidermal drivers we have characterized exhibit a low level of variegation in expression within a hemisegment that we have previously documented (Jiang et al 2014 Development; Jiang et al 2019 eLife), and we suspect that it may be related to epidermal endoreplication (epidermal cells do not synchronously endoreplicate). However, we have not observed any systematic difference in epidermal GAL4 driver or Cora-GFP expression in larvae overexpressing Drpr. We note that a single cell in the field of view in Supplemental Figure 3 exhibits a higher level of GFP fluorescence. We occasionally observe this, independent of background genotype.

      All gene names must be italicized and lowercase (e.g., drpr), including in figure labels and legends.

      All protein names must be capitalized and non-italic (e.g., Drpr, Cora).

      We appreciate the Reviewer’s feedback. We used Drpr in keeping with many recent reports, but the Reviewer is correct in outlining the standard naming conventions. We have changed the gene names to reflect convention (lowercase, italics for genes that were initially identified according to phenotypic characterization; uppercase, italics for genes named according to homology to orthologues in other species such as NimB4 and ATP8A)

      Define ROI on first use.

      Done. We defined ROI in the methods section.

      Ensure consistent phrasing: use "anti-Cora or anti-Drpr immunoreactivity" uniformly.

      We have done so.

      There a few typos which must be corrected:

        • Line 196: "containing" → "contain"*
        • Line 205: "antibodies Drpr" → "antibodies to Drpr" or "anti-Drpr antibodies"*
        • Line 331: "predominan" → "predominant"*
        • Line 353: "phagocyting" → "phagocytic"*
        • Line 385: "similar the effect" → "similar to the effect"*
        • Line 432: Title should be underlined*
        • Line 544: "drpr∆5" is missing the 5*
        • Line 569: "immunoreactivity a" → "immunoreactivity of"*

      The typographical errors have been corrected. We thank the Reviewer for the close reading of the manuscript.

      Reviewer #3 (Significance (Required)):

      The manuscript makes a meaningful contribution to the field of neuron/epidermal cells interactions by demonstrating that recognized phagocytic machinery components can be co-opted for ensheathment of sensory neurites. This not only expands our understanding of skin innervation and mechanosensation but also raises intriguing implications for how similar mechanisms might operate in vertebrates (e.g., epidermal/nerve interactions, peripheral neuropathy). Given the functional link to nociceptive sensitivity, the work may have broader relevance for pain biology and sensory disorders.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      The study by Yin and colleagues investigates how epidermal cells recognize and ensheath somatosensory neuron (SSN) dendrites in Drosophila larvae. The authors identify the phagocytic receptor Draper (Drpr) as a key mediator of selective epidermal ensheathment and demonstrate that this process relies on phosphatidylserine (PS) exposure on dendrites and the bridging molecule Orion. The work significantly advances our understanding of neuron/epidermis interactions and reveals a novel role for phagocytic recognition pathways in non-glial ensheathment. The manuscript is clearly written, methodologically solid and supported by compelling data. The authors combine genetic, imaging and functional approaches to uncover a mechanism of structural and functional modulation of nociceptive neurons. The results will interest researchers studying neuronal morphogenesis, epithelial biology and non-glial phagocytic pathways.

      While the study is strong and timely, several issues should be addressed prior to acceptance: Figure 1: The authors refer to the receptors as "engulfment receptors." I recommend calling them "phagocytic receptors" since not all are required for the engulfment step (e.g., Crq).

      Figure 2: The title states "Drpr is required in epidermal cells..." yet the authors analyze a drpr null mutant, which lacks Drpr in all expressing cells (glia, macrophages and epidermal cells). The rationale for using the null mutant instead of epidermal-specific RNAi should be explained. The increased dendrite number in drpr RNAi larvae should also be noted here.

      Figure 3: Explain the numbers on the X-axis in panels B and D. Add a panel without blue dashed outlines to better visualize Drpr expression. Adjust the red boxes to precisely match the enlarged regions.

      Figure 4: Why is the drpr mutant used here rather than RNAi? Please clarify the reasoning for choosing mutants in some experiments and knockdown in others.

      Figure 5: Correct the placement of white boxes in panels E-F′.

      Figure 6: AnnV staining in B is difficult to detect. Please add a version of the panel showing AnnV alone. AnnV labeling appears weak on sheaths. Since epidermal membranes are strongly labeled, confirm PS exposure on dendrites with a commercial fluorescent Annexin V reagent. In F and F" sheaths are labeled in areas without visible dendrites. Please clarify. In O and P, show Drpr staining without blue dashed sheath outlines. The legend contains numerous labeling errors: there is no B′ or B"; C-G should be E-G; G-I should be H-J; I-L should be K-N; M-O should be O-R. Please revise carefully.

      Sup Fig 1: Add a panel with only c4da labeling to visualize dendrites. Sup Fig 2: The anti-Drpr signal is unexpected in the null mutant. Validate with an additional antibody (e.g., mouse monoclonal anti-Drpr from the DSHB). Sup Fig 3: No panels A or B are shown; no PIP2 marker is present despite the legend. Please revise. Drpr overexpression appears to increase Cora levels in some cell. Could Drpr affect Cora expression or distribution? This should be addressed. Also dendrite number appears higher in Drpr-overexpressing larvae. Please state whether this is significant.

      All gene names must be italicized and lowercase (e.g., drpr), including in figure labels and legends. All protein names must be capitalized and non-italic (e.g., Drpr, Cora). Define ROI on first use. Ensure consistent phrasing: use "anti-Cora or anti-Drpr immunoreactivity" uniformly. There a few typos which must be corrected:

      • Line 196: "containing" → "contain"
      • Line 205: "antibodies Drpr" → "antibodies to Drpr" or "anti-Drpr antibodies"
      • Line 331: "predominan" → "predominant"
      • Line 353: "phagocyting" → "phagocytic"
      • Line 385: "similar the effect" → "similar to the effect"
      • Line 432: Title should be underlined
      • Line 544: "drpr∆5" is missing the 5
      • Line 569: "immunoreactivity a" → "immunoreactivity of"

      Significance

      The manuscript makes a meaningful contribution to the field of neuron/epidermal cells interactions by demonstrating that recognized phagocytic machinery components can be co-opted for ensheathment of sensory neurites. This not only expands our understanding of skin innervation and mechanosensation but also raises intriguing implications for how similar mechanisms might operate in vertebrates (e.g., epidermal/nerve interactions, peripheral neuropathy). Given the functional link to nociceptive sensitivity, the work may have broader relevance for pain biology and sensory disorders.

    1. trabalho
      • Informativo nº 858
      • 19 de agosto de 2025.
      • Processo: REsp 2.191.479-SP, Rel. Ministra Maria Thereza de Assis Moura, Primeira Seção, por unanimidade, julgado em 13/8/2025. (Tema 1342). REsp 2.191.694-SP, Rel. Ministra Maria Thereza de Assis Moura, Primeira Seção, por unanimidade, julgado em 13/8/2025 (Tema 1342).

      Ramo do Direito DIREITO TRIBUTÁRIO

      Contribuição previdenciária patronal. Contribuição do Grau de Incidência de Incapacidade Laborativa decorrente dos Riscos Ambientais do Trabalho (GIIL-RAT). Contribuições a terceiro. Incidência. Contrato de aprendizagem. Tema 1342.

      Destaque - A remuneração decorrente do contrato de aprendizagem (art. 428 da CLT) integra a base de cálculo da contribuição previdenciária patronal, da Contribuição do Grau de Incidência de Incapacidade Laborativa decorrente dos Riscos Ambientais do Trabalho (GIIL-RAT) e das contribuições a terceiros.

      Informações do Inteiro Teor - Cinge-se a controvérsia a definir se a remuneração decorrente do contrato de aprendizagem (art. 428 da CLT) integra a base de cálculo da contribuição previdenciária patronal, inclusive as adicionais Contribuição do Grau de Incidência de Incapacidade Laborativa decorrente dos Riscos Ambientais do Trabalho (GIIL-RAT) e as contribuições a terceiros.

      • De acordo com o art. 428 da CLT, o contrato de aprendizagem é um "contrato de trabalho especial**". Assim, o texto legal acentua o caráter empregatício da relação de aprendizagem.

      • A doutrina também assevera que a aprendizagem é um contrato de trabalho, segundo as regras da CLT. Defende que a legislação "não deixa qualquer dúvida que o contrato de aprendizagem é uma forma de contrato de emprego"; que estabelece "uma relação empresa-empregado, quando o adolescente é submetido, no próprio emprego, à aprendizagem metódica".

      • A jurisprudência do Tribunal Superior do Trabalho vai em idêntica direção. Afirma que o contrato de aprendizagem "é espécie de contrato de trabalho, e, nesse contexto, o aprendiz é destinatário de normas específicas da CLT, reunindo os pressupostos do art. 3º da norma celetista", e acrescenta que "lhe são assegurados todos os direitos de cunho trabalhista conferidos à modalidade especial de seu contrato a termo" (RR-24001-73.2014.5.24.0096, 7ª Turma, Rel. Ministro Evandro Pereira Valadao Lopes, julgado em 23/4/2025).

      • Além disso, o reconhecimento de direitos previdenciários ao adolescente é princípio da legislação protetiva (art. 65 do ECA).

      • Não se sustenta o argumento de que o contrato de aprendizagem não gera uma relação de emprego, sendo o aprendiz segurado facultativo, na forma do art. 14 da Lei n. 8.212 /1991 e de seu correspondente art. 13 da Lei n. 8.213/1991.

      • Esses dispositivos apenas trazem uma idade mínima para a filiação como facultativo. Não é possível ver neles a indicação de que a pessoa com menos de 18 anos necessariamente é segurada facultativa. A forma de filiação de tal pessoa que tenha um contrato de trabalho será a de empregado. Portanto, esses dispositivos não impedem que a forma de filiação do aprendiz seja empregado - segurado obrigatório, portanto, não facultativo.

      • Apesar de os aprendizes serem segurados obrigatórios, seria possível desonerar a contribuição do empregador sobre as suas remunerações. Para tanto, seria necessária uma isenção, a ser prevista em lei, na forma do art. 176 do Código Tributário Nacional.

      • Embora os contribuintes recorrentes tenham sustentado que o art. 4º, § 4º, do Decreto-Lei n. 2.318/1986, cria tal isenção, ao excluir a remuneração dos "menores assistidos" da base de cálculo de encargos previdenciários, o "menor assistido" e o aprendiz não são a mesma figura.

      • Nesse sentido, a jurisprudência do Superior Tribunal de Justiça afirma que o art. 4º, § 4º, do Decreto-Lei n. 2.318/1986 não está regulamentado e não se confunde com o contrato de aprendizagem, previsto no art. 428 da CLT. Logo, não há aplicação atual para esse ato normativo (AgInt no REsp 2.146.118, Rel. Ministro Teodoro Silva Santos, Segunda Turma, julgado em 7/10/2024; e AgInt nos EDcl no REsp n. 2.078.398, Rel. Ministro Francisco Falcão, Segunda Turma, julgado em 26/2/2024).

      • Sendo assim, o aprendiz é empregado e recebe remunerações (salário e outras verbas), "destinadas a retribuir o trabalho, qualquer que seja a sua forma", as quais integram a base de cálculo da contribuição em questão e de seus adicionais, na forma do art. 22, I e II, da Lei n. 8.212/1991. Portanto, não há isenção prevista para as contribuições a cargo do empregador sobre a remuneração do aprendiz.

      • Dessa forma, a remuneração decorrente do contrato de aprendizagem (art. 428 da CLT) integra a base de cálculo da contribuição previdenciária patronal, da Contribuição do Grau de Incidência de Incapacidade Laborativa decorrente dos Riscos Ambientais do Trabalho (GIIL-RAT) e das contribuições a terceiros.

    1. Author response:

      The following is the authors’ response to the original reviews.

      We thank the reviewers for their constructive and precise comments, which have helped us improve the consistency and clarity of our manuscript. Below, we provide a point-by-point response to each comment. In summary, the main changes introduced in the revised version are as follows:

      (1) We replaced all the statistical analyses to their non-parametric equivalents to ensure compliance with test assumptions and consistency of the results;

      (2) We compare the participants’ reaction times before and during connected practice, revealing a significant reduction in reaction times of both partners when connected;

      (3) We added, in the supplementary materials, a table reporting the vigor scores of each participant in each experimental condition, facilitating the assessment of individual and dyadic behaviors;

      (4) We have reviewed and refined the terminology throughout the manuscript and reduced the number of abbreviations to improve clarity.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      The authors present a novel investigation of the movement vigor of individuals completing a synchronous extension-flexion task. Participants were placed into groups of two (so-called "dyads") and asked to complete shared movements (connected via a virtual loaded spring) to targets placed at varying amplitudes. The authors attempted to quantify what, if any, adjustments in movement vigor individual participants made during the dyadic movements, given the combined or co-dependent nature of the task. This is a novel, timely question of interest within the broader field of human sensorimotor control.

      Participants from each dyad were labeled as "slow" (low vigor) or "fast" (high vigor), and their respective contributions to the combined movement metrics were assessed. The authors presented four candidate models for dyad interactions: (a) independent motor plans (i.e., co-activity hypothesis), (b) individual-led motor plans (i.e., leader-follower hypothesis), (c) generalization to a weighted average motor plan (i.e., weighted adaptation hypothesis), and (d) an uncertainty-based model of dynamic partner-partner interaction (i.e., interactive adaptation hypothesis). The final model allowed for dynamic changes in individual motor plans (and therefore, movement vigor) based on partner-partner interactions and observations. After detailed observations of interaction torque and movement duration (or vigor), the authors concluded that the interactive adaptation model provided the best explanation of human-human interaction during self-paced dyadic movements.

      Strengths:

      The experimental setup (simultaneous wrist extension-flexion movements) has been thoroughly vetted. The task was designed particularly well, with adequate block pseudo-randomization to ensure general validity of the results. The analyses of torque interaction, movement kinematics, and vigor are sound, as are the statistical measures used to assess significance. The authors structured the work via a helpful comparison of several candidate models of human-human interaction dynamics, and how well said models explained variance in the vigor of solo and combined movements. The research question is timely and extends current neuroscientific understanding of sensorimotor control, particularly in social contexts.

      We thank the reviewer for their in-depth analysis and constructive assessment of our manuscript.

      Weaknesses:

      (1) My chief concern about the study as it currently stands is the relatively low number of data points (n=10). The authors recruited 20 participants, but the primary conclusions are based on dyad-specific interactions (i.e., analyses of "fast" vs "slow" participants in each pair). Some of these analyses would benefit greatly, in terms of power, from the addition of more data points.

      We understand and appreciate the reviewer’s concern regarding the effective sample size at the dyad level (n=10). While our primary analyses focus on dyad-specific interactions, we note that the reported effects are consistent across multiple dynamic conditions and are associated with large effect sizes. To provide a conservative assessment the Cohen’s D values reported correspond to the smallest effect size observed across the relevant statistical tests, thereby limiting the risk of false positives or overinterpretation. In addition, to ensure robustness given the sample size and distribution properties of the data, we have replaced all parametric tests with their non-parametric counterparts, as some analyses violated ANOVA assumptions. Friedman and Kruskal-Wallis tests are now used for paired and unpaired main effects respectively, and Wilcoxon and Mann-Whitney tests for paired and unpaired post-hoc comparisons respectively. Note that these changes did not alter the conclusions of the study.

      (a) The distribution of delta-vigor (Fast group vs Slow group) is highly skewed (see Figures 3D, S6D), with over half of the dyads exhibiting delta-vigor less than 0.2 (i.e., less than 20% of unit vigor). Given the relatively low number of dyads, it would be helpful for the authors to provide explicit listings of VigorFast, VigorSlow, and VigorCombined for each of the 10 separate dyads or pairings.

      We agree with this comment. However, we note that the distribution of vigor scores within a population is typically centered around 1, with large deviations observed only for the fastest and slowest participants [1]. As a result, the distri bution of ∆-vigor is inherently skewed. Correcting for this skewness would (i) require pairing participants based on their vigor, which is logistically difficult, and (ii) lead to an atypical sampling of dyads, with an over representation of pairs exhibiting very large vigor differences. The distributions of vigor scores for the fast and slow groups before and after the interaction are reported in Supplementary Fig. S21. In addition, as suggested by the reviewer, we have now included Table S.1 in the supplementary materials, listing the values VigorFast, VigorSlow, and VigorCombined for each of the 10 dyads. This table provides a complete view of the evolution of participant’s vigor throughout the experiment.

      (b) The authors concluded that the interactive adaptation hypothesis provided the best summary of the combined movement dynamics in the study. If this is indeed the case, then the relative degree of difference in vigor between the fast and slow participants in a dyad should matter. How well did the interactive adaptation model explain variance in the dyads with relatively low delta-vigor (e.g., less than 0.2) vs relatively high delta-vigor?

      We initially expected the magnitude of difference in individual vigor within a dyad to play a significant role. However, our analysis did not reveal any systematic effect of ∆-vigor on either the interaction force or the resulting dyadic vigor, as shown by the LMM analysis. Importantly, the interactive adaptation hypothesis does per se imply that the magnitude of vigor differences between the two partners should matter, only that their respective roles in selecting the adapted behavior is different. Although the model includes several free parameters, we did not attempt to fit it to individual dyads as would in principle be possible. Instead, we performed a sensitivity analysis to assess how variations in the difference in vigor between the partners influence model predictions. For this purpose, we simulated increasing values of µ and variations in the fast partner’s cost of time. In addition, we demonstrated that uncertainty in the estimated behavior of the slow partner, which is a priori specific to each individual, has a substantial impact on the optimal movement duration of the dyad. Overall, this analysis shows that the model captures the full range of qualitative trends observed in the experimental data. When applied to predict the behavior of the average dyad, the resulting movement time prediction error remain small, as detailed in the Results section.

      (2) The authors shared the results of one analysis of reaction time, showing that the reaction times of the slow partners and the fast partners did not differ during the initial passive block. Did the authors observe any changes in RT of either the slow or fast partner during the combined (primary task) blocks (KL, KH, etc.)? If the pairs of participants did indeed employ a form of interactive adaptation, then it is certainly plausible that this interaction would manifest in the initial movement planning phase (i.e., RT) in addition to the vigor and smoothness of the movements themselves.

      We thank the reviewer for this interesting question, that prompted us to extend our analysis of reaction times to the connected conditions. This additional analysis revealed a significant main effect of the condition on the reaction time for both the fast and slow groups (in both cases: W<sub>2</sub> > 0.39, p < 0.02). Post-hoc comparisons showed a significant reduction in reaction time between the initial null-field block (NF1) and the KH condition for the slow group (p = 0.03, D = 1.46), and a similar trend for the fast group (p = 0.06, D = 1.03). However, the reaction times remained comparable between the two groups, with no significant difference between them. We have incorporated these observations in the Results section (p.4, l.100–109) and expanded the Discussion (p.11, l.341–348) to address their implications for interactive adaptation in human-human and human-robot physical interactions.

      Reviewer #2 (Public review):

      Summary:

      This study examines how individual movement vigor is integrated into a shared, dyadic vigor when two individuals are physically coupled. Participants performed wrist-reaching movements toward targets at different distances while mechanically linked via a virtual elastic band, and dyads were formed by pairing participants with different baseline vigor profiles. Under interaction conditions, movements converged to coordinated patterns that could not be explained by simple averaging, indicating that each dyad behaved as a single functional unit. Notably, under coupling, movement durations for both partners were shorter than in the solo condition, arguing against the view that each individual simply executed an independent movement plan. Furthermore, dyadic vigor was primarily predicted by the slower partner’s vigor rather than by the faster partner’s, suggesting that neither a leader-follower strategy nor a weighted averaging account fully explains the observed behavior. The authors propose a computational model in which both partners adapt to the emerging interaction dynamics ("interactive adaptation strategy"), providing a coherent explanation of the behavioral observations.

      Strengths:

      The study is carefully designed and addresses an important question about how individual movement vigor is integrated during joint action. The experimental paradigm allows systematic manipulation of interaction strength and partner asymmetry. The behavioral results show clear and robust patterns, particularly the shortening of movement durations under elastic coupling (KL and KH conditions) and the asymmetrical contribution of the slower partner’s vigor to dyadic vigor. The computational model captures the main behavioral patterns well and provides a principled framework for interpreting dyadic vigor not as a simple combination of two independent motor plans, but as an emergent property arising from mutual adaptation. Conceptually, the study is notable in extending the notion of vigor from an individual attribute to a dyad-level construct, opening a new perspective on coordinated movement and motor decision-making.

      We thank the reviewer for their thorough analysis of our manuscript and their constructive feedback.

      Weaknesses:

      (1) A key conceptual issue concerns the apparent asymmetry between partners in the computational framework. While dyadic vigor is empirically better predicted by the slower partner’s vigor, the model formulation appears to emphasize the faster partner’s time-related cost and interaction forces. Although the cost function includes an uncertaintyrelated component associated with the slower partner, it remains unclear from the current formulation and description how dyadic vigor is formally derived from the slower partner’s control policy within the same modeling framework. This raises an important question regarding whether the model offers a symmetric account of dyadic vigor formation for both partners or whether it is effectively anchored to the faster partner’s control architecture.

      We have modified our phrasing to clarify the principles according to which the computational framework was designed (p.7, l.226–231 and p.9, l.260–264). As stated in the Results section, the model is indeed asymmetric by design, which corresponds to the different roles of the fast and slow partner exhibited in the data. In that context, the uncertain term associated with the slow partners should be understood as an overarching constraint that conditions the strategy of the dyad, while the fast partner cost of time acts as a contributor to the expected dyad strategy. Conceptually and numerically as reported in the sensitivity analysis, this asymmetry corresponds to the role of the slow partners in setting the vigor ranking among the dyads and the role of the fast partner in setting the average dyadic behavior.

      (2) A second conceptual issue concerns the interpretation of the term "motor plan." It remains unclear whether this term refers primarily to movement-related characteristics such as speed or duration, or more broadly to the underlying optimization structure that governs these variables. This distinction is theoretically important, as it determines whether the reported interaction effects should be understood as adjustments in movement characteristics or as changes in the structure of the control policy itself.

      We agree with the reviewer that this terminology required clarification. In this paper, the term “motor plan” refers to the time series of control inputs planned by the CNS, rather than solely to kinematic descriptors such as speed or duration. These planned control signals are a direct consequence of the underlying optimization structure and cost functions that govern trajectory generation. We have clarified this definition in the Introduction (p.1, l.23–24).

      Reviewer #3 (Public review):

      Strengths:

      This study provides novel insights into how individuals regulate the speed of their movements both alone and in pairs, highlighting consistent differences in movement vigor across people and showing that these differences can adapt in dyadic contexts. The findings are significant because they reveal stable individual patterns of action that are flexible when interacting with others, and they suggest that multiple factors, beyond reward sensitivity, may contribute to these idiosyncrasies. The evidence is generally strong, supported by careful behavioral measurements and appropriate modeling, though clarifying some statistical choices and including additional measures of accuracy and smoothness would further strengthen the support for the conclusions.

      Thank you for this analysis and the insightful feedback.

      Major Comments:

      (1) Given the idiosyncrasies in individual vigor, would linear mixed models (LMMs) be more appropriate than ANOVAs in some analyses (e.g., in the section "Solo session"), as they can account for random intercepts and slopes on vigor measures? Some figures (e.g., Figure 2.B and 3.E) indeed seem to show that some aspects of behaviour may present variability in slopes and intercepts across participants. In fact, I now realize that LMMs are used in the "Emergence of dyadic vigor from the partners’ individual vigor" section, so could the authors clarify why different statistical approaches were applied depending on the sections?

      We thank the reviewer for this thoughtful comment. We deliberately used different statistical approaches throughout the paper in order to address different types of questions. Note that the statistical tests were converted to their nonparametric equivalent for consistency (see answer to Reviewer 1).

      - Friedman tests were used in a limited number of cases to assess population- or group-level effects, such as differences in movement time, smoothness, or accuracy across the solo, connected, and after-effects conditions. Such tests provide a straightforward framework for these descriptive, condition-level comparisons.

      - The stability of individual and dyadic vigor scores across conditions was assessed using Pearson correlations across all condition pairs, which we consider the most direct and interpretable approach for evaluating consistency across sessions.

      - LMMs were employed to examine how dyadic vigor relates to the partners’ individual vigor measured in the solo conditions, which revealed the critical contribution of the slow partner.

      Rather than applying a single statistical framework throughout, we selected the method best suited to each question. While LMMs are well suited for modeling participant-specific variability when linking individual and dyadic measures, their systematic use in all analyses would be less intuitive and would not directly address several of the population-level comparisons central to this study.

      (2) If I understand correctly, the introduction suggests that idiosyncrasies in movement vigor may be driven by interindividual differences in reward sensitivity. However, the current task does not involve any explicit rewards, yet the authors still observe idiosyncrasies in vigor, which is interesting. Could this indicate that other factors contribute to these consistent individual differences? For example, could sensitivity to temporal costs or physical effort explain the slow versus fast subgrouping? Specifically, might individuals more sensitive to temporal costs move faster to minimize opportunity costs, and might those less sensitive to effort costs also move faster? Along the same lines, could the two subgroups (slow vs. fast) be characterized in terms of underlying computational "phenotypes," such as their sensitivities to time and effort? If this is not feasible with the current dataset, it would still be valuable to discuss whether these factors could plausibly account for the observed patterns, based on existing literature.

      We thank the reviewer for this interesting question. We first note that the notion of reward in motor control is quite broad. Although our task did not include explicit external (e.g. monetary) rewards, we assumed that participants attribute an implicit value to completing the task in accordance with the experimenter’s instructions. This assumption has been shown to be appropriate for characterising baseline behavior in previous studies [2–5].

      As discussed in the Introduction, vigor is generally understood to emerge from a tradeoff between effort, accuracy, and time. The reviewer is correct in noting that inter-individual differences in vigor may reflect differences in reward sensitivity or in its discounting [3,6], given that time and reward are intrinsically coupled. Differences in vigor may also arise from inter-individual variability in sensitivity to effort or perceived task difficulty. Because these factors are intertwined—for example, increasing accuracy through co-contraction typically incurs greater effort [7])—it is challenging to disentangle their respective contributions based solely on behavioral data.

      In the present study, our inverse optimal control procedure to identify the cost of time (and thus predict individuals’ vigor) relies on a predefined effort-accuracy tradeoff under fixed final time across multiple movement amplitudes [8]. As a result, the model does not allow us to independently estimate individual sensitivities to effort, accuracy, and time. Such characterization of computational "phenotypes" would likely require experimental paradigms in which each of these factors is systematically manipulated while the others are held constant, which is beyond the scope of the current dataset. In practice, the main value of behavioral modeling lies in revealing the relative weighting of these criteria by the CNS during motor planning [5]. We have expanded the Discussion to clarify these limitations and considerations (see Discussion p.12, l.396–401 & l.407–412).

      Finally, we chose not to emphasize these broader issues in the present manuscript because (i) they are peripheral to our primary research question on how individual vigor influences human-human interaction, and (ii) although we do not yet have definitive and consensual answers, they have been addressed in multiple studies reviewed elsewhere [9,10].

      (3) The observation that dyads did not lose accuracy or smoothness despite changes in vigor is interesting and suggests a shift in the speed-accuracy tradeoff. Could the authors include accuracy and smoothness measures in the main figures rather than only in supplementary materials? I think it would make the manuscript more complete.

      We also find that the preservation of accuracy and smoothness despite changes in vigor is an interesting result, and we therefore chose to report these measures in the Supplementary Materials. However, we believe it is preferable not to include them in the main figures for the following reasons:

      - We avoid framing our results in terms of a speed-accuracy trade-off, as Fitts’ work was initially designed to study fast movements [11], whereas our work focuses on self-paced movements. As outlined in the Introduction, vigor is more appropriately interpreted as reflecting a tradeoff between effort (related to movement speed), accuracy, and time. From this perspective, the reported changes of vigor already capture a shift in the underlying trade-off selected by the CNS, using a framework better suited to our experimental paradigm.

      - The manuscript is technically dense and reports multiple analyses that are essential to establish (i) the existence and definition of dyadic vigor, and (ii) how it emerges from interaction between partners. Although the observed preservation of accuracy and improvements in smoothness are informative, they are not central to these two primary questions and would risk diverting attention from the core contributions of the paper. In addition, accuracy is not a feature predicted by our deterministic modeling and extensions would be needed to capture these aspect. Here we only attempted to replicate average behaviors.

      (4) It is a bit unclear to me whether the variance assumptions for ANOVAs were checked, for instance, in Figure 3H.

      We thank the reviewer for this comment, which prompted us to verify the assumptions underlying our ANOVAs. We found that a few distributions in the original analysis, as well as in some of the new tests, did not meet these assumptions. To ensure consistency, all statistical analyses have now been replaced with non-parametric tests: Friedman and Kruskal-Wallis tests for paired and unpaired main effects, Wilcoxon and Mann-Whitney tests for paired and unpaired post-hocs. The updated results do not change any of the conclusions. the only minor change is accuracy, that appeared slightly improved in a restricted number of connected conditions, and now appears mostly non-impacted.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      Minor points:

      (1) Lines 146-147. The authors state, "Whereas the fast partners maintained a similar duration". Figures S6H,I suggest that fast partners made slower movements during the paired task relative to the solo task, not movements with a similar duration.

      We agree that Fig. S.6H,I suggest slightly slower movements for the fast partners, though not significant. We have modified the sentence to be less assertive than in the previous version (see p.6, l.155).

      (2) In the Discussion (Lines 318-319), the authors state that their findings confirm and extend the "benefits of dyadic control in collaborative actions". What benefits are they referring to here, relative to individual control? It would be helpful if the authors would elaborate on this claim.

      We have modified this sentence to clarify that the benefits of dyadic control refer to previously reported advantages over individual control, namely reduced movement time Reed and Peshkin (2008) [12] and improved tracking accuracy [13,14] (see p.11, l.336–337).

      (3) On Lines 87-89, the authors reference a decomposition of variance of vigor scores across the NF1, VL, and VH conditions; however, I did not see an explanation of how this decomposition was performed. The method used to estimate variance explained by inter-individual vs intra-individual differences in vigor should be outlined for the reader.

      Thank you for pointing out this missing information. We now explain in the statistical analysis section (see p.14, l.504–507), that the percentage of inter-individual variability in vigor is estimated using sum-square values as an estimation of inter- and intra-individual variability.

      (4) How was the absolute interaction torque for a paired movement calculated? Was it an integral of the temporal profile of torque for some portion of the combined movement? The method for calculating the absolute interaction torque needs to be specified.

      We have now clarified in the Methods (see p.14, l.490–491) that the reported average interaction effort was computed as the absolute value of the interaction torque as a function of time averaged over the entire movement.

      (5) Lines 123-124: "... interaction torque showed no significant correlation with differences in individual vigor within dyads." This statement should be supported by appropriate statistical measures.

      This result is now supported by reporting the corresponding Pearson correlation analyses. No significant correlations were found between interaction torque and differences in individual vigor within dyads (KL conditions: |r| < 0.43, p> 0.22; KH conditions: |r| < 0.18, p > 0.61, see p.5, l.132–133).

      (6) For the analysis, presented in Figure 3C, and specified on lines 116-123, the text mentions the main effects of both condition and target. There doesn’t appear to be much of an effect of the target for the KH data. Should these results not be reported as an interaction effect between the two factors instead?

      We agree with the reviewer and have corrected our presentation of these results (see p.4, l.126–128). Consistent with the reviewer’s observation, no significant effect of the target is found in the KH condition.

      (7) Figures 3E and S6B. What is the purpose of including the averaged data for each pair in addition to both individuals’ data from each pair? It would be useful to distinguish the individual data from the average data for each pair. Frankly, the number of data points shown on this sub-figure is excessive.

      There may have been a misunderstanding. Because the partners of a dyad are connected by a virtual elastic band (rather than a rigid bar), they do not execute identical movements. Therefore Figs. 3E,S6B display the movement time of all individual participants, together with the corresponding 20 individual regression lines, like in Fig. 2B. The solid black line represents the average across all individuals, and the averaged behaviors of dyads are not included. We have clarified this point by revising the caption of Fig. 3E (see p.5).

      Noted mis-spellings:

      Figure S.3A caption: "trials towards this target."

      Page 10 Line 313: "Importantly, these findings show ...".

      These mis-spellings have been corrected at supplementary p.2 and main text p.11, l.331. Thank you!

      Reviewer #2 (Recommendations for the authors):

      (1) To illustrate the contribution of the three components used to calibrate the overall cost function, it would be informative to include simulation analyses in which each component is selectively removed (i.e., ablation analyses).

      We did not perform ablation analyses, as selectively removing components of the model can lead to instability or ill-suited control inputs, making the resulting simulations difficult to interpret. Instead, we conducted a sensitivity analysis of the key parameters shaping the overall cost function, including the estimated mean and deviation of the slow partner’s movement duration, the weight associated with uncertain torque minimization (Figs. S.18,S.19), and the fast partner’s cost of time (Fig. S20). This analysis reveals the predominant roles of the estimated slow partner movement patterns in determining the model predictions, in agreement with our experimental observations.

      (2) Although the authors refer to the motor-off condition as "passive," participants actively generated the movements in the absence of external forces. Thus, this condition corresponds to active, unassisted movement. A different term may therefore reduce potential confusion for readers.

      We agree that term “passive” was not well-chosen given the context of the paper, thus we have instead replaced this denomination as “null-field” condition. Consequently, the P1 and P2 blocks are now referred to as NF1 and NF2.

      (3) Please clarify the instructions given to participants. Were they informed in advance that their movements would physically interact with those of their partner?

      Thank you for pointing out this missing clarification. We have now specified in the Methods (p.14, l.465–469) that participants were not informed prior to any condition that they would interact with a human partner; they were only told that the robot would provide assistance. When debriefed at the end of the experiment, only one out of the 20 participants reported having realized that they were connected to another human. Most participants believed they were interacting either with a version of themselves or with a robot with some randomness.

      (4) Line 475. Should "Fig. 2D" be "Fig. 2B"?

      Thank you for catching this error. The reference has been corrected to Fig. 2B (see p.15, l.522).

      Reviewer #3 (Recommendations for the authors):

      (1) The analysis of reaction times shows no difference between groups in the passive block, which challenges the assumption that movement vigor covaries with decision speed or action initiation speed. It may be worth discussing this in the context of recent literature.

      We agree that the initial analysis and discussion of reaction times were too superficial. In the revised manuscript, we now report that dyadic interaction leads to significantly shorter reaction times (p.4, l.100–109), concomitantly with improved movement velocity. We have also expanded the Discussion, on the relationship between decision and action speeds/durations (p.11, l.340–348).

      (2) Many abbreviations are unusual for a non-expert. I would recommend using the full terms instead. At least initially, I found it difficult to follow the results because the abbreviations were not immediately clear (at least to me).

      We agree that the paper had to many abbreviations. Therefore, we have removed the abbreviated names of the models and, when possible without impacting the readability, used the full names of the conditions.

      (3) Relatedly, the notation in Figure 1 may be confusing. The labels "S" and "F" (slow and fast) correspond to different concepts than "F" and "L" (follower and leader), so the same participant could be labeled "F" as fast but not "F" as a leader.

      Thank you for pointing out this potential source of confusion. We have therefore modified Fig. 1A (p.2) to avoid any potential confusion by using the full model names rather than abbreviations. In the remainder of the manuscript, "S" and "F" exclusively denote the slower and faster partners within a dyad, and we do not use abbreviations for "leader" or "follower" in the text.

      (4) In figures like 2.C and 3.I, keeping the same scales on the x and y axes and adding a diagonal reference line would make it easier to see shifts across conditions.

      As explained in the Methods, vigor scores in the low- and high-viscosity conditions were computed using the average movement durations from the NF1 condition as a reference. Consequently, because movements are slower in these conditions, the corresponding vigor values are lower than those in NF1. For this reason, using identical scales on the x- and y-axes and adding a 45◦ reference line could mislead the reader in thinking that the vigor scores are expected to be identical and reduce the readability of the figure.

      (5) Multiple hypotheses about dyadic regulation of vigor are nicely explained; it could help to indicate if any of these were a priori favored based on prior literature.

      Previous literature provides mixed evidence regarding how vigor might be regulated in dyadic interaction. For instance, Takagi et al. (2016) [15] reported that mechanically connected partners may rely on independent motor plans, which corresponds to the co-activity hypothesis considered here. However, in that study, movement duration was prescribed. We therefore expected that removing this constraint on movement duration could allow coordination strategies to emerge, particularly in view of findings on haptic communication during tracking of random targets while connected via an elastic band [13,14].

      At the same time, a large body of work on human–human and human–robot interaction has interpreted coordination through a leader–follower framework. In our context, vigor is understood as the outcome of a tradeoff between effort and elapsed time, with time being associated with a decaying reward. Based on this framework, we hypothesized a priori that a leader–follower scheme would emerge, in which the fast partner—being more sensitive to time costs and/or less sensitive to effort—would tend to drive the interaction, even at the expense of increased effort. For these reasons, the leader–follower hypothesis was formulated as the expected outcome throughout the manuscript.

      (6) In the introduction, statements such as "relative vigor of an individual is remarkably stable" appear true only in the solo condition. The same is true in the discussion where it is said that vigor is a stable trait. The whole study show that an individual can shift his/her vigor to the same vigor of another individual, so it doesn’t appear stable to me in such conditions but adaptable.

      Let us first clarify that when we describe vigor as “remarkably stable”, we do not imply that individuals do not adjust their movement timing in response to changes in external dynamics. For example, movement durations increase in visco-resistive conditions even during solo performance; nevertheless, individuals who move faster in the absence of resistance will remain faster relative to others when resistance is introduced. In this sense, stability refers to the preservation of relative rankings across conditions, rather than invariance of absolute movement timing. Because interaction with another individual constitutes a substantial change in task dynamics, an effect on individual pace is therefore expected.

      Told that (and as pointed to by the reviewer) (i) dyadic interactions lead to the emergence of a dyadic vigor characterized by average movement durations close to those of the fast partners, while the ranking across dyads is largely imposed by the slow partners; and (ii) these adaptations persist after the interaction phase. Importantly, the observed vigor adaptations appear to last longer in our physical interaction task than in previous attempts to manipulate vigor using visual feedback [16]. To account for this adaptability of vigor, we have (i) clarified claims in the Introduction regarding the stability of vigor (see p.1, l.18–20), and (ii) expanded the Discussion to more explicitly address vigor adaptability and the possible resulting consequences for the concept of vigor (see p.12, l.407–412).

      References

      (1) O. Labaune, T. Deroche, C. Teulier, and B. Berret, “Vigor of reaching, walking, and gazing movements: on the consistency of interindividual differences,” Journal of Neurophysiology, vol. 123, pp. 234–242, jan 2020.

      (2) L. Rigoux and E. Guigon, “A model of reward-and effort-based optimal decision making and motor control,” PLoS Computational Biology, vol. 8, pp. 1–13, Jan. 2012.

      (3) R. Shadmehr, J. J. O. de Xivry, M. Xu-Wilson, and T.-Y. Shih, “Temporal discounting of reward and the cost of time in motor control,” Journal of Neuroscience, vol. 30, pp. 10507–10516, aug 2010.

      (4) B. Berret and G. Baud-Bovy, “Evidence for a cost of time in the invigoration of isometric reaching movements,” Journal of Neurophysiology, vol. 127, pp. 689–701, feb 2022.

      (5) D. Verdel, O. Bruneau, G. Sahm, N. Vignais, and B. Berret, “The value of time in the invigoration of human movements when interacting with a robotic exoskeleton,” Science Advances, vol. 9, sep 2023.

      (6) K. Jimura, J. Myerson, J. Hilgard, T. S. Braver, and L. Green, “Are people really more patient than other animals? evidence from human discounting of real liquid rewards,” Psychonomic Bulletin & Review, vol. 16, pp. 1071–1075, dec 2009.

      (7) P. L. Gribble, L. I. Mullin, N. Cothros, and A. Mattar, “Role of cocontraction in arm movement accuracy,” Journal of Neurophysiology, vol. 89, pp. 2396–2405, may 2003.

      (8) B. Berret and F. Jean, “Why Don’t We Move Slower? The Value of Time in the Neural Control of Action,” Journal of Neuroscience, vol. 36, pp. 1056–1070, Jan. 2016.

      (9) R. Shadmehr and A. A. Ahmed, Vigor : neuroeconomics of movement control. The MIT Press, 2020.

      (10) D. Thura, A. M. Haith, G. Derosiere, and J. Duque, “The integrated control of decision and movement vigor,” Trends in Cognitive Sciences, vol. 29, pp. 1146–1157, Dec. 2025.

      (11) P. M. Fitts, “The information capacity of the human motor system in controlling the amplitude of movement,” Journal of Experimental Psychology, vol. 47, pp. 381–391, June 1954.

      (12) K. B. Reed and M. A. Peshkin, “Physical collaboration of human-human and human-robot teams,” IEEE Transactions on Haptics, vol. 1, pp. 108–120, July 2008.

      (13) G. Gowrishankar, A. Takagi, R. Osu, T. Yoshioka, M. Kawato, and E. Burdet, “Two is better than one: physical interactions improve motor performance in humans,” Scientific Reports, vol. 4, Jan. 2014.

      (14) A. Takagi, G. Ganesh, T. Yoshioka, M. Kawato, and E. Burdet, “Physically interacting individuals estimate the partner’s goal to enhance their movements,” Nature Human Behaviour, vol. 1, pp. 1–6, Mar. 2017.

      (15) A. Takagi, N. Beckers, and E. Burdet, “Motion plan changes predictably in dyadic reaching,” PLOS ONE, vol. 11, p. e0167314, Dec. 2016.

      (16) P. Mazzoni, B. Shabbott, and J. C. Cortes, “Motor control abnormalities in Parkinson’s disease,” Cold Spring Harbor Perspectives in Medicine, vol. 2, pp. a009282–a009282, Mar. 2012.

      1. Transversal (Delineamento)
      2. É como tirar uma fotografia de um momento específico.
      3. Analisa a causa (exposição) e o efeito (doença) simultaneamente.
      4. Você não consegue dizer o que veio primeiro (o ovo ou a galinha), ou seja, não estabelece causalidade direta, apenas associação.

      5. Quantitativo (Abordagem)

      6. Foca em números, estatísticas e métricas.
      7. Traduz opiniões, prevalências ou dados biológicos em números para serem tabulados.
      8. Em vez de descrever o "sentimento" de um paciente, você usa uma escala de 1 a 10 ou calcula a média de pressão arterial de um grupo.
      9. Objetividade e possibilidade de generalizar os resultados para uma população maior.

      10. Descritivo (Objetivo) Serve para relatar o que está acontecendo, sem intervir.

      11. Descreve as características de uma população (quem, onde, quando). Informa a frequência, a distribuição e a prevalência de um fenômeno.
      12. "60% dos alunos da faculdade X apresentam sintomas de burnout". O estudo não tenta explicar por que (isso seria analítico), apenas descreve a realidade encontrada.
    1. 1. Modular Structure: While Planning Center’s modular design allows for specialized tools tailored to different church needs, some users find it a bit overwhelming initially. Each module (like People, Check-Ins, and Giving) has a specific interface, which can require additional staff training.2. Steeper Learning Curve: While Planning Center offers robust features, the learning curve can be steeper compared to ChMeetings. This is especially true for churches that intend to use multiple modules, as each may require separate familiarization due to notable differences between them.3. Comprehensive Documentation: Planning Center compensates for its complexity with extensive documentation and customer support. Their help center provides detailed guides, tutorials, and community forums that can assist users in troubleshooting and maximizing their use o
      • Modular Interface Structure: Planning Center is organized into separate applications (such as People, Check-Ins, and Giving), each with its own interface and configuration.
      • Onboarding Process Across Modules: Churches using multiple modules may need to configure and learn each application separately, depending on the combination of tools in use.
      • Documentation and Support Resources: Planning Center provides extensive documentation, guides, and community resources to support setup, troubleshooting, and ongoing use.
    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      In this study, Wang et al. use Difteria Toxin (DT) to cause hair cell (HC) death in transgenic mice expressing the DT receptor in the HC of the inner ear. This model is assumed to cause HC loss in a selective way. The lesioned mice are assessed for translational vestibulo-ocular reflex (tVOR), vestibular sensory evoked potential (VsEP), rotational vestibulo-ocular reflex (rVOR), and single-unit recordings of vestibular afferents from cristae and maculae. Numbers of surviving HC, including total HC, type I HC (HCI) and type II HC (HCII) were also obtained at short and long times after DT exposure. By comparing the functional and histological results, the authors conclude that DT cause dose-dependent HC loss and vestibular function loss, that limited but significant HC regeneration occurs and that vestibular organs display variable but ample redundancy because robust physiological responses were obtained despite loss of high percentages of HCs.

      However, there are several limitations in the experimental design, methodological choices and analysis of the results that weaken the conclusions stated by the authors. Also, some important aspects of the work are not clear enough for an in deep scrutiny.

      The following list of weaknesses is not arranged in order of importance.

      1. Choice and use of the Pou4f3DTR/+ transgenic on FVB and C57/Bl6 backgrounds.

      1.a. Literature descriptions of the Pou4f3-DTR model used C57/Bl6 and CBA/J backgrounds and low mortality rates were found after DT administration. The present study generated Pou4f3-DTR mice on a FVB background and found that DT cause high mortality rates in this background. Comparison of the C57/Bl6 and FVB backgrounds are included in Figures 1 and 2 and the conclusion was that the C57/Bl6 background is more suitable for studying vestibular HC degeneration/regeneration. However, data are presented in Figures 3 to 7 without informing the reader whether these are from C57/Bl6 or FVB animals. Because of the information given in table 1, at least part of the data in these Figures is from the less suitable FVB mice. It is also possible that some data sets contain unbalanced numbers of animals from each strain in the different experimental conditions, with a potential impact on the robustness of the results. The strain identity of animals should be clarified across all data sets.

      1.b. Why the Pou4f3-DTR transgene was introduced in the FVB strain? The FVB strain is frequently used in transgenesis because the prominent pronuclei in their fertilized eggs and large litter size. While generation of transgenic lines in FVB mice is common, why would you want to bring an already established transgenic modification to a FVB background? It is known that FVB mice become blind by wean age due to a mutation in the Pde6b gene. Were the authors trying to have the Pou4f3-DTR model in a strain of blind animals? It is anomalous that the rationale for the FVB derivation is not provided and that the blindness of this strain is not even mentioned in an article containing VOR data. 2. Toxicity of the DT.

      2.1. The non-HC toxicity of DT is not evaluated. One of the stated reasons of the choice of the Pou4f3-DTR model to ablate HC is that other alternative models (aminoglycosides, cisplatin, IDPN) cause other toxic effects besides HC toxicity. However, the lack of evidence of other toxicities in Pou4f3-DTR mice after DT administration may simply be due to lack of assessment. Besides the inner ear, Pou4f3 is expressed in several structures including the genitourinary system, the retina, Merkel cells and subsets of somatosensory and brain neurons (https://www.ncbi.nlm.nih.gov/datasets/gene/18998/; PMID: 20826176; PMID: 22262898; PMID: 34266958; PMID: 33135183), so one would expect DT toxicity in these Pou4f3 expressing cells. Also, DT may cause other toxicities not explored in the model. The fact that the DT treatment is toxic beyond the intended HC toxicity is proven by the high (strain-dependent) mortality rate recorded in this study. A more detailed analysis of the effects of DT in the Pou4f3-DTR mice is needed before stating that the treatment is selective for the inner ear HCs. By the way, hyperactivity is not an additional toxic effect of ototoxic chemicals, it is a consequence of the vestibular function loss.

      2.2. The dose-response relationship of the DT treatment is unclear. The authors state that DT caused a dose-dependent loss of HC. However, the effects across different DT doses were not compared directly. Instead, each DT dose was compared with a different set of controls, and then the percentage of HC loss was qualitatively compared without statistical comparison. Looking at the numbers, the percent loss after the 35x2 dose is greater than that recorded after the 50x2 dose, contradicting the conclusion of a dose-dependent effect. One possible explanation is that the DT treatment has an inverted-U dose-response relationship, and the 25x2, 35x2 and 50x2 doses draw the bottom of the U. Alternatively, you have a dose-dependent effect with a dose causing a moderate effect (15) and 3 doses (25x2, 35x2, 50x2) causing near-maximal effects with differences among these groups more related to experimental variability than to dose-dependency. <br /> 3. Experimental design, use of animals, role of batch-to-batch variability in apparent results.

      3.a. The number of animals used in each experimental condition, their assignment to each assessment and participation in each dataset must be clarified. The reader is not informed on whether the animals used for physiological and histological analyses were the same or separate sets of animals were used. Also, the distribution of animals in different batches is not clarified and this may have originated apparent results through experimenter-generated bias. For instance, the HC count data are presented as two different, independent experiments, one evaluating different doses in the two strains at 14 days after exposure (Figures 1 and 2) and a second one comparing the HC counts at 2 weeks and 6 months after exposure (Figures 3 and 4). However, these were not separate experiments because at least some animals were shared in the two "experiments". This is demonstrated by the duplicate images between figures 1 and 2 and figures 3 and 4 (for instance, images D to D' in Figure 1 are the same than images C to C' in Figure 3). Therefore, at least part of the data for 2-week animals in Figure 3 have already been used as data of day-14 animals in Figure 1. This makes this reviewer suspect that 6-month animals in Figure 3 were treated with DT at different dates than 2-month animals in the same figure. Therefore, the small but significant "regeneration" could be simply due to differences in experimental outcome due to batch-to-batch experimental variability. In this kind of models, batch-to-batch experimental variability may be large and generate apparent group differences. For instance, in Figure 1, HC loss seems to be deeper after 35x2 than after 50x2. Although no statistical comparison is made between these groups, there seems to be an inversion of the dose-effect relationship that may simply depend on experimental (batch-to-batch) variability.

      3.b. The aim of revealing the relationship between HC loss and function retention should ideally be addressed using an experimental design providing subject-based data for comparison. That is, you cause the lesion, next you evaluate the function, and then you obtain the tissues for histological assessment, so the individual functional values can be matched to the individual HC numbers for a robust assessment of the relationship. In this work, group data from functional analyses are compared to group data from histological analyses, but no information is given on whether the same or different animals were used. If the same animals were used, the lack of direct comparison of the individual data is surprising and suggest that perhaps the comparison was made and conflicting results were observed. Alternatively, if different sets of animals were used, the conclusions on the "redundancy" of the vestibular organs are severely weakened because batch-to-batch variability in the extent of the lesion may be large and the lesions in the animals used for physiological assessment were in fact not assessed. As noted above, the possibility of a large batch-to-batch variability in the extent of the lesion is supported by the observation that lesions in 35x2 mice were deeper than lesions in 50x2 mice.<br /> 4. The conclusions on HC regeneration needs a deeper scrutiny and the conclusion on its dose-dependency is not supported by the data.

      4.1. The animals used for the experiments are too young to sustain claims on adult HC regeneration. DT was administered in "4-6 weeks old" animals. In rats and mice, many HC are generated at the early postnatal days and they mature over the first month. At 4 weeks after birth (postnatal day 28), the number of immature HCs in the rat utricle is small but significantly higher than at day 60 (PMID: 38895157). Therefore, 4-week-old animals may contain a higher reserve of immature cells to show up as "new HC" after damage than 6-week or 8-week-old animals. One possible origin of the differences between 2-week and 6-month DT animals would be that the 6-month group included more animals treated at 4 weeks while the 2-week group included more animals treated at 6 weeks.

      4.2. The conclusions on regeneration are based on percentages of HC densities. In the first 2-week experiment the area of the epithelium is assessed, but areas are not taken into consideration when comparing HC densities at 2 weeks and 6 months after DT. Is it possible that the increase in HC density is caused by epithelial shrinkage rather than by emergence of new HC?

      4.3. The spontaneous HC regeneration is stated to be "dose-dependent", meaning that more extensive lesions caused more vigorous regeneration. However, this is only an apparent effect caused by the use of percent data. Thus, the increase in HC counts in the utricle is said to represent a 52% after 25X2 and 118% after 50X2. However, if you look at the numbers instead of percentages, the mean number of HCs is 130 vs 86 (an increase of 44) after 25X2 and 78 vs 36 (an increase of 42) after 50X2. So, the cell counts indicate tat a similar number of "new" HCs appear after either dose. 5. The use of antibodies and the exact methodology for HC counts is unclear and perhaps defective.

      5.1. The immunohistochemical protocol did not include a specific marker for HCI, so HCI were defined as MYO7A+/Sox2- cells, HCII were MYO7A+/Sox2+ cells and supporting cells were MYO7A-/ Sox2+cells. The use of additional markers for the HCI (Spp1) or the calyx (Caspr1, tenascin-C) would have provided a more robust dataset. Also, striola/central versus peripheral regions were simply defined by approximate anatomical comparison, when positive markers of the central region are available (oncomodulin, calretinin+ calyces).

      5.2. The primary and secondary antibodies listed do not match. Two Myosin7a antibodies were used (mouse monoclonal from DSHB and rabbit polyclonal from Proteus) and a goat anti-Sox2. However, the secondaries listed are one anti-goat and two anti-rabbits. No anti-mouse is listed.

      5.3. In the figures, the reader is not informed whether the data are from the mouse anti-MYO7A or the rabbit anti-MYO7A, or whether the figure includes mixed data from both antibodies. This is highly relevant because MYO7A was used as the only positive marker for HCI, MYO7A expression may be reduced in stressed HCs (PMID: 37195449), and the two anti-MYO7A antibodies have different affinity for the target. Thus, if the 2-week samples were labelled with the mouse anti-MYO7A and the 6-month samples were labelled with the rabbit antibody, added to the possibility of reduced MYO7A expression at 2 weeks, then the apparent regeneration may be simply apparent, not real regeneration.

      5.4. The images were similarly obtained with the 63X objective in both the utricle and the crista. Why two different measures (per 10,000 square micrometres in utricle and per 2500 in crista) were computed if the original area used for counts was the same? The counts are said to be derived from these 63X square images or from merged images spanning the whole utricle. However, the results section does not include the information on the particular kind of image used for any of the counts, and all are presented similarly. The method used to obtain each count should be indicated and valid comparisons should only include counts obtained with the same method. 6. The presentation of the results and its interpretation is biased. Unbiased interpretation of the results do not support conclusions such as "we found that utricle function is largely preserved until hair cell loss exceeded 90%".

      6.1. "...a trend of increase....1.2+/-0.4 to 2.7+/-0.6...". These are similar very low numbers, close to zero, not a trend of increase.

      6.2. The reader is informed that VsEP "is particularly dependent...striolar type I hair cells". However, the next sentence stresses that measures "remained unchanged at low dose (15 ng/g), with 54% HC survival in striola" when the percentage survival of HCI was 62.7 %. The 54% survival was for total HCs.

      6.3. Lack of statistical significance is interpreted as lack of significant biological effect, when this may simply result from lack of power of the experimental design. For instance, it is concluded that the 15 ng/g dose has no effect on VsEP amplitudes, because control and DT animals did not sow statistically significant differences in this parameter. However, the comparison was made using only 4 control animals, with one of them showing a value much lower than the other 3. Also, 7 of the 8 DT animals had amplitude values below these 3 control values, and the mean value in the DT group was about 30-40% lower than the control mean. Clearly, larger groups were necessary to conclude that the 15 DT dose had no effect. Or, as suggested above, use individual animal-based comparisons to compare HC loss to loss of function. Lack of statistical significance in experiments with an insufficient number of controls can't be used to conclude that responses "were intact".

      6.4. "At 25 ng/g x2.....Notably, only 3 out of 13 exhibited elevated VsEP thresholds at this dose". However, looking at Fig 5C it seems more accurate to say that 8 out of 13 exhibited elevated thresholds. "At the highest dose (35 ng/g x2), 53.8% (7 out of 13) of the animals showed elevated VsEP thresholds", but in fact all 13 DT animals showed thresholds above the mean threshold value in the control group. 7. A total of 198 vestibular afferents were measured in 5 DT mice and 195 afferents in 4 control mice. An explanation is lacking about the representativeness of these populations, whether they represent a biased or unbiased representation of the total population of afferents. 8. Information of vehicle and volume of injection of DT is lacking. 9. Vestibular organs were "harvested". How? In PBS, fixative?<br /> 10. Why was the anterior crista used for HC counts? The VOR test used examines the reflexes generated in the lateral crista, and the lateral crista is easier to image. 11. There are several reference errors, including formal errors (duplicate o missing references) and content errors (references that do not include the information that you would expect from the text where they are cited).

      Referees cross-commenting

      While Referee #1 states that the experiments were carefully executed, in my opinion there are many details of the experimental design and execution that need to be better explained before this statement can be made.

      Significance

      The question addressed is of great interest for several reasons. To explain one, the degree of redundancy in the system greatly influences the possibilities of significant functional recovery that can be achieved by therapeutic interventions aimed at triggering HC regeneration after HC loss from any cause. The DT/transgenic mouse model is certainly an interesting model to address the question.

    1. La hipertensión portal incrementa en grado significativo la presión en el interior de la vena porta. Según la ley de Ohm, la presión es el producto de la resistencia multiplicada por el flujo.

      Ahora, traslademos esto al contexto de la circulación sanguínea y la hipertensión portal. En este caso, los términos se adaptan de la siguiente manera:

      Presión (P): En lugar de Voltaje (V), consideramos la presión sanguínea. Es la fuerza que impulsa la sangre a través de los vasos. Flujo Sanguíneo (Q): En lugar de Corriente (I), hablamos del flujo sanguíneo, que es la cantidad de sangre que pasa por un vaso en un determinado tiempo. Resistencia Vascular (R): En lugar de Resistencia (R), nos referimos a la resistencia vascular. Esto representa qué tan estrechos o abiertos están los vasos sanguíneos, y qué tan difícil es para la sangre fluir a través de ellos.

    1. Responda 3 perguntas e entenda qual nível faz sentido para você 1 Você já vende ou entrega SOC hoje? Sim Não 2 Seu objetivo imediato é fechar o 1º cliente? Sim Não 3 Você precisa de tenant próprio agora? Sim Não

      Podemos tirar essa sessão

    1. Reviewer #1 (Public review):

      In this manuscript, the authors report that GPR55 activation in presynaptic terminals of Purkinje cells decrease GABA release at the PC-DCN synapse. The authors use an impressive array of techniques (including highly challenging presynaptic recordings) to show that GPR55 activation reduces the readily releasable pool of vesicle without affecting presynaptic AP waveform and presynaptic Ca2+ influx. This is an interesting study, which is seemingly well-executed and proposes a novel mechanism for the control of neurotransmitter release. However, the authors' main conclusions are heavily, if not solely, based on pharmacological agents that most often than not demonstrate affinity at multiple targets. Below are points that the authors should consider in a revised version.

      Major points:

      (1) There is no clear evidence that GPR55 is specifically expressed in presynaptic terminals at the PC-DCN synapse. The authors cited Ryberg 2007 and Wu 2013 in the introduction, mentioning that GPR55 is potentially expressed in PCs. Ryberg (2007) offers no such evidence, and the expression in PC suggested by Wu (2013) does not necessarily correlate with presynaptic expression. The authors should perform additional experiments to demonstrate presynaptic expression of GPR55 at PC-DCN synapse.

      (2) The authors' conclusions rest heavily on pharmacological experiments, with compounds that are sometimes not selective for single targets. Genetic deletion of GPR55 would be a more appropriate control. The authors should also expand their experiments with occlusion experiments, showing if the effects of LPI are absent after AM251 or O-1602 treatment. In addition, the authors may want to consider AM281 as a CB1R antagonist without reported effects at GPR55.

      (3) It is not clear how long the different drugs were applied, and at what time the recording were performed during or following drug application. It appears that GPR55 agonists can have transient effects (Sylantyev, 2013; Rosenberg, 2023), possibly due to receptor internalization. The timeline of drug application should be reported, where IPSC amplitude is shown as a function of time and drug application windows are illustrated.

      (4) A previous investigation on the role of GPR55 in the control of neurotransmitter release is not cited nor discussed Sylantyev et al., (2013, PNAS, Cannabinoid- and lysophosphatidylinositol-sensitive receptor GPR55 boosts neurotransmitter release at central synapses). Similarities and differences should be discussed.

      Minor point:

      (1) What is the source of LPI? What isoform was used? The multiple isoforms of LPI have different affinities for GPR55.

      Comments on revisions:

      In this revised version, the authors have addressed my major concerns. Notably, they used CRISPR/Cas9 genetic knockdown of GPR55 to independently validate their original findings. The main conclusions are now well supported and represent an important contribution to the field.

    2. Author response:

      The following is the authors’ response to the original reviews

      Public Reviews:

      Reviewer #1 (Public review):

      In this manuscript, the authors report that GPR55 activation in presynaptic terminals of Purkinje cells decrease GABA release at the PC-DCN synapse. The authors use an impressive array of techniques (including highly challenging presynaptic recordings) to show that GPR55 activation reduces the readily releasable pool of vesicle without affecting presynaptic AP waveform and presynaptic Ca<sup>2+</sup> influx. This is an interesting study, which is seemingly well-executed and proposes a novel mechanism for the control of neurotransmitter release. However, the authors' main conclusions are heavily, if not solely, based on pharmacological agents that most often than not demonstrate affinity at multiple targets. Below are points that the authors should consider in a revised version.

      We are happy to hear the encouraging comments from this reviewer, and thank for pointing out the important issues including the previous study design depending only on pharmacological agents. To address these, we have performed additional experiments, as detailed below.

      Major points:

      (1) There is no clear evidence that GPR55 is specifically expressed in presynaptic terminals at the PC-DCN synapse. The authors cited Ryberg 2007 and Wu 2013 in the introduction, mentioning that GPR55 is potentially expressed in PCs. Ryberg (2007) offers no such evidence, and the expression in PC suggested by Wu (2013) does not necessarily correlate with presynaptic expression. The authors should perform additional experiments to demonstrate the presynaptic expression of GPR55 at PC-DCN synapse.

      We completely agree with the reviewer in that our previous manuscript lacked the reliable information regarding presynaptic expression of GPR55 at PC boutons.

      To clarify the localization, we first tried immunostaining of GPR55 using commercially available antibodies, but unfortunately they did not provide clear labeling of neurons and also even in GPR55-transfected HEK cells (used as positive control). Thus, we gave up the direct immunostaining. Alternatively, we attempted to label PC axonal boutons by GPR55-targeting dye together with a complementary strategy based on gene knock-down. Specifically, we used T1117, a fluorescent derivative of AM251 which is a GPR55 ligand used in the manuscript, and clear fluorescent signals were evident at GFP-labeled PC terminals. Still, by itself it was not clear whether the labeling was mediated by association with GPR55. Therefore, we also attempted to specifically suppress gene expression of GPR55 using CRISPR/Cas9-mediated genome editing in PCs, based on acute DNA micro-injection of plasmids into nuclei of PCs to express gRNAs targeting GPR55 together with Cas9. As a result, 5 days after the knock-down, T1117 labeling at axon terminals was reduced by ~50% compared to Cas9-alone controls. All these data are now shown in new Figure 2, and explained in the text p5-6, lines 141-159. Further, the reduction of GPR55 expression abolished the AM251-mediated reduction of vesicular exocytosis, as shown in new Figure 3D, E.

      Taken together, these results essentially convince our main conclusions by strongly suggesting that GPR55 is present at PC axon terminals, where it negatively regulates the exocytosis upon activation by AM251.  

      (2) The authors' conclusions rest heavily on pharmacological experiments, with compounds that are sometimes not selective for single targets. Genetic deletion of GPR55 would be a more appropriate control. The authors should also expand their experiments with occlusion experiments, showing if the effects of LPI are absent after AM251 or O-1602 treatment. In addition, the authors may want to consider AM281 as a CB1R antagonist without reported effects at GPR55.

      We thank the reviewer for pointing out these important issues. First, as noted above to confirm the presence of GPR55 at axon terminals of PCs, we performed genetic deletion of GPR55 using CRISPR/Cas9 system. In PCs co-expressing Cas9 and two gRNAs targeting the ligand-binding domain of GPR55, AM251 failed to suppress the exocytosis at PC boutons, together with decreased T1117 labeling. Therefore, the idea that GPR55 negatively regulates transmitter release at PC boutons has now been strengthened. The new data is shown in Figure 3D and E, and explained in the text p6, lines 173-178.  

      As suggested, we also carried out the occlusion experiments with LPI and AM251. First, LPI similarly reduced the readily releasable pool (RRP) size as AM251 did. Then, applied together, LPI and AM251 did not further reduce the RRP size compared with the effect by either compound alone. Thus, LPI and AM251 seem to act through the same pathway, consistent with the idea for role of GPR55 activation. The data is shown in new Figure 5—figure supplement 1 and explained in the text, p7-8, lines 215-221.

      Regarding another point suggested by the reviewer, we applied AM281 and observed no effect on transmission at the PC–target neuron synapses (shown in new Figure 1F and I; explained in the text p5, lines 117-123), indicating that the effect of AM251 is likely to be mediated by GPR55, but not by CB1R.

      Taken together, our additional experiments based on genetic and pharmacological experiments have consolidated our conclusion that GPR55 suppresses the presynaptic neurotransmitter release in PC boutons.

      (3) It is not clear how long the different drugs were applied, and at what time the recordings were performed during or following drug application. It appears that GPR55 agonists can have transient effects (Sylantyev, 2013; Rosenberg, 2023), possibly due to receptor internalization. The timeline of drug application should be reported, where IPSC amplitude is shown as a function of time and drug application windows are illustrated.

      Thank you for suggesting the better presentation of data. Accordingly, we have re-organized figures showing time course of changes in IPSCs before and after the drug application (new Figure 1 and 4; p4, lines 94-97; p5, lines 110-115; p7, lines 193-197). The current data presentation clearly shows that the effect of AM251 becomes evident in a few minutes after application, and somehow reaches a saturated level.

      (4) A previous investigation on the role of GPR55 in the control of neurotransmitter release is not cited nor discussed (Sylantyev et al., (2013, PNAS, Cannabinoid- and lysophosphatidylinositolsensitive receptor GPR55 boosts neurotransmitter release at central synapses). Similarities and differences should be discussed.

      We are really sorry for failing to adequately discuss this important work in our previous manuscript, and deeply appreciate the reviewer for pointing this out. We have now cited and discussed the work by Sylantyev et al. (2013), in the text (p12, lines 380-389), as following:

      ‘Pioneering studies clarified an important role of GPR55 in synaptic transmission at hippocampal excitatory synapses, demonstrating presynaptic enhancement of glutamate release presumably by elevating the cytoplasmic residual Ca<sup>2+</sup> via release from intracellular stores (Sylantyev et al., 2013; Rosenberg et al., 2023), in contrast to the suppression of release in our observation. The lack of positive modulation of AP-triggered release through residual Ca<sup>2+</sup> in PC terminals might be due to abundant amount of potent Ca<sup>2+</sup> buffer calbindin (Fierro and Llano, 1996). Indeed, increased vesicular fusion only for the AP-insensitive spontaneous vesicular release (as mIPSCs) was observed upon the IP<sub>3</sub>-mediated Ca<sup>2+</sup> release from internal store (Gomez et al., 2020). Thus, minimal sensitivity of AP-triggered release to residual Ca<sup>2+</sup> in PC boutons would underlie the distinct effects of GPR55 activation at the presynaptic side.’  

      Minor point:

      (1) What is the source of LPI? What isoform was used? The multiple isoforms of LPI have different affinities for GPR55.

      Thank you for letting us know about the lack of important information in the previous manuscript. In our experiments, we used a soybean-derived LPI mixture containing approximately 58% C16:0 and 42% C18:0 or C18:2 species. According to Brenneman et al. (2025), these isoforms show moderate or strong effects in cultured DRG neurons, whereas the C20:4 isoform, reported to promote neuroinflammatory signaling, was contained only at very low levels. We have added this information to the revised manuscript and briefly discussed the influence of different LPI isoforms on the physiological outcomes of GPR55 activation (p5, lines 127-131; p15, lines 493-496).

      Reviewer #2 (Public review):

      Summary:

      This paper investigates the mode of action of GPR55, a relatively understudied type of cannabinoid receptor, in presynaptic terminals of Purkinje cells. The authors use demanding techniques of patch clamp recording of the terminals, sometimes coupled with another recording of the postsynaptic cell. They find a lower release probability of synaptic vesicles after activation of GPR55 receptors, while presynaptic voltage-dependent calcium currents are unaffected. They propose that the size of a specific pool of synaptic vesicles supplying release sites is decreased upon activation of GPR55 receptors.

      Strengths:

      The paper uses cutting-edge techniques to shed light on a little-studied, potentially important type of cannabinoid receptor. The results are clearly presented, and the conclusions are for the most part sound.

      We feel very happy to see the positive comments from the reviewer.  

      Weaknesses:

      The nature of the vesicular pool that is modified following activation of GPR55 is not definitively characterized.

      We agree with the reviewer in that our data cannot fully address the changes of vesicle pools caused by GPR55. As detailed in responses to comments in ‘Recommendations for the authors’ from the reviewer, we have added explanation and discussion in the main text of the revised manuscript.

      Reviewer #3 (Public review):

      Summary:

      Inoshita and Kawaguchi investigated the effects of GPR55 activation on synaptic transmission in vitro. To address this question, they performed direct patch-clamp recordings from axon terminals of cerebellar Purkinje cells and fluorescent imaging of vesicular exocytosis utilizing synaptopHluorin. They found that exogenous activation of GPR55 suppresses GABA release at Purkinje cell to deep cerebellar nuclei (PC-DCN) synapses by reducing the readily releasable pool (RRP) of vesicles. This mechanism may also operate at other synapses.

      Strengths:

      The main strength of this study lies in combining patch-clamp recordings from axon terminals with imaging of presynaptic vesicular exocytosis to reveal a novel mechanism by which activation of GPR55 suppresses inhibitory synaptic strength. The results strongly suggest that GPR55 activation reduces the RRP size without altering presynaptic calcium influx.

      We thank the reviewer for giving the encouraging comments on our study.

      Weaknesses:

      The study relies on the exogenous application of GPR55 agonists. It remains unclear whether endogenous ligands released due to physiological or pathological activities would have similar effects. There is no information regarding the time course of the agonist-induced suppression. There is also little evidence that GPR55 is expressed in Purkinje cells. This study would benefit from using GPR55 knockout (KO) mice. The downstream mechanism by which GPR55 mediates the suppression of GABA release remains unknown.

      We thank the reviewer for pointing out all of these important issues to be ideally addressed. As detailed in the responses to comments in the ‘Recommendations for the authors’ from the reviewers, we have addressed most of these weak points, and also added careful discussion in the text about the open questions to be solved in the future study.

      Recommendations for the authors:

      Reviewer #2 (Recommendations for the authors):

      This is a high-quality paper that reports novel and interesting results. The authors should consider one main critique, related to Figure 6, as well as a number of minor points.

      We thank the reviewer for making very positive assessment of our study. We have carefully considered the main critique regarding presynaptic vesicle pools (related to previous Figure 6), as well as other points, and accordingly revised manuscript.

      Main critique:

      In Figure 6, it is said that GPR55 locks SVs in a state that is insensitive to VGCCs, based on a series of experiments with synapto-pHluorin. This conclusion is open to several critiques:

      The authors' model is shown in the diagram of Figure 6A. In this scheme, it appears as if recycled SVs eventually re-acidify in spite of the presence of bafilomycin, and that they are directed to a location close to the plasma membrane, but away from VGCCs. In fact, there is no evidence that the effects of bafilomycin could be limited in time. And there is a lot of evidence indicating that recycled SVs move back to release sites, close to VGCCs.

      We are so sorry for presenting misleading figure panel in the previous Figure 6A. As the reviewer says, the effect of bafilomycin should be expected to last for long, and then the endocytosed vesicles cannot be re-acidified. Now, in new Figure 8A, we have changed the panel for explanation about the experimental situation of vesicles in the presence of bafilomycin. Another insightful point, kindly suggested by the reviewer, regarding the quick recruitment of newly endocytosed vesicles to release sites, is highly related to the interpretation of our data, but is a different issue from the situation explained in new Figure 8A. To avoid confusion, the arrow drawn in the previous version indicating the endocytosed vesicle movement back to the docked situation has been omitted in the new panel, and this critical issue is now carefully discussed in terms of the mechanism of GPR55 action on the release machinery (p15, lines 480-482).

      The saturation of the train-induced signals is interpreted as reflecting an exhaustion of SVs initially close to VGCCs or more generally, susceptible to being released following VGCC activation.

      In an alternative scenario, saturation occurs because AP trains, or KCl applications, become unable to activate VGCCs. This could occur either because long illumination causes photodamage of VGCCs, or because repeated activation of VGCCs leads to their inactivation. The latter explanation is possible in spite of a publication from the authors' laboratory describing the facilitation of presynaptic VGCCs following paired stimulations in this synapse (Diaz-Rojas et al., 2015).

      We agree that it is an important control experiment to demonstrate that Ca<sup>2+</sup> increase upon repetitive AP trains is intact even during or after the long photo-illumination for imaging. To test this possibility, we have performed additional fluorescent Ca<sup>2+</sup> imaging at PC varicosities during individual 400-AP trains and also in response to 50 mM KCl following the series of AP trains. Now new data demonstrated that Ca<sup>2+</sup> influx remains constant across all AP trains (shown in Figure 8— figure supplement 1), arguing against VGCC inactivation or photodamage as a major factor underlying the saturated signal increase in the synapto-pHluorin. We have added explanation regarding this issue in the text p11, lines 327-329.

      The authors explain the larger effect of ionomycin compared with AP trains and KCl applications as reflecting a better capacity to increase the bulk calcium concentration. The above proposal for the inactivation of VGCCs offers an alternative explanation, in my view more likely.

      As noted above, our newly added Ca<sup>2+</sup> imaging data clearly showed that individual AP trains induced similar Ca<sup>2+</sup> influxes during repetitive trials, in line with our original interpretation. In addition, the Ca<sup>2+</sup> increase by KCl was shown to be more potent and broader in axon terminals and trunks. Nevertheless, the exocytic signal caused by ionomycin was clearly large, implying a critical effect of the source of Ca<sup>2+</sup> influx in PC boutons. Therefore, we suppose that the marked effect of ionomycin on release reflects higher elevation of bulk Ca<sup>2+</sup> in the cytoplasm arising from non-site selective Ca<sup>2+</sup>-ionophore (Figure 8—figure supplement 1, p11, lines 327-334; lines 342-349).

      In yet another scenario, recycled SVs in bafilomycin retain their fluorescence since they do not reacidify, but they come back to release sites to undergo new rounds of exocytosis. The new exocytosis events do not increase the fluorescence since the pH in the vicinity of synapto-pHluorin does not change. NH4Cl would then increase the fluorescence by revealing SVs that had not undergone exocytosis-endocytosis cycles during AP trains or KCl exposure. In this last scenario, the GPR55-sensitive SV pool would be a specific sub-pool of SVs that can be recycled by repetitive 400 AP trains.

      We deeply appreciate the reviewer for pointing out this important possibility. We completely agree that this scenario can also explain the pool which is sensitive to GPR55. Therefore, we have added explanation of this possibility in the text (p15, lines 474–482).

      Figure 6F shows calcium imaging measurements of PC varicosities. Unfortunately, crucial measurements are missing. It would have been revealing to compare calcium rises for the first and the last of the 8 400-AP trains. And to compare calcium rises elicited by 60 mM KCl before and after the series of 8 400-AP trains.

      This is an important control experiment. Therefore, we have performed additional Ca<sup>2+</sup> imaging during the eight 400-AP trains and KCl application. The new results shown in the present Figure 8—figure supplement 1 clearly suggest that Ca<sup>2+</sup> rises are comparable between the first and eighth trains, and that additional Ca<sup>2+</sup> influx (which was large in amplitude and wide in area) could still be evoked by KCl after the eight trains. The experiments are explained in the text p11, lines 327336.

      Minor points:

      (1) Introduction: The Introduction would benefit from a more substantial description of what is known about GPR55 and downstream signaling pathways. Right now, it is stated that GPR55 is 'potentially expressed in PCs': What are the arguments behind this statement? Also, the signaling pathway is discussed on p.12, much too late in the ms. Why not move this section to the Introduction?

      We thank the reviewer for the helpful suggestion. As recommended, in the revised manuscript, we have changed the Introduction by moving the sentences from other sections, including speculation about the expression of GPR55 in Purkinje cells (Ryberg et al., 2007; Wu et al., 2013) (p3-4, lines 71-75) and downstream signaling pathways (Gα<sub>q</sub>/PLC/IP<sub>3</sub>/Ca<sup>2+</sup> and Gα<sub>13</sub>/RhoA/ROCK) (p3, 63-68).  

      (2) Legend to Figures 1, 2, and 4: What is the EGTA concentration in these experiments?

      As suggested, the EGTA concentrations (0.5 or 5 mM) used in the individual experiments have now been clearly indicated both in the figure legends and in the Methods section (p18, lines 585586).

      (3) Fig. 3C: These experiments show that some SV pool is depleted by AM251. The authors state that this is the RRP, but other options are possible. In the calyx of Held, similar experiments are supposed to deplete not only the FRP (=RRP, presumably) but also the SRP.

      We thank the reviewer for pointing out the important aspect related to category for vesicle pools. In PC boutons, the membrane capacitance increases in response to different duration of depolarization pulses in a manner fitted by a single exponential curve (see Figure 5C for example). Our previous study (Kawaguchi and Sakaba, 2015) noted that the vesicle pools corresponding to FRP and SRP may not be easy to distinguish in PCs, suggesting apparently single component. That’s the reason why we simply describe the component as RRP in the present manuscript. Still, as suggested, careful discussion about typical fast- and slow components would be helpful to interpret our present findings. Therefore in the revised manuscript, we have added a sentence to explain this issue (p7, lines 211-214).

      (4) p. 8: When the 400 APs protocol is introduced, the corresponding frequency (20 Hz?) should be mentioned. This information comes only much later in the ms.

      We are sorry for our insufficient explanation in the previous manuscript. As suggested, we have clearly written the stimulation frequency ‘20 Hz’ in the main text where the 400 APs protocol first appears (p9, lines 277-278).

      (5) Figure 5, panels B and F: synapto-pHluorin is labelled twice 'synapto-pHluolin'.

      Sorry for careless typos. Now, those are corrected (new Figure 7).

      (6) Legend to Figure 5, last line: 'x' is missing in the last equation.

      Thank you for the careful and kind check. Now, ‘x’ has been added to the last equation in the legend for new Figure 7.

      (7) p. 7, Interpretation of EGTA effects: The authors frame their interpretation of EGTA effects around the distance between release sites and VGCCs. However since AM251 appears to alter the recruitment of SVs, a more parsimonious interpretation would be that EGTA modifies the calciumdependent movement of SVs towards release sites.

      Thank you for suggesting an insightful scenario. We agree that the capacitance jump upon long depolarization pulse would include exocytosis of substantial amount of vesicles which are newly recruited during the Ca<sup>2+</sup> increase. Then, as the reviewer states, EGTA possibly lowers the Ca<sup>2+</sup>dependent replenishment of synaptic vesicles, and this replenishment system might be the target of GPR55 activation. Therefore, we have now clearly added an explanation about this possibility in the text (p15, lines 474-482).

      (8) p. 13, Interpretation of GPR55 sensitive SV pool: The authors suggest a larger distance to VGCCs for this pool compared to naïve SVs. An alternative could be that in the presence of GPR55, the recruitment to release sites would be less efficient.

      This is also an insightful suggestion to speculate the causal relationship between the GPR55mediated reduction of vesicular release and the vesicle pools. Accordingly, we have revised the Discussion (see “Dynamics of synaptic vesicles among distinct functional pools”) by clearly telling about the possibility of decreased recruitment of vesicles to release sites after the GPR55 activation (p15, lines 474-482). By totally considering all the suggested scenario, we believe that the possible mechanisms for GPR55-mediated reduction of release are much more clearly explained in the revised manuscript.

      Reviewer #3 (Recommendations for the authors):

      (1) The time course of the agonist-induced suppression should be reported (Figure 1).

      This is an important point to show data clearly, as suggested also by the reviewer 1. Accordingly, we have changed the figure panels to show time courses of agonist-induced suppression (shown in new Figures 1 and 4).  

      (2) Show that the suppression of GABAergic transmission mediated by AM251 and LPI is eliminated in GPR55 KO mice.

      We appreciate the reviewer for putting us to try this important experiment. Owing to the suggestion, we attempted to knock-down the GPR55 expression using CRISPR/Cas9 in cultured Purkinje cells. To avoid potential developmental compensations, here we adopted the CRISPR/Cas9-based genome editing approach, rather than using global knock out mice. Those GPR55-KO cells, as noted above in response to the comment #2 of reviewer #1, showed decreased fluorescent labeling of PC axon terminals to fluorescent-variant of AM251 (shown in new Figure 2) and abolishment of AM251-mediated suppression of vesicle exocytosis (Figure 3D and E). These results are explained in the text p5-6, lines 141-159; p6, lines 173-178.  

      (3) Include references supporting AM251 and LPI as GPR55 agonists and specify the E50 concentrations for each agonist. Furthermore, provide details about the GPR55 antagonist CID16600046.

      As suggested, we have added references regarding GPR55 agonists, AM251 and LPI. In the text, the following information was added: AM251, originally characterized as an inverse agonist for CB1, has also been reported to act as a GPR55 agonist (Ryberg et al., 2007; Henstridge et al., 2009) (p5, lines 115-116). LPI is an established endogenous GPR55 agonist (Oka et al., 2007; Henstridge et al., 2009) (p5, lines 127-129). The reported EC<sub>50</sub> values are ~ 30 nM for LPI (Oka et al., 2007, HEK cell assay) and 39 nM for AM251 (Ryberg et al., 2007, HEK cell assay) (p4, lines 94-95; p5, lines 127-129). Regarding the GPR55 antagonist CID16020046, detailed information (IC<sub>50</sub> = 0.21 µM for GPR55 without significant effect on CB1 receptor) was added in the text with an appropriate citation (Kargl et al., 2013) (p5, lines 123-127). These points have also been added to the Methods section (p17, lines 587-589).

      (4) Regarding the onset delay (Figure 4C; page 8, lines 3-4), consider the following: "AM251 induced a modest yet significant synaptic delay, estimated by the time to the onset of release" (or something similar).

      We thank the reviewer for suggesting helpful explanation. Accordingly, we have changed the sentence to explain the delayed onset (p9, lines 264-265).

      These three points should be properly acknowledged in the Discussion:

      (1) Are action potentials (APs)/depolarizations and ionomycin applications comparable? Ionomycin mediates a large calcium rise significantly slower than the calcium rise mediated by fast depolarization. Such presynaptic calcium dynamics could account, in part, for the different results.

      The qualitative difference of Ca<sup>2+</sup> increase between APs/depolarization-mediated ones and ionomycin-mediated one is an important point. Thank you for pointing out this issue. In the revised manuscript, we have added an explanation about the possible difference arising from the distinct dynamics of Ca<sup>2+</sup> increases caused by direct depolarization of axon terminals or by ionomycin (p14, lines 452-453).

      (2) Previous studies on hippocampal CA3-CA1 pyramidal cell synapses indicate that GPR55 activation enhances glutamate release through presynaptic calcium modulation while diminishing inhibitory postsynaptic strength by reducing GABAA receptors (Sylantyev et al., PNAS 2013; Rosenberg et al., Neuron 2023). In contrast, Inoshita and Kawaguchi discovered that GPR35 suppresses PC-DCN inhibitory transmission by decreasing GABA release without affecting inhibitory postsynaptic strength. Some potential explanation for this discrepancy is warranted.

      We appreciate the reviewer for pointing out this important issue, and feel sorry for not providing an appropriate discussion about the possible interpretation in the previous manuscript. In the revised manuscript, we have added explanations for this discrepancy. First, PC terminals show only limited influence by elevated cytoplasmic Ca<sup>2+</sup> through ER store on GABA release (Gomez et al., 2020) probably due to abundant calbindin. Second, our present data clearly show the GPR55 signals at PC terminals (although indirect, see Figure 2), while hippocampal inhibitory neuronal boutons somehow showed lower GPR55 levels compared with excitatory neuronal boutons (Rosenberg et al., Neuron, 2023). Third, the subtypes and/or anchoring mechanism for postsynaptic GABA<sub>A</sub> receptors might be different between two distinct postsynaptic neurons in the hippocampus and the cerebellum. These factors are now clearly discussed in the text (p12, lines 380-396).

      (3) Earlier work has suggested that CB1 receptor activation can alter the release machinery. Therefore, the observation that GPR55 activation induces changes in the RRP is not entirely surprising.

      As pointed out, previous studies showed that CB1R influences the synaptic release machinery, rather than Ca<sup>2+</sup> influx (Ramirez-Franco et al., 2014). In that context, as the reviewer says, the GPR55-mediated RRP change can be regarded as a similar synaptic modulation mechanism as the CB1-mediated one. However, considering the different downstream signaling pathways, G<sub>12/13</sub>- or G<sub>q</sub>-mediated one and G<sub>i/o</sub>-mediated one, our findings would provide an important scope about the regulation mechanisms of release machinery, which should be further analyzed in the future study. Now we have added these points in discussion (p13-14, lines 435-439).

      (4) Add a section about the limitations of this study (see Weaknesses above).

      As suggested, we have added a section about the limitations of this study at present, which we could not address in the revision and should be addressed in the future (p15, lines 488-508). Particularly, the actual endogenous agonist to activate GPR55, and the physiological situation in which the agonist is produced, much more direct evidence for GPR55 presence at PC boutons, and the downstream mechanisms of GPR55-mediated suppression of GABA release are now clearly notified in that section.

      (5) Double-check grammar and typos ("anandamid").

      We are really sorry for the poor writings in the previous manuscript. Now, we have carefully checked the text.

  3. revistas.est.edu.br revistas.est.edu.br
  4. www.planalto.gov.br www.planalto.gov.br
    1. § 1o
      • Frise-se que o recurso interposto não segue diretamente à autoridade superior.

      • Primeiro, é destinado à autoridade prolatora da decisão, que, se não reconsiderar em 5 (cinco) dias, deverá encaminhar à autoridade superior

    1. Integers can be specified in: decimal (base 10), hexadecimal (base 16), octal (base 8), or binary (base 2) notation

      الجملة هاي معناها ببساطة إنك بتقدري تكتبي الأرقام الصحيحة (اللي بدون أعشار أو فواصل) جوا الكود بأكثر من "نظام عد"، مش بس بالنظام العادي اللي بنعرفه.

      لغات البرمجة بشكل عام (سواء PHP أو بايثون وغيرها) بتفهم الأرقام بـ 4 طرق رئيسية عشان تناسب العمليات المختلفة في معالجة البيانات:

      النظام العشري (Decimal - Base 10): هاد نظامنا الطبيعي اللي بنستخدمه بحياتنا اليومية. بيتكون من الأرقام (0 إلى 9).

      مثال: $num = 15;

      النظام الثنائي (Binary - Base 2): لغة الآلة الأساسية، وبتتكون بس من (0 و 1). عشان تفهم لغة البرمجة إنك بتكتبي بنظام ثنائي، لازم تبلشي الرقم بـ 0b.

      مثال: $num = 0b1111; (هاد بيعادل رقم 15 بالعشري).

      النظام السادس عشر (Hexadecimal - Base 16): بيستخدم الأرقام (0 إلى 9) والحروف (A إلى F). عشان تكتبي فيه لازم تبلشي الرقم بـ 0x. هاد النظام رح يمر عليكِ كثير بالبرمجة مثلاً لتمثيل أكواد الألوان أو في خوارزميات التشفير.

      مثال: $num = 0xF; (هاد كمان بيعادل رقم 15).

      النظام الثماني (Octal - Base 8): بيستخدم الأرقام (0 إلى 7) فقط. وبتبلشي الرقم بحرف 0o أو أحياناً بس صفر 0.

      مثال: $num = 017; (وبرضه هاد بيعادل 15).

    1. The pipeline does not currently support batch parallelization, processing images sequentially. For large screening datasets this may be a practical limitation, though the per-image processing time (seconds to minutes depending on image size and analysis modules) is acceptable for most experimental workflows.

      Nice work! This seems like a useful tool for making image analysis more accessible.

      I was curious whether there was a specific reason for the limitation you mention here: "The pipeline does not currently support batch parallelization, processing images sequentially."

      My first thought was that segmentation might be the main constraint (especially when using Cellpose). But it seems like one possible architecture would be to run segmentation first and save masks, then parallelize the downstream steps (puncta detection, colocalization, morphology measurements, etc.) across images or cells.

      That part of the pipeline seems like it could be relatively straightforward for Claude to parallelize with something like multiprocessing or joblib and might significantly improve throughput for larger datasets, since downstream analysis would no longer be tied to per-image segmentation.

      Was something like this considered, or are there constraints (e.g., Cellpose behavior, I/O, memory usage) that make parallelization less practical?

    1. “Well, I dunno, skasely. Ole Drake Higgins he’s ben down to Shelby las’ week. Tuck his crap down; couldn’t git shet o’ the most uv it; hit wasn’t no time for to sell, he say, so he ’fotch it back agin, ’lowin’ to wait tell fall.

      The dialogue flow here gives insight on the accent– seemingly country-like.

    2. Goodness knows what’s to become o’ that po’ boy. No father, no mother, no kin folks of no kind.

      Parents were seen as a guiding force. even if someone else did look after the boy, he most likely would have pity and be seen as unfortunate.

    1. So the COlloidal crystals will havemoduli of - 1 dyn/ cm 2 • Actual values range from O. 1<A < 1000 dyn/cm 2

      Despite strong individual interparticle forces, the macroscopic elastic properties of colloidal crystals are vastly weaker than those of conventional solids because of the much lower particle density and larger interparticle spacing.

    Annotators

    1. Water is polar (O pulls electrons from H → δ⁻ on O, δ⁺ on H, bent shape ~104.5°).

      Bit too much info for one sentence. Explain it across 2 or 3 sentences

    1. if we make an “O” by putting our thumb and forefinger together, we mean “OK,” but the same gesture in certain parts of Europe signifies an obscenity.

      ? It would be helpful to know specifically which countries view the "OK" sign as an obscenity

    1. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public Review):

      Summary:

      Zeng et al. have investigated the impact of inhibiting lactate dehydrogenase (LDH) on glycolysis and the tricarboxylic acid cycle. LDH is the terminal enzyme of aerobic glycolysis or fermentation that converts pyruvate and NADH to lactate and NAD+ and is essential for the fermentation pathway as it recycles NAD+ needed by upstream glyceraldehyde-3-phosphate dehydrogenase. As the authors point out in the introduction, multiple published reports have shown that inhibition of LDH in cancer cells typically leads to a switch from fermentative ATP production to respiratory ATP production (i.e., glucose uptake and lactate secretion are decreased, and oxygen consumption is increased). The presumed logic of this metabolic rearrangement is that when glycolytic ATP production is inhibited due to LDH inhibition, the cell switches to producing more ATP using respiration. This observation is similar to the well-established Crabtree and Pasteur effects, where cells switch between fermentation and respiration due to the availability of glucose and oxygen. Unexpectedly, the authors observed that inhibition of LDH led to inhibition of respiration and not activation as previously observed. The authors perform rigorous measurements of glycolysis and TCA cycle activity, demonstrating that under their experimental conditions, respiration is indeed inhibited. Given the large body of work reporting the opposite result, it is difficult to reconcile the reasons for the discrepancy. In this reviewer's opinion, a reason for the discrepancy may be that the authors performed their measurements 6 hours after inhibiting LDH. Six hours is a very long time for assessing the direct impact of a perturbation on metabolic pathway activity, which is regulated on a timescale of seconds to minutes. The observed effects are likely the result of a combination of many downstream responses that happen within 6 hours of inhibiting LDH that causes a large decrease in ATP production, inhibition of cell proliferation, and likely a range of stress responses, including gene expression changes.

      Strengths:

      The regulation of metabolic pathways is incompletely understood, and more research is needed, such as the one conducted here. The authors performed an impressive set of measurements of metabolite levels in response to inhibition of LDH using a combination of rigorous approaches.

      Weaknesses:

      Glycolysis, TCA cycle, and respiration are regulated on a timescale of seconds to minutes. The main weakness of this study is the long drug treatment time of 6 hours, which was chosen for all the experiments. In this reviewer's opinion, if the goal was to investigate the direct impact of LDH inhibition on glycolysis and the TCA cycle, most of the experiments should have been performed immediately after or within minutes of LDH inhibition. After 6 hours of inhibiting LDH and ATP production, cells undergo a whole range of responses, and most of the observed effects are likely indirect due to the many downstream effects of LDH and ATP production inhibition, such as decreased cell proliferation, decreased energy demand, activation of stress response pathways, etc.

      We thank reviewer for the careful reading of our manuscript, the accurate summary of the prevailing model, and the positive assessment of the rigor of our measurements. We agree that much prior literature reports increased oxygen consumption following LDH inhibition, and we recognize that our finding—coordinated suppression of glycolysis, the TCA cycle, and OXPHOS—differs from this prevailing interpretation. We address below the reviewer’s main concern regarding the 6-hour time point and clarify the conceptual scope of our study.

      (1) Scope: steady-state metabolic regulation versus immediate transient effects

      The reviewer raises an important point that many metabolic perturbations can trigger rapid, transient responses within seconds to minutes, whereas our measurements were performed after sustained LDH inhibition. We agree that very early time points would be required if the primary goal were to isolate the most immediate, proximal consequence of LDH inhibition before downstream propagation. However, the objective of our study is different: we aim to characterize the metabolic steady state re-established after sustained inhibition of LDH activity, because this adapted steady state is more relevant for understanding long-term metabolic consequences and therapeutic outcomes of LDH inhibition in cancer cells.

      (2) Genetic LDHA/LDHB knockout: comparison of two steady states

      A related point applies to the LDHA/LDHB knockout models. We fully agree that the knockout process necessarily involves a temporal perturbation during cell line generation and adaptation. Nevertheless, the experimental comparison in our study is explicitly between two steady states: the baseline steady state of control cells and the steady state achieved after stable genetic disruption of LDHA or LDHB. The observation that LDHA or LDHB knockout alone had minimal effects on glycolysis and respiration indicates that partial reduction of LDH activity can be compensated in a steady-state manner, consistent with the exceptionally high catalytic capacity of LDH in cancer cells relative to upstream rate-limiting enzymes.

      (3) LDH-activity-dependent quantitative relationships support stable metabolic states

      Importantly, our conclusions do not rely on a single inhibitor condition at a single time point. Rather, we established quantitative steady-state relationships between residual LDH activity and pathway behavior across a wide range of LDH inhibition. These LDH-activity-dependent data strongly support that the system resides in stable metabolic states at different degrees of LDH activity, rather than reflecting non-specific collapse due to prolonged stress.

      Specifically, we observed that when LDH activity was reduced from 100% to approximately ~9% (e.g., by genetic perturbation and partial pharmacologic inhibition), glucose consumption and lactate production remained essentially unchanged, indicating maintenance of a steady-state glycolytic flux despite substantial LDH inhibition. Only when LDH activity was further reduced below this threshold did glycolytic flux decrease in a graded manner, consistent with a nonlinear control structure (Figure 8 A & B)).

      Likewise, the isotope tracing results showed distinct LDH-activity-dependent transitions in TCA cycle labeling patterns. Over the range in which LDH activity decreased from 100% to ~9%, the [<sup>13</sup>C<sub>6</sub>]glucose-derived labeling pattern of citrate remained largely unchanged, whereas deeper inhibition led to a decrease in m2 citrate with a compensatory rise in higher-order citrate isotopologues, consistent with altered flux entry versus cycling/retention in the TCA cycle (Figure 8C). Similarly, [<sup>13</sup>C<sub>5</sub>]glutamine tracing revealed that deeper LDH inhibition reduced the direct m5 contribution, accompanied by corresponding shifts in other isotopologues (Figure 8D). These graded, quantitative transitions—rather than an abrupt global failure—support the interpretation of distinct metabolic steady states across LDH activity levels, linking LDH inhibition to changes in both glycolysis and mitochondrial metabolism.

      (4) Reconciling discrepancies with prior studies

      We agree that multiple prior studies have reported increased oxygen consumption or enhanced oxidative metabolism following LDH inhibition in cancer cells. However, we note that this prevailing notion often persists because LDH inhibition is frequently discussed by analogy to the classical Pasteur and Crabtree effects, in which cells toggle between fermentation and respiration depending on oxygen and glucose availability. We believe this analogy can be misleading.

      In the Pasteur effect, the metabolic shift is primarily driven by oxygen limitation, i.e., restriction of the terminal electron acceptor for the mitochondrial electron transport chain, which enforces reliance on fermentation. In the Crabtree effect, high glucose availability suppresses respiration through regulatory mechanisms while glycolysis is strongly activated. Both phenomena are fundamentally controlled by oxygen availability and respiratory capacity, rather than by inhibition of a specific cytosolic enzyme.

      By contrast, LDH inhibition is mechanistically distinct: it directly perturbs cytosolic redox recycling by limiting NADH-to-NAD<sup>+</sup> regeneration and can therefore constrain upstream glycolytic flux (particularly at GAPDH) and reshape pathway thermodynamics. Under conditions where LDH inhibition sufficiently limits effective NAD<sup>+</sup> availability and reduces glycolytic flux into pyruvate, the downstream consequence is reduced carbon input into the TCA cycle and suppressed OXPHOS—consistent with our experimental measurements. We therefore suggest that divergent outcomes reported across studies likely reflect differences in residual LDH activity, cell-type–specific metabolic wiring, and the extent to which glycolytic flux remains sustained versus becoming redox-limited upstream, rather than a universal Pasteur/Crabtree-like “switch” from fermentation to respiration. Accordingly, interpreting LDH inhibition as a Pasteur/Crabtree-like toggle may oversimplify the biochemical consequences of disrupting cytosolic NAD<sup>+</sup> regeneration.

      We have revised the Discussion to clarify this conceptual distinction and to avoid relying on comparisons that are not mechanistically equivalent to LDH inhibition.

      Reviewer #2 (Public Review):

      Summary:

      Zeng et al. investigated the role of LDH in determining the metabolic fate of pyruvate in HeLa and 4T1 cells. To do this, three broad perturbations were applied: knockout of two LDH isoforms (LDH-A and LDH-B), titration with a non-competitive LDH inhibitor (GNE-140), and exposure to either normoxic (21% O2) or hypoxic (1% O2) conditions. They show that knockout of either LDH isoform alone, though reducing both protein level and enzyme activity, has virtually no effect on either the incorporation of a stable 13C-label from a 13C6-glucose into any glycolytic or TCA cycle intermediate, nor on the measured intracellular concentrations of any glycolytic intermediate (Figure 2). The only apparent exception to this was the NADH/NAD+ ratio, measured as the ratio of F420/F480 emitted from a fluorescent tag (SoNar).

      The addition of a chemical inhibitor, on the other hand, did lead to changes in glycolytic flux, the concentrations of glycolytic intermediates, and in the NADH/NAD+ ratio (Figure 3). Notably, this was most evident in the LDH-B-knockout, in agreement with the increased sensitivity of LDH-A to GNE-140 (Figure 2). In the LDH-B-knockout, increasing concentrations of GNE-140 increased the NADH/NAD+ ratio, reduced glucose uptake, and lactate production, and led to an accumulation of glycolytic intermediates immediately upstream of GAPDH (GA3P, DHAP, and FBP) and a decrease in the product of GAPDH (3PG). They continue to show that this effect is even stronger in cells exposed to hypoxic conditions (Figure 4). They propose that a shift to thermodynamic unfavourability, initiated by an increased NADH/NAD+ ratio inhibiting GAPDH explains the cascade, calculating ΔG values that become progressively more endergonic at increasing inhibitor concentrations.

      Then - in two separate experiments - the authors track the incorporation of 13C into the intermediates of the TCA cycle from a 13C6-glucose and a 13C5-glutamine. They use the proportion of labelled intermediates as a proxy for how much pyruvate enters the TCA cycle (Figure 5). They conclude that the inhibition of LDH decreases fermentation, but also the TCA cycle and OXPHOS flux - and hence the flux of pyruvate to all of those pathways. Finally, they characterise the production of ATP from respiratory or fermentative routes, the concentration of a number of cofactors (ATP, ADP, AMP, NAD(P)H, NAD(P)+, and GSH/GSSG), the cell count, and cell viability under four conditions: with and without the highest inhibitor concentration, and at norm- and hypoxia. From this, they conclude that the inhibition of LDH inhibits the glycolysis, the TCA cycle, and OXPHOS simultaneously (Figure 7).

      Strengths:

      The authors present an impressively detailed set of measurements under a variety of conditions. It is clear that a huge effort was made to characterise the steady-state properties (metabolite concentrations, fluxes) as well as the partitioning of pyruvate between fermentation as opposed to the TCA cycle and OXPHOS.

      A couple of intermediary conclusions are well supported, with the hypothesis underlying the next measurement clearly following. For instance, the authors refer to literature reports that LDH activity is highly redundant in cancer cells (lines 108 - 144). They prove this point convincingly in Figure 1, showing that both the A- and B-isoforms of LDH can be knocked out without any noticeable changes in specific glucose consumption or lactate production flux, or, for that matter, in the rate at which any of the pathway intermediates are produced. Pyruvate incorporation into the TCA cycle and the oxygen consumption rate are also shown to be unaffected.

      They checked the specificity of the inhibitor and found good agreement between the inhibitory capacity of GNE-140 on the two isoforms of LDH and the glycolytic flux (lines 229 - 243). The authors also provide a logical interpretation of the first couple of consequences following LDH inhibition: an increased NADH/NAD+ ratio leading to the inhibition of GAPDH, causing upstream accumulations and downstream metabolite decreases (lines 348 - 355).

      Weaknesses:

      Despite the inarguable comprehensiveness of the data set, a number of conceptual shortcomings afflict the manuscript. First and foremost, reasoning is often not pursued to a logical conclusion. For instance, the accumulation of intermediates upstream of GAPDH is proffered as an explanation for the decreased flux through glycolysis. However, in Figure 3C it is clear that there is no accumulation of the intermediates upstream of PFK. It is unclear, therefore, how this traffic jam is propagated back to a decrease in glucose uptake. A possible explanation might lie with hexokinase and the decrease in ATP (and constant ADP) demonstrated in Figure 6B, but this link is not made.

      We appreciate the reviewer's critical comment. In Figure 3C, there is no accumulation of F6P or G6P, which are upstream of PFK1. This is because the PFK1-catalyzed reaction sets a significant thermodynamic barrier. Even with treatment using 30 μM GNE-140, the ∆G<sub>PFK1</sub> (Gibbs free energy of the PFK1-catalyzed reaction) remains -9.455 kJ/mol (Figure 3D), indicating that the reaction is still far from thermodynamic equilibrium, thereby preventing the accumulation of F6P and G6P.

      We agree with the reviewer that hexokinase inhibition may play a role, this requires further investigation.

      The obvious link between the NADH/NAD+ ratio and pyruvate dehydrogenase (PDH) is also never addressed, a mechanism that might explain how the pyruvate incorporation into the TCA cycle is impaired by the inhibition of LDH (the observation with which they start their discussion, lines 511 - 514).

      We agree with the reviewer’s comment. In this study, we did not explore how the inhibition of LDH affects pyruvate incorporation into the TCA cycle. As this mechanism was not investigated, we have titled the study:

      "Elucidating the Kinetic and Thermodynamic Insights into the Regulation of Glycolysis by Lactate Dehydrogenase and Its Impact on the Tricarboxylic Acid Cycle and Oxidative Phosphorylation in Cancer Cells."

      It was furthermore puzzling how the ΔG, calculated with intracellular metabolite concentrations (Figures 3 and 4) could be endergonic (positive) for PGAM at all conditions (also normoxic and without inhibitor). This would mean that under the conditions assayed, glycolysis would never flow completely forward. How any lactate or pyruvate is produced from glucose, is then unexplained.

      This issue also concerned me during the study. However, given the high reproducibility of the data, we consider it is true, but requires explanation. The PGAM-catalyzed reaction is tightly linked to both upstream and downstream reactions in the glycolytic pathway. In glycolysis, three key reactions catalyzed by HK2, PFK1, and PK are highly exergonic, providing the driving force for the conversion of glucose to pyruvate. The other reactions, including the one catalyzed by PGAM, operate near thermodynamic equilibrium and primarily serve to equilibrate glycolytic intermediates rather than control the overall direction of glycolysis, as previously described by us (J Biol Chem. 2024 Aug8;300(9):107648).

      The endergonic nature of the PGAM-catalyzed reaction does not prevent it from proceeding in the forward direction. Instead, the directionality of the pathway is dictated by the exergonic reaction of PFK1 upstream, which pushes the flux forward, and by PK downstream, which pulls the flux through the pathway. The combined effects of PFK1 and PK may account for the observed endergonic state of the PGAM reaction.

      However, if the PGAM-catalyzed reaction were isolated from the glycolytic pathway, it would tend toward equilibrium and never surpass it, as there would be no driving force to move the reaction forward.

      Finally, the interpretation of the label incorporation data is rather unconvincing. The authors observe an increasing labelled fraction of TCA cycle intermediates as a function of increasing inhibitor concentration. Strangely, they conclude that less labelled pyruvate enters the TCA cycle while simultaneously less labelled intermediates exit the TCA cycle pool, leading to increased labelling of this pool. The reasoning that they present for this (decreased m2 fraction as a function of DHE-140 concentration) is by no means a consistent or striking feature of their titration data and comes across as rather unconvincing. Yet they treat this anomaly as resolved in the discussion that follows.

      GNE-140 treatment increased the labeling of TCA cycle intermediates by [<sup>13</sup>C<sub>6</sub>]glucose but decreased the OXPHOS rate, we consider the conflicting results as an 'anomaly' that warrants further explanation. To address this, we analyzed the labeling pattern of TCA cycle intermediates using both [<sup>13</sup>C<sub>6</sub>]glucose and [<sup>13</sup>C<sub>5</sub>]glutamine. Tracing the incorporation of glucose- and glutamine-derived carbons into the TCA cycle suggests that LDH inhibition leads to a reduced flux of glucose-derived acetyl-CoA into the TCA cycle, coupled with a decreased flux of glutamine-derived α-KG, and a reduction in the efflux of intermediates from the cycle. These results align with theoretical predictions. Under any condition, the reactions that distribute TCA cycle intermediates to other pathways must be balanced by those that replenish them. In the GNE-140 treatment group, the entry of glutamine-derived carbon into the TCA cycle was reduced, implying that glucose-derived carbon (as acetyl-CoA) entering the TCA cycle must also be reduced, or vice versa.

      This step-by-step investigation is detailed under the subheading "The Effect of LDHB KO and GNE-140 on the Contribution of Glucose Carbon to the TCA Cycle and OXPHOS" in the Results section in the manuscript.

      In the Discussion, we emphasize that caution should be exercised when interpreting isotope tracing data. In this study, treatment of cells with GNE-140 led to an increase labeling percentage of TCA cycle intermediates by [<sup>13</sup>C<sub>6</sub>]glucose (Figure 5A-E). However, this does not necessarily imply an increase in glucose carbon flux into TCA cycle; rather, it indicates a reduction in both the flux of glucose carbon into TCA cycle and the flux of intermediates leaving TCA cycle. When interpreting the data, multiple factors must be considered, including the carbon-13 labeling pattern of the intermediates (m1, m2, m3, ---) (Figure 5G-K), replenishment of intermediates by glutamine (Figure 5M-V), and mitochondrial oxygen consumption rate (Figure 5W). All these factors should be taken into account to derive a proper interpretation of the data.

      Reviewer #3 (Public Review):

      Hu et al in their manuscript attempt to interrogate the interplay between glycolysis, TCA activity, and OXPHOS using LDHA/B knockouts as well as LDH-specific inhibitors. Before I discuss the specifics, I have a few issues with the overall manuscript. First of all, based on numerous previous studies it is well established that glycolysis inhibition or forcing pyruvate into the TCA cycle (studies with PDKs inhibitors) leads to upregulation of TCA cycle activity, and OXPHOS, activation of glutaminolysis, etc (in this work authors claim that lowered glycolysis leads to lower levels of TCA activity/OXPHOS). The authors in the current work completely ignore recent studies that suggest that lactate itself is an important signaling metabolite that can modulate metabolism (actual mechanistic insights were recently presented by at least two groups (Thompson, Chouchani labs). In addition, extensive effort was dedicated to understanding the crosstalk between glycolysis/TCA cycle/OXPHOS using metabolic models (Titov, Rabinowitz labs). I have several comments on how experiments were performed. In the Methods section, it is stated that both HeLa and 4T1 cells were grown in RPMI-1640 medium with regular serum - but under these conditions, pyruvate is certainly present in the medium - this can easily complicate/invalidate some findings presented in this manuscript. In LDH enzymatic assays as described with cell homogenates controls were not explained or presented (a lot of enzymes in the homogenate can react with NADH!). One of the major issues I have is that glycolytic intermediates were measured in multiple enzyme-coupled assays. Although one might think it is a good approach to have quantitative numbers for each metabolite, the way it was done is that cell homogenates (potentially with still traces of activity of multiple glycolytic enzymes) were incubated with various combinations of the SAME enzymes and substrates they were supposed to measure as a part of the enzyme-based cycling reaction. I would prefer to see a comparison between numbers obtained in enzyme-based assays with GC-MS/LC-MS experiments (using calibration curves for respective metabolites, of course). Correct measurements of these metabolites are crucial especially when thermodynamic parameters for respective reactions are calculated. Concentrations of multiple graphs (Figure 1g etc.) are in "mM", I do not think that this is correct.

      We thank the reviewer’s comment and the following are clarification of the conceptual framework, the quantitative methodology, and the experimental basis supporting our conclusions.

      (1) “It is well established that glycolysis inhibition or forcing pyruvate into the TCA cycle… leads to upregulation of TCA/OXPHOS… (authors claim lowered glycolysis leads to lower TCA/OXPHOS)”

      This framing is not accurate in the context of our study. PDK inhibition and LDH inhibition are fundamentally different perturbations. PDK inhibition directly promotes mitochondrial pyruvate oxidation by enabling PDH flux, whereas LDH inhibition primarily perturbs cytosolic redox balance (free NADH/NAD<sup>+</sup>) and thereby constrains upstream glycolytic reactions, particularly the GAPDH step. Therefore, the metabolic outcomes of these interventions are not expected to be identical and should not be treated as interchangeable.

      Importantly, we do not “ignore” prior studies proposing increased OXPHOS after LDH inhibition; we explicitly cite and summarize this prevailing interpretation in the Introduction. Our study was motivated precisely because this interpretation does not resolve key quantitative inconsistencies, including (i) the large mismatch between glycolytic flux and mitochondrial oxidative capacity, and (ii) the exceptionally high catalytic capacity of LDH relative to upstream rate-limiting glycolytic enzymes. These constraints raise a mechanistic question: how does LDH inhibition actually suppress glycolytic flux in intact cancer cells, and what are the consequences for TCA cycle and OXPHOS?

      Our central contribution is the identification of a biochemical mechanism supported by integrated measurements of fluxes, metabolite concentrations, redox state, and reaction thermodynamics: LDH inhibition increases free NADH/NAD<sup>+</sup>, decreases free NAD<sup>+</sup> availability, inhibits GAPDH, drives accumulation/depletion patterns in glycolytic intermediates, shifts Gibbs free energies of near-equilibrium reactions (PFK1–PGAM segment), suppresses pyruvate production, and consequently reduces carbon input into TCA cycle and OXPHOS. These analyses are not provided by most prior work and directly address the mechanistic gap.

      (2) Lactate signaling (Thompson/Chouchani) and metabolic modeling (Titov/Rabinowitz)

      These research directions are valuable, but they address questions that are different from the one investigated here. Our manuscript focuses on steady-state biochemical control of metabolic flux by LDH inhibition through redox-linked kinetics and pathway thermodynamics.

      (3) Pyruvate in RPMI

      Pyruvate in standard medium does not invalidate our conclusions. All experimental comparisons were performed under identical conditions across groups, and the major conclusions rely on orthogonal measurements including glycolytic flux (glucose consumption/lactate production), OCR profiling, and isotope tracing with [<sup>13</sup>C<sub>6</sub>]glucose and [<sup>13</sup>C<sub>5</sub>] glutamine, which directly quantify carbon entry into lactate and TCA cycle intermediates. These tracer-based results are not confounded by unlabeled extracellular pyruvate in a way that would reverse the mechanistic conclusions.

      (4) LDH activity assay in homogenates and “many enzymes can react with NADH”

      This concern is overstated. In the LDH assay, substrates are pyruvate + NADH, and the measured signal reflects NADH oxidation coupled to pyruvate reduction. In cell lysates, LDH is uniquely abundant and catalytically efficient for this reaction pair, and the inhibitor-response behavior matches the known LDHA/LDHB selectivity of GNE-140 and the cellular phenotypes. Thus, the assay is mechanistically specific in this context.

      (5) Enzyme-coupled metabolite assays and request for LC–MS validation

      The reviewer’s implication that enzyme-coupled assays are intrinsically unreliable is incorrect. Enzymatic cycling assays are a widely used quantitative approach when performed with proper specificity and calibration, and they are particularly useful for labile glycolytic intermediates that are challenging to quantify reproducibly by MS without specialized quenching, derivatization, and isotope dilution standards.

      We agree that MS-based quantification is valuable, and we have developed LC–MS methods for selected metabolites. However, absolute quantification of these intermediates remains technically difficult due to the inherent limitation of this method and, in our hands, did not provide uniformly robust performance for all intermediates required for thermodynamic analysis.

      (6) Units (“mM”)

      The metabolite concentration units are correct.

      Recommendations for the authors:

      Reviewer #1 (Recommendations For The Authors):

      If the goal is to investigate the direct impact of LDH inhibition, then in my opinion, most of these experiments need to be repeated at a very early time point immediately after or a few minutes after LDH inhibition. I understand that this is a tremendous amount of work that the authors might not want to pursue. I do want to highlight that the quality of the experiments performed in this work is impressive. I hope the authors continue investigating this subject and look forward to reading their future manuscripts on this topic.

      We thank the reviewer for this thoughtful and constructive comment and for the positive assessment of the experimental quality of our work.

      We fully agree that measurements at very early time points after LDH inhibition would be required if the goal were to isolate an immediate, proximal molecular event occurring before downstream propagation. However, the primary objective of our study is not to dissect a single instantaneous biochemical consequence of LDH inhibition, but rather to characterize the metabolic steady state that is re-established after sustained suppression of LDH activity, which we believe is more relevant for understanding the long-term metabolic and therapeutic consequences of LDH inhibition in cancer cells.

      (1) Scope: steady-state metabolic regulation versus immediate transient effects

      The reviewer raises an important point that many metabolic perturbations can trigger rapid, transient responses within seconds to minutes, whereas our measurements were performed after sustained LDH inhibition. We agree that very early time points would be required if the primary goal were to isolate the most immediate, proximal consequence of LDH inhibition before downstream propagation. However, the objective of our study is different: we aim to characterize the metabolic steady state re-established after sustained inhibition of LDH activity, because this adapted steady state is more relevant for understanding long-term metabolic consequences and therapeutic outcomes of LDH inhibition in cancer cells.

      (2) Genetic LDHA/LDHB knockout: comparison of two steady states

      A related point applies to the LDHA/LDHB knockout models. We fully agree that the knockout process necessarily involves a temporal perturbation during cell line generation and adaptation. Nevertheless, the experimental comparison in our study is explicitly between two steady states: the baseline steady state of control cells and the steady state achieved after stable genetic disruption of LDHA or LDHB. The observation that LDHA or LDHB knockout alone had minimal effects on glycolysis and respiration indicates that partial reduction of LDH activity can be compensated in a steady-state manner, consistent with the exceptionally high catalytic capacity of LDH in cancer cells relative to upstream rate-limiting enzymes.

      (3) LDH-activity-dependent quantitative relationships support stable metabolic states

      Importantly, our conclusions do not rely on a single inhibitor condition at a single time point. Rather, we established quantitative steady-state relationships between residual LDH activity and pathway behavior across a wide range of LDH inhibition. These LDH-activity-dependent data strongly support that the system resides in stable metabolic states at different degrees of LDH activity, rather than reflecting non-specific collapse due to prolonged stress.

      Specifically, we observed that when LDH activity was reduced from 100% to approximately ~9% (e.g., by genetic perturbation and partial pharmacologic inhibition), glucose consumption and lactate production remained essentially unchanged, indicating maintenance of a steady-state glycolytic flux despite substantial LDH inhibition. Only when LDH activity was further reduced below this threshold did glycolytic flux decrease in a graded manner, consistent with a nonlinear control structure.

      Likewise, the isotope tracing results showed distinct LDH-activity-dependent transitions in TCA cycle labeling patterns. Over the range in which LDH activity decreased from 100% to ~9%, the [<sup>13</sup>C<sub>6</sub>]glucose-derived labeling pattern of citrate remained largely unchanged, whereas deeper inhibition led to a decrease in m2 citrate with a compensatory rise in higher-order citrate isotopologues, consistent with altered flux entry versus cycling/retention in the TCA cycle. Similarly, [<sup>13</sup>C<sub>5</sub>]glutamine tracing revealed that deeper LDH inhibition reduced the direct m5 contribution, accompanied by corresponding shifts in other isotopologues. These graded, quantitative transitions—rather than an abrupt global failure—support the interpretation of distinct metabolic steady states across LDH activity levels, linking LDH inhibition to changes in both glycolysis and mitochondrial metabolism.

      Reviewer #2 (Recommendations For The Authors):

      All in all, the authors would benefit from collaboration with a group more well-versed in quantitative aspects of metabolism (such as Metabolic Control Analysis) and modelling methods (such as flux analysis) to boost the interpretation and impact of their really nice data set.

      We sincerely thank the reviewer for this insightful and constructive suggestion. We fully agree that collaboration with groups specializing in quantitative metabolic analysis, such as Metabolic Control Analysis and flux modeling, would further expand the interpretative depth and broader impact of this work.

      The primary objective of the present work, however, was not to construct a global mathematical model, but to experimentally dissect the biochemical mechanism by which LDH inhibition coordinately suppresses glycolysis, the TCA cycle, and OXPHOS, integrating enzyme kinetics with thermodynamic constraints at steady state. Within this scope, we focused on experimentally demonstrable relationships between LDH activity, redox balance, GAPDH perturbation, thermodynamic shifts in near-equilibrium reactions, and emergent flux suppression.

      We fully recognize the power of MCA and related modeling approaches in formalizing control coefficients and system-level sensitivities, and we view our dataset as particularly well suited to support such future analyses. We therefore see this work as providing a robust experimental platform upon which more comprehensive quantitative modeling can be built, either in future studies or through collaboration with specialists in metabolic modeling.

      Reviewer #3 (Recommendations For The Authors):

      We sincerely thank the reviewer for the important suggestions.

      (1) I strongly disagree that "regulation of glycolytic flux".. "remained largely unexplored.”

      Our original wording was meant to emphasize not the absence of prior work on glycolytic flux regulation, but rather that the specific biochemical mechanism by which LDH regulates glycolytic flux—particularly through the integrated effects of enzyme kinetics, redox balance, and thermodynamic constraints within the pathway—has not been fully elucidated.

      To avoid any ambiguity or overstatement, we have revised the relevant text to more precisely reflect this intent. The revised wording now reads:

      “This study elucidates a biochemical mechanism by which lactate dehydrogenase influences glycolytic flux in cancer cells, revealing a kinetic–thermodynamic interplay that contributes to metabolic regulation.”

      We believe this revised phrasing more accurately acknowledges prior work while clearly defining the specific mechanistic contribution of the present study.

      (2) Very confusing in the Introduction section: "If LDH is inhibited at the LDH step..”

      We sincerely thank the reviewer for pointing out the potential confusion caused by the phrase “If LDH is inhibited at the LDH step” in the Introduction.

      Our intention was to contrast two conceptual models of LDH inhibition. The first is the conventional view, in which the effect of LDH inhibition is assumed to be confined to the LDH-catalyzed reaction itself, leading primarily to local accumulation of pyruvate and its redirection toward mitochondrial metabolism. The second, which is supported by our data, is that LDH inhibition initiates a system-wide biochemical response, perturbing redox balance, upstream enzyme kinetics, and the thermodynamic state of the glycolytic pathway, ultimately resulting in coordinated suppression of glycolysis, the TCA cycle, and OXPHOS.

      We agree that the original phrasing was ambiguous and potentially misleading. To improve clarity, we have revised the text as follows:

      “If the effect of LDH inhibition were confined solely to its catalytic step…”

      (3) The entire introduction part when the authors attempt to explain how decreased glycolysis will lead to decreased mitochondrial respiration is confusing.

      We would like to clarify that the Introduction does not attempt to explain how decreased glycolysis leads to decreased mitochondrial respiration. Rather, the final paragraph of the Introduction is intended to highlight an unresolved conceptual inconsistency in the existing literature and to motivate the central question addressed in this study.

      Specifically, we summarize the prevailing view that LDH inhibition redirects pyruvate toward mitochondrial metabolism and enhances oxidative phosphorylation, and then point out that this interpretation is difficult to reconcile with quantitative considerations, such as the large disparity between glycolytic and mitochondrial flux capacities and the excess catalytic activity of LDH relative to upstream glycolytic enzymes. These observations are presented to emphasize that the biochemical mechanism linking LDH inhibition to changes in glycolysis and mitochondrial respiration has not been fully resolved.

      Importantly, the Introduction does not propose a mechanistic explanation for the observed suppression of mitochondrial respiration; rather, it poses this as an open question, which is then systematically addressed through experimental analysis in the Results section.

      (4) Line 144: "which is 81(HeLa-LDHAKO) -297(HeLa-Ctrl) times"- here and in many other places wording is confusing to the reader.

      Our intention was to emphasize the significant redundancy of LDH activity relative to hexokinase (HK), the first rate-limiting enzyme in the glycolysis pathway, in cancer cells.

      Specifically, we wanted to express that in HeLa-Ctrl cells, the total LDH activity is 297 times that of HK activity; while in HeLa-LDHAKO cells, although the total LDH activity decreased, it was still 81 times that of HK activity. This data comes from supplement Table 1 in the paper and aims to provide quantitative evidence for "why knocking out LDHA or LDHB alone is insufficient to significantly affect glycolysis flux," because the remaining LDH activity is still far higher than the HK activity at the pathway entrance, sufficient to maintain flux.

      Based on your suggestion, we rewrite it in the revised draft with a more specific statement: "...the total activity of LDH in HeLa cells is very high, which is 297-fold higher than the first rate-limiting enzyme HK activity in HeLa-Ctrl cells and 81-fold higher in HeLa-LDHAKO cells.”

      (5) Line 153: "in the following four aspects:"- but what are these aspects, the text below has no corresponding subtitles, etc.

      Our intention was to indicate that after LDHA or LDHB knockout alone failed to affect the glycolysis rate, we further explored its potential impact on the glycolytic pathway from four deeper perspectives: the glucose carbon to pyruvate and lactate, the glucose carbon to subsidiary branches of glycolysis, the concentration of glycolytic intermediates and the thermodynamic state of the pathway, and the redox state of cytosolic free NADH/NAD<sup>+</sup>.

      Following your valuable suggestion, we have now added the aforementioned clear subtitles to these four aspects in the revised manuscript.

      (6) Lines 193, another example of the very confusing statement: "The results suggested that the loss of total LDH concentration was compensated.."

      The actual catalytic activity (reaction rate) of LDH is determined by both its enzyme concentration and substrate concentration (pyruvate and NADH). When the total LDH protein concentration (enzyme amount) in the cell is reduced through gene knockout, the reaction equilibrium is disrupted. To maintain sufficient lactate production flux to support a high glycolysis rate, the cell compensates by increasing the concentration of one of the substrates—free NADH (as shown in Figure 1I). This results in an increased substrate concentration, despite a reduction in the amount of enzyme, thus partially maintaining the overall reaction rate.

      We have revised the original statement to more accurately describe this kinetic equilibrium process: "The decrease in total LDH concentration was counterbalanced by a concomitant increase in the concentration of its substrate, free NADH, thereby maintaining the reaction velocity.”

      (7) Line 222-223: "did not or marginally significantly affect....”

      Our intention is to reflect the complexity of the data in Figure 1. Specifically: Regarding "did not affect": This means that there were no statistically significant differences in most key parameters, such as glycolytic flux (glucose consumption rate, lactate production rate). Regarding "or marginally significantly affected": This means that in a few indicators, although statistical calculations showed p-values less than 0.05, the absolute value of the difference was very small, with limited biological significance.

      To clarify this, we rewrite it as: "...did not significantly affect glucose-derived pyruvate entering into TCA cycle, neither significantly affect mitochondrial respiration, although statistically significant but minimal changes were observed in a few specific parameters (e.g., m3-pyruvate% in medium).”

      (8) It is very confusing to use the same colors for three GNE-140 drug concentrations (Figure 2a-b) and for 3 different cell lines right next to each other (Figure 2c-d).

      The figures have been revised accordingly.

      (9) Lines 263-273: nothing is new here as oxidized NAD+ is required for run glycolysis and LDH inhibition/KO leads to a high NADH/NAD+ ratio; Also below it is well known that reductive stress blocks serine biosynthesis;

      It is well established that oxidized NAD<sup>+</sup> is required for glycolysis, that LDH inhibition or knockout increases the NADH/NAD<sup>+</sup> ratio, and that reductive stress can suppress serine biosynthesis. We did not intend to present these observations as novel.

      The key point of this section is not the qualitative requirement of NAD<sup>+</sup> for GAPDH, but rather the mechanistic alignment between LDH inhibition, changes in free NAD<sup>+</sup> availability, and the emergence of GAPDH as a flux-controlling step within the glycolytic pathway under steady-state conditions. Previous studies have largely treated the increase in NADH/NAD<sup>+</sup> following LDH inhibition as a correlative or downstream effect, without directly demonstrating how this redox shift quantitatively propagates upstream to reorganize glycolytic flux distribution and thermodynamic driving forces.

      In our study, we explicitly link LDH inhibition to (i) an increase in free NADH/NAD<sup>+</sup> ratio, (ii) inhibition of GAPDH activity in intact cells, (iii) accumulation of upstream glycolytic intermediates, (iv) suppression of serine biosynthesis from 3-phosphoglycerate, and critically, (v) coordinated shifts in the Gibbs free energies of reactions between PFK1 and PGAM. This integrated kinetic–thermodynamic framework goes beyond the established qualitative understanding of NAD<sup>+</sup> dependence and provides a pathway-level mechanism by which LDH activity controls glycolytic flux.

      (10) Lines 368-370: "... we reached an alternative interpretation of the data.."- does not provide much confidence.

      Our intention was to prudently emphasize that we proposed a new interpretation based on detailed data, differing from conventional views. Our interpretation is grounded in key and consistent evidence from dual isotope tracing experiments using [<sup>13</sup>C<sub>6</sub>]glucose and [<sup>13</sup>C<sub>5</sub>]glutamine: The [<sup>13</sup>C<sub>6</sub>]glucose tracing data: the labeling pattern of citrate, the starting product of TCA cycle, showed a significant decrease in m+2 %. This directly reflects a reduction in the flux of newly generated acetyl-CoA from glucose entering the TCA cycle. Simultaneously, the sum of other isotopologues % (m+1/ m+3/ m+4/m+5/m+6) increased, indicating a longer retention time of the labeled carbon in the cycle, implying a simultaneous decrease in the flux of cycle intermediates effluxed for biosynthesis. [<sup>13</sup>C<sub>5</sub>]Glutamine tracing data: the labeling pattern of α-ketoglutarate showed a decrease in m+5 %, indicating a reduction in glutamine replenishment flux. The pattern of change in the total percentage of other isotopologues % (m+1/ m+2/ m+3/m+4) also supports the conclusion of reduced intermediate product efflux.

      These two sets of data corroborate each other, pointing to a unified conclusion: LDH inhibition not only reduces carbon source inflow into the TCA cycle but also decreases intermediate product efflux, leading to a decrease in overall cycle activity. Therefore, our "alternative interpretation" is a well-supported and more consistent explanation of our overall experimental results. We revise the original wording to: "Integrated analysis of dual isotope tracing data demonstrates that LDH inhibition reduces both influx and efflux of the TCA cycle..."

      (11) Lines 418-421: This entire discussion on how TCA cycle activity is decreased upon LDH inhibition is very confusing. I also would like to see these tracer studies when ETC is inhibited with different inhibitors.

      We would like to clarify that the mitochondrial respiration rate data presented in Figure 5W are based on studies using different ETC inhibitors, and the cell treatment conditions (including culture time, etc.) for these oxygen consumption measurements are consistent with the conditions for the [<sup>13</sup>C<sub>6</sub>]glucose and [<sup>13</sup>C<sub>5</sub>]glutamine isotope tracing experiments (Figure 5A-V). Therefore, the changes in TCA cycle flux revealed by the tracing data and the inhibition of OXPHOS rate shown by the respiration measurements are mutually corroborating evidence from the same experimental conditions.

      (12) Figure 6F, G - very limited representation of growth curves, why not perform these experiments with all corresponding cell lines and over multiple days. Especially since proliferation arrest vs cell death was implicated.

      We have provided the growth curves of the HeLa-Ctrl and HeLa-LDHAKO cell lines under the corresponding treatments in Figure 6—figure supplement 1, as a supplement to Figure 6F, G (HeLa-LDHBKO cells). The choice of 48 hours as the cutoff observation point is based on clear biological evidence: under the stress of hypoxia (1% O<sub>2</sub>) combined with GNE-140 treatment, HeLa-LDHBKO cells experienced substantial death within 24 to 48 hours, at which point the differences in the growth curves were already very significant.

      (13) Move most of the Supplementary tables into an Excel file - so values can be easily accessed.

      We have compiled the tables into an Excel file and submitted it along with the revised manuscript as supplementary material.

      (14) Consider changing colors to more appealing- especially jarring is a bright blue, red, black combination on many bar graphs.

      We have adjusted the color scheme of the figures (especially the bar graphs) in the paper, and have submitted them with the revised manuscript.

      (15) Double check y-axis on multiple graphs it says "mM".

      We have checked y-axis, the unit (mM) is correct.

      (16) Instead TCA cycle use the TCA cycle.

      In the revised manuscript, TCA cycle is used.

    1. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      This paper by Karimian et al proposes an oscillator model tuned to implement binding by synchrony (BBS*) principles in a visual task. The authors set out to show how well these BBS principles explain human behavior in figure-ground segregation tasks. The model is inspired by electrophysiological findings in non-human primates, suggesting that gamma oscillations in early visual cortex implement feature-binding through a synchronization of feature-selective neurons. The psychophysics experiment involves the identification of a figure consisting of gabor annuli, presented on a background of gabor annuli. The participants' task is to identify the orientation of the figure. The task difficulty is varied based on the contrast and density of the gabor annuli that make up the figure. The same figures (without the background) are used as inputs to the oscillator model. The authors report that both the discrimination accuracy in the psychophysics experiment and the synchrony of the oscillators in the proposed model follow a similar "Arnold Tongue" relationship when depicted as a function of the texture-defining features of the figure. This finding is interpreted as evidence for BBS/gamma synchrony being the underlying mechanism of the figure-ground segregation.

      Note that I chose to use "BBS" over gamma synchrony (used by the authors) in this review, as I am not convinced that the authors show evidence for synchronization in the gamma-band.

      We thank the reviewer for their careful assessment of our manuscript and useful comments that we believe have served to strengthen our work.

      Strengths:

      The design of the proposed model is well-informed by electrophysiological findings, and the idea of using computational modeling to bridge between intracranial recordings in non-human primates and behavioral results in human participants is interesting. Previous work has criticized the BBS synchrony theory based on the observation that synchronization in the gamma-band is highly localized and the frequency of the oscillation depends on the visual features of the stimulus. I appreciate how the authors demonstrate that frequency-dependence and local synchronization can be features of BBS, and not contradictory to the theory. As such, I feel that this work has the potential to contribute meaningfully to the debate on whether BBS is a biophysically realistic model of feature-binding in visual cortex.

      Weaknesses:

      I have several concerns regarding the presented claims, assessment of meaning and size of the presented effects, particularly with regard to the absence of a priori defined effect sizes.

      Firstly, the paper makes strong claims about the frequency-specificity (i.e., gamma synchrony) and anatomical correlates (early visual cortex) of the observed effects. These claims are informed by previous electrophysiological work in non-human primates but are not directly supported by the paper itself. For instance, the title contains the word "gamma synchrony", but the authors do not demonstrate any EEG/MEG or intracranial data in from their human subjects supporting such claims, nor do they demonstrate that the frequencies in the oscillator model are within the gamma band. I think that the paper should more clearly distinguish between statements that are directly supported by the paper (such as: "an oscillator model based on BBS principles accounts for variance in human behavior") and abstract inferences based on the literature (such as "these effects could be attributed to gamma oscillations in early visual cortex, as the model was designed based on those principles").

      We thank the reviewer for this helpful comment and agree that the scope of our claims should be clearly delineated between what is directly supported by our data and what is theoretically inferred from prior literature.

      We revised the Abstract, Introduction, and early Discussion to moderate the strength of our statements and make the distinction explicit. The revised title now emphasizes that our study tests principles derived from prior work on gamma synchrony rather than directly demonstrating gamma activity in humans. Throughout the text, we use more cautious phrasing that highlights potential mechanisms and theoretical predictions. The intention of our study was not to position synchrony as the only viable mechanism of figure–ground perception. Rather, our goal was to reinvigorate it as a potential contender by showing that features often cited as limitations of synchrony-based binding may in fact be essential properties of the mechanism. We updated phrasing throughout the manuscript to make this clearer and avoid overstating the study’s contribution.

      Importantly, our model is not agnostic with respect to frequency band. Oscillator frequencies exhibited by model units are within the gamma range by design. Frequency emerges directly from the contrast within each oscillator’s receptive field, following an empirically established relationship between stimulus contrast and gamma frequency. To our knowledge, such a robust, quantitative relationship between stimulus features to exact oscillation frequency has not been consistently demonstrated for other frequency bands. This relationship yields gamma-band frequencies for all contrasts used in our simulations. The model is thus indeed a gamma oscillator model of V1, not a generic instantiation of Binding by Synchrony (BBS) principles.

      That said, we fully agree with the reviewer that our study cannot demonstrate a direct link between gamma synchrony in visual cortex and human behavior. Our behavioral and modeling results instead show that synchronization principles derived from gamma-band physiology in V1 can predict perceptual performance patterns. We now make this distinction explicit throughout the revised manuscript.

      Secondly, unlike the human participants, the model strictly does not perform figure-ground segregation, as it only receives the figure as an input.

      We thank the reviewer for the opportunity to clarify our modeling approach. We chose not to model the background to reduce computational cost, since including it requires a substantially larger number of oscillators without changing the model’s predictions. The model thus indeed only receives the figure region as input. We aimed to test the local grouping mechanism predicted by TWCO, rather than to simulate a full figure–ground segregation process including a read-out stage. Our model therefore isolates the conditions under which local synchrony emerges within the figure region, assuming that a downstream read-out mechanism (not explicitly modeled here) would detect regions of coherent activity. The exact nature of such a read-out mechanism was beyond the scope of our work.

      To confirm that our simplified model is a valid proxy, we ran additional simulations including the background and found that a coherent figure assembly reliably emerges, as can be seen in the phase-locking patterns relative to a reference oscillator at the center of the figure. This validates that the principles of local grouping we studied in isolation hold even when the figure is embedded in a noisy surround. We have added an explicit note in the Results (paragraph 2) that we only simulate the figure and added Supplementary Figure S1 showing the additional simulations.

      Finally, it is unclear what effect sizes the authors would have expected a priori, making it difficult to assess whether their oscillator model represents the data well or poorly. I consider this a major concern, as the relationship between the synchrony of the oscillatory model and the performance of the human participants is confounded by the visual features of the figure. Specifically, the authors use the BBS literature to motivate the hypothesis that perception of the texture-defined figure is related to the density and contrast heterogeneity of the texture elements (gabor annuli) of the figure. This hypothesis has to be true regardless of synchrony, as the figure will be easier to spot if it consists of a higher number of high-contrast gabors than the background. As the frequency and phase of the oscillators and coupling strength between oscillators in the grid change as a function of these visual features, I wonder how much of the correlation between model synchrony and human performance is mediated by the features of the figure. To interpret to what extent the similarity between model and human behavior relies on the oscillatory nature of the model, the authors should find a way to estimate an empirical threshold that accounts for these confounding effects. Alternatively, it would be interesting to understand whether a model based on competing theories (e.g., Binding by Enhanced Firing, Roelfsema, 2023) would perform better or worse at explaining the data.

      We thank the reviewer for these insightful and constructive comments, which have prompted additional analyses that we believe substantially strengthen our work. The reviewer raises two main points: (1) the need for a benchmark to assess our model’s performance, and (2) the concern that the relationship between model synchrony and behavior might be a non-causal “confound” of the visual features. We address each point below.

      (1) Benchmarking model performance

      We agree that it is important to assess how well our model performs relative to the data and included this in the original manuscript. We did not predefine an absolute good fit threshold because absolute agreement depends on irreducible noise and inter-subject variability, making a universal cutoff arbitrary. Instead, we had benchmarked model performance in two complementary ways. First, the noise ceiling shown in Figure 5 provides an empirical benchmark for the maximum fit any model could achieve on our data. Simulated Arnold tongues (based on synchrony) approach this ceiling achieving 89% of possible similarity for correlation and 79% of possible similarity for weighted Jaccard similarity, respectively. Second, the parameter sweep (Figure 3) situates our model’s performance within the broader parameter space. It shows that the model, whose key parameters were fixed a priori from independent macaque neurophysiological data, lies close to the optimal regime for explaining the human data. It also provides an estimate of the lower bound (worst-performing point) on the fit that a misspecified model implementing the identical mechanism would achieve. Our model with fixed a priori parameters does 1.41 times better than a misspecified model for the correlation fit metric and 3 times better for weighted Jaccard similarity.

      (2) Synchrony as mechanism vs. potential confound

      We appreciate the reviewer’s suggestion to test whether synchrony explains behavior beyond stimulus features. In our framework, synchrony is a near-deterministic function of the manipulated stimulus features given fixed model parameters. As a result, synchrony and the stimulus features are collinear (R<sup>2</sup>≈0.8) leaving no independent variance for synchrony to explain once stimulus features are included. Adding both into one statistical model yields unstable coefficients and no out-of-sample improvement.

      Mechanistically, we believe the relevant question is not whether synchrony explains behavior beyond stimulus features but whether synchrony is the correct transformation of the stimulus features to reproduce the behavioral pattern. Please note that in our design we ensured that mean contrast and luminance are identical in the figure and the background such that there are not more high-contrast Gabors in the figure than in the background. We did this with the aim to render mean contrast not a relevant feature. However, there are more high-contrast Gabors in the background, and it is conceivable that the absence of such high contrasts in the figure drives the detection/discrimination of the figure. We therefore agree that testing alternative models would further clarify the unique explanatory value of the synchrony mechanism. To that end, we derived two alternative rate-based readouts from the same V1 simulations of our model from which we derived synchrony. First, average firing rates inside the figure and second, the difference between average firing rates inside the figure and average firing rates in the background (rate difference). We analyzed each individually as predictors of behavior and performed a model comparison based on out-of-sample predictions. While rate difference (but not average firing) showed meaningful associations with performance when considered alone, the synchrony readout had a larger effect size and was favored by the model comparison. We added a new subsection comparing synchrony to rate-based alternatives in the Results (paragraphs 7-9), including additional Bayesian analyses and LOO-CV model comparison. Please note that the model comparison we added to the manuscript provides an additional benchmark beyond the map-level ceiling analysis. It indicates that the mapping from stimulus features to behavior via synchrony generalizes best without requiring an a priori good-fit threshold.

      We agree that formally comparing our model to a sophisticated rate-based alternative, such as an instantiation of the Binding by Enhanced Firing model, is an important direction for future work. However, it remains an open and non-trivial question whether such a model could quantitatively reproduce the precise shape of the behavioral Arnold tongue that emerges from the systematic manipulation of our stimulus parameters. Implementing and parameterizing such a model in a comparable, biologically grounded framework is a substantial undertaking that lies beyond the scope of the current study. Therefore, our goal here was not to claim exclusivity for synchrony-based mechanisms, but rather to re-evaluate their plausibility by showing that features often seen as limitations (stimulus dependence and frequency heterogeneity) are, in fact, essential characteristics of the TWCO framework that can predict complex behavioral outcomes.

      We would also like to clarify that our stimulus features were derived from theory rather than psychophysical literature. Starting from the principles of TWCO, we mapped frequency detuning and coupling strength onto known anatomical and physiological properties of early visual cortex, and only then derived the corresponding stimulus manipulations (contrast heterogeneity and grid coarseness). Demonstrating that these features predict behavior is therefore not trivial but constitutes a first empirical confirmation that the core TWCO variables match perception.

      Apart from adding analyses of additional rate-based readouts of our model, we also refined our discussion of the relationship between these and a synchrony-based mechanism.

      Reviewer #2 (Public review):

      The authors aimed to investigate whether gamma synchrony serves a functional role in figure-ground perception. They specifically sought to test whether the stimulus-dependence of gamma synchrony, often considered a limitation, actually facilitates perceptual grouping. Using the theory of weakly coupled oscillators (TWCO), they developed a framework wherein synchronization depends on both frequency detuning (related to contrast heterogeneity) and coupling strength (related to proximity between visual elements). Through psychophysical experiments with texture discrimination tasks and computational modeling, they tested whether human performance follows patterns predicted by TWCO and whether perceptual learning enhances synchrony-based grouping.

      We thank the reviewer for their thoughtful and constructive review. We believe the comments have served to improve our work.

      Strengths:

      (1) The theoretical framework connecting TWCO to visual perception is innovative and well-articulated, providing a potential mechanistic explanation for how gamma synchrony might contribute to both feature binding and separation.

      (2) The methodology combines psychophysical measurements with computational modeling, with a solid quantitative agreement between model predictions and human performance.

      (3) In particular, the demonstration that coupling strengths can be modified through experience is remarkable and suggests gamma synchrony could be an adaptable mechanism that improves with visual learning.

      (4) The cross-validation approach, wherein model parameters derived from macaque neurophysiology successfully predict human performance, strengthens the biological plausibility of the framework.

      Weaknesses:

      (1) The highly controlled stimuli are far removed from natural scenes, raising questions about generalisability. But, of course, control (almost) excludes ecological validity. The study does not address the challenges of natural vision or leverage the rich statistical structure afforded by natural scenes.

      We agree with the reviewer that the insights of the present study are limited to texture stimuli and have made adjustments in the Discussion (final two paragraphs) to avoid claiming generalizability to natural stimuli. We have also adjusted the title to specifically limit our results to texture stimuli. To establish the principles of TWCO, we needed tight control over the stimulus, but are intrigued by the idea to investigate natural scenes. We have added to our Discussion (paragraph 9) that future should evaluate to what extent the principles we investigate here apply to natural scenes. Synchrony-based mechanisms have been successfully used for image segmentation tasks in machine vision, showing that the proposed mechanism can in principle work for natural scenes.

      (2) The experimental design appears primarily confirmatory rather than attempting to challenge the TWCO framework or test boundary conditions where it might fail.

      We thank the reviewer for this important point. Our primary motivation was to address the neurophysiological properties of gamma synchrony that have been suggested to severely challenge the binding by synchrony mechanism. Particularly the strong dependence of gamma oscillations and synchrony on stimulus features. Our goal was to show that from the perspective of TWCO, these challenges become expected components of the mechanism. In essence, we wanted to promote a conceptual shift that converts what pushes a theory to its limit into something that is actually its central tenet. To facilitate this shift, we designed the experiment to directly test this core tenet.

      While our approach was designed to test a central prediction of TWCO rather than explicitly challenge its boundaries, we respectfully argue that it was far from a simple confirmatory experiment. The design incorporated high-risk elements that provided considerable room for both the theory and our model to fail. First, the core prediction itself was non-obvious and highly specific. We did not simply test whether contrast heterogeneity and grid coarseness affect perception. We tested the stronger hypothesis that they would reflect a specific, interactive trade-off (the behavioral Arnold tongue) as specified by TWCO. Second, our modeling approach was deliberately constrained to provide a further stringent test. We did not post-hoc optimize the model's key parameters to fit our behavioral data. Instead, we fixed them a priori based on independent neurophysiological data from macaques. This was a high-risk choice, as a mismatch between a priori model predictions and the human data would have seriously challenged the framework's generalizability.

      We agree that future research should further challenge TWCO. For instance, by using stimuli that require segregating several objects simultaneously or objects that cover more extensive regions of the visual field.

      (3) Alternative explanations for the observed behavioral effects are not thoroughly explored. While the model provides a good fit to the data, this does not conclusively prove that gamma synchrony is the actual mechanism underlying the observed effects.

      We agree that our results do not conclusively show that gamma synchrony is the actual mechanism underlying figure-ground segregation. We admit that the original phrasing used throughout the manuscript was too strong and gave the impression that we wanted to establish exactly that. However, the goal of our work was only to reinvigorate gamma synchrony as a potential contender by showing that features often cited as limitations of synchrony-based binding may in fact be essential properties of the mechanism. We have revised the title and made adjustments throughout the manuscript to better reflect this more moderate goal.

      Additionally, we added tests of alternatives (Results, paragraphs 7–9) to clarify the unique explanatory value of the synchrony mechanism. To that end, we derived two alternative rate-based readouts from the same V1 simulations of our model. First, we extracted average firing rates inside the figure. Second, we computed the difference between average firing rates inside the figure and average firing rates in the background (rate difference). We analyzed each individually as predictors of behavior and performed a model comparison between these two and synchrony based on out-of-sample predictions. While the rate difference (but not average firing) showed meaningful associations with performance when considered alone, the synchrony readout had a larger effect size and was favored by the model comparison.

      (4) Direct neurophysiological evidence linking the observed behavioral effects to gamma synchrony in humans is absent, creating a gap between the model and the neural mechanism.

      We agree that the model only provides a how-possibly account linking stimulus features to performance. Showing that the brain actually relies on this mechanism would require showing that cortical synchrony mediates the effect of stimulus features on behavior beyond firing rates. Collecting such data would constitute a major effort that would go beyond the scope of this study. We acknowledge the need for electrophysiological data and the mediation analysis in the updated Discussion.

      Achievement of Aims and Support for Conclusions:

      The authors largely achieved their primary aim of demonstrating that human figure-ground perception follows patterns predicted by TWCO principles. Their psychophysical results reveal a behavioral "Arnold tongue" that matches the synchronization patterns predicted by their model, and their learning experiment shows that perceptual improvements correlate with predicted increases in synchrony.

      The evidence supports their conclusion that gamma synchrony could serve as a viable neural grouping mechanism for figure-ground segregation. However, the conclusion that "stimulus-dependence of gamma synchrony is adaptable to the statistics of visual experiences" is only partially supported, as the study uses highly controlled artificial stimuli rather than naturalistic visual statistics, or shows a sensitivity to the structure of experience.

      Likely Impact and Utility:

      This work offers a fresh perspective on the functional role of gamma oscillations in visual perception. The integration of TWCO with perceptual learning provides a novel theoretical framework that could influence future research on neural synchrony.

      The computational model, with parameters derived from neurophysiological data, offers a useful tool for predicting perceptual performance based on synchronization principles. This approach might be extended to study other perceptual phenomena and could inspire designs for artificial vision systems.

      The learning component of the study may have a particular impact, as it suggests a mechanism by which perceptual expertise develops through modified coupling between neural assemblies. This could influence thinking about perceptual learning more broadly, but also raises questions about the underlying mechanism that the paper does not address.

      Additional Context:

      Historically, the functional significance of gamma oscillations has been debated, with early theories of temporal binding giving way to skepticism based on gamma's stimulus-dependence. This study reframes this debate by suggesting that stimulus-dependence is exactly what makes gamma useful for perceptual grouping.

      The successful combination of computational neuroscience and psychophysics is a significant strength of this study.

      The field would benefit from future work extending (if possible) these findings to more naturalistic stimuli and directly measuring neural activity during perceptual tasks. Additionally, studies comparing predictions from synchrony-based models against alternative mechanisms would help establish the specificity of the proposed framework.

      Recommendations for the authors:

      Reviewing Editor Comments:

      In a joint discussion to integrate the peer reviews and agree on the eLife recommendations, both reviewers agreed that the work is valuable, but they were on the fence about whether the strength of evidence was incomplete or solid, eventually settling on incomplete. The reviewers make several recommendations for improving these ratings, which I (Reviewing Editor) have organised into 3 points below, with point 1 of particular importance. Underneath the summary, please see the individual recommendations of the reviewers.

      (1) Strengthen evidence for the unique role of gamma synchrony in explaining the data, and ensuring claims are directly supported by relevant data:

      Reviewers 2 and 3 both note the lack of direct evidence for gamma involvement, and reviewer 2 observes that the fit with behaviour may trivially be explained by a relationship between contrast heterogeneity and grid coarseness without need for oscillation. The reviewers felt that the approach of fitting the model to human data could be strengthened to help address this issue - and they offer various solutions, e.g., more principled a-priori criteria around good vs bad fit of the model to both main task and training data, and comparison to alternative binding models (Reviewer 2), identifying and testing boundary conditions of the model (Reviewer 3). There is also the possibility of collecting direct human neurophysiological evidence linking the behavioural data to neural mechanisms. Our discussion also highlighted the need to weaken claims (including in the title) where links are not directly demonstrated by methods from the present study, e.g., resting on indirect comparisons to primate literature.

      We agree with the editor and reviewers that this was a critical point. To address it, we have made several major revisions.

      As suggested, we have weakened claims where the links are not directly demonstrated by our data. The title has been revised to be more specific, and we have carefully edited the abstract, introduction, and discussion to distinguish between our model's predictions and direct neurophysiological evidence.

      To address the concern that our model's fit might be trivially explained by visual features, we have performed a new analysis comparing the synchrony-based readout to two alternative rate-based readouts from the same V1 simulations. This new comparison shows that the synchrony readout provides a superior out-of-sample prediction of human behavior.

      While a full implementation of a competing theory like "Binding by Enhanced Firing" would be a valuable next step, we note that parameterizing such a model in a comparably grounded framework is a substantial undertaking beyond the scope of the present study. Our new analysis provides an important first step in this direction.

      (2) Make explicit and address the limitations of the stimuli:

      Include that the model is not extracting the figure from the background, and the controlled stimuli may limit generalizability.

      To address the concern that our model was not performing true figure-ground extraction, we performed a new set of simulations that included both the figure and the immediate background. The results confirm that synchrony dynamics within the figure region are not affected by the presence of the background. We added these validation results as supplementary materials. We have additionally made the modeling choice and its justification more explicit in the Results and Methods sections.

      We have revised the Discussion to be more explicit about the limitations of using highly controlled texture stimuli. We now clearly state that our findings are specific to this context and that further research is required to determine if these principles generalize to the segregation of objects in natural scenes.

      (3) Some clarifications to make more accessible:

      Include the figure explaining the framework (Reviewers 1&2), and also the model details (Reviewer 2).

      We have revised Figure 1 and its caption to more clearly illustrate the links from TWCO principles to their neural implementation in V1 and the resulting behavioral predictions.

      We have expanded the Methods section to provide a more detailed and accessible description of the model's construction. We now clarify precisely how the oscillator grid was defined in visual space, how eccentricity-dependent receptive field sizes were implemented, and how these were mapped onto a retinotopic cortical surface to determine coupling strengths.

      Reviewer #1 (Recommendations for the authors):

      (A) Major concerns:

      (1) My main concern:

      My main concern is the repeated claims that the observed findings can be attributed to gamma synchrony in the early visual cortex. I find this claim misleading as the authors do not report any electrophysiological data that directly supports such claims. As stated in my public review, I feel that the authors should be clear about direct evidence versus more abstract inferences based on the literature.

      In particular, I recommend changing claims about "gamma synchrony" to "Binding by Synchrony" That being said, the authors can outline that the model was built under the assumption that this synchrony is mediated by gamma in early visual cortex, but I don't think it should be part of their main conclusions.

      We appreciate that TWCO’s general principles are frequency-agnostic and can be viewed as binding by synchrony in a broad sense. Our work, however, specifically instantiates these principles in V1 gamma: the model reflects TWCO dynamics together with V1 anatomy/physiology and the well-established contrast–frequency relationship in the gamma range (which, to our knowledge, has not been demonstrated with comparable specificity for other bands). In that sense, it is a gamma oscillator model of V1, rather than a generic BBS instantiation. Moreover, stimulus dependencies often cited as challenges to BBS have been used in particular to argue against gamma; showing that these very dependencies are integral to the TWCO mechanism is central to our contribution, and we therefore keep our conclusions focused on the gamma-specific instantiation tested here.

      (2) Mediation of the observed effects by the visual features of the figure:

      The authors motivate the hypothesis that BBS predicts that the perception of texture-defined objects depends on the density of texture elements and their contrast heterogeneity. This hypothesis seems trivial as those are the features that distinguish figure from ground. I think it would be important to clarify how this hypothesis is unique to BBS and not explained by competing theories, such as Binding by Enhanced Firing (Roelfsema, 2023). The authors should be clear about what part of the hypothesis is not trivial based on the task and clearly attributable to oscillators and synchrony.

      Our stimulus features were derived from theory rather than psychophysical literature. Starting from the principles of TWCO, we mapped frequency detuning and coupling strength onto known anatomical and physiological properties of early visual cortex, and only then derived the corresponding stimulus manipulations (contrast heterogeneity and grid coarseness). We agree that grid coarseness (element distance) is an established facilitator of figure–ground perception. By contrast, contrast heterogeneity (feature variance) is less commonly emphasized as a figure–ground cue, compared to mean-based cues, but follows directly from TWCO’s frequency detuning. Importantly, mean contrast and luminance were matched exactly between figure and background in our stimuli. Demonstrating that contrast heterogeneity and grid coarseness not only independently affect figure-ground perception, but reflect a trade-off where higher heterogeneity needs to counteracted by reduced grid coarseness in the way TWCO specifies is therefore non-obvious and provides an initial empirical indication that the core TWCO variables might shape perception. We also agree that alternative models would further clarify the unique explanatory value of synchrony. In the revised manuscript, we compare rate-based readouts (mean figure rate; figure–background rate difference) with the synchrony readout from the same simulations. Rate difference indeed constitutes a predictor of performance, but the synchrony readout showed a larger effect and was preferred by out-of-sample model comparison.

      Using a linear model, the authors assess the relationship between discrimination accuracy and synchrony. Did the authors also include the factors grid coarseness and contrast heterogeneity in this model? Again, as both the task performance (as shown by the GEE analysis) and oscillatory synchrony depend on these features, the relationship between model and behavioral performance will be mediated by the visual features.

      Thank you for raising this. In our framework, detuning (via contrast heterogeneity) and coupling (via grid coarseness) are the inputs, synchrony is the proposed mechanistic mediator, and behavior is the output. Because synchrony in our model is a (near-)deterministic function of the manipulated features under fixed parameters, a joint features+synchrony regression is statistically ill-posed (perfect multicollinearity up to numerical error) and cannot add information. A proper mediation test would require trial-wise neural measurements of synchrony in the same task, which we do not have and acknowledge as a limitation in the Discussion. Accordingly, we show that both the features themselves (reflecting TWCO principles) and model-derived synchrony (realizing the proposed pathway) account for behavior.

      We agree this does not establish a unique contribution of synchrony. To probe alternatives, we added rate-based readouts and a model comparison to the revised manuscript. These additional analyses indicate that synchrony outperforms simple rate-based mappings. We do not claim this rules out more sophisticated rate-based mechanisms. Our aim is to demonstrate that synchrony is a viable, behaviorally informative readout for downstream processing. We do not assert it is the only mechanism the brain uses. Synchrony had been discounted due to its stimulus dependence; our results are intended to rule it back in. We have made changes throughout the manuscript to better reflect this more modest aim.

      (3) Goodness of fit measures are not established a prior:

      I have described this concern in my public review. It is hard to assess what the authors would have interpreted as a good or a bad fit, especially without accounting for the confound in the relationship between oscillator synchrony and behavior. Similarly, when assessing the similarity between the behavioral and dynamic Arnold Tongues across different coupling parameters, the authors found that the chosen parameters (based on macaque data) were not optimal. They offer the explanation that the human cortex has a lower coupling decay than the macaque cortex, and the similarity is higher for lower values of coupling decay. While this explanation is not entirely implausible, it is unclear where an oscillator model with human values would be in the presented plot, as the authors didn't estimate those values from the human studies. Moreover, the task used in the Lowet et al., 2017 paper is very different from the task presented here, which could also account for differences. Overall, the explanation appears hand-wavy considering the lack of empirically defined goodness of fit measures.

      Thank you for these concerns.

      We did indeed not provide a priori thresholds for what would be considered good fit. Instead, we used two complementary benchmarks; namely noise ceilings and parameter exploration. The former provides an upper bound on what any model (not just ours but based on completely different mechanisms) could achieve given our data. The parameter sweep provides an indication how well our concrete model can maximally fit the data and how bad it can be based on possible parameters. These benchmarks are more informative than a fixed a-priori cutoff, which would depend on unknown noise and inter-subject variability. Both the noise ceiling and the parameter exploration indicate that our model, using a priori fixed parameters, performs well. Additionally, we redid all our statistical analyses after z-normalizing every predictor to provide easier interpretation of effect sizes.

      Regarding the reason that key model parameters were not optimal, we believe our interpretation to be plausible. We agree that we currently do not have data to estimate the exact human decay factor and hence cannot establish how much model fit would be affected. However, the parameter exploration in Figure 3 shows that small to modest reductions in decay would improve model fit. We discuss this now in the revised manuscript.

      The reviewer’s suggestion is intriguing. While Lowet et al. (2017) used a different task, the parameters we took from their work (decay rate and maximum coupling) are intended to reflect anatomical properties and thus should not be task-dependent. That said, Lowet et al. ‘s data carry uncertainty, so our estimates may not be exact; we note this explicitly in the revised Discussion. Whether a different task would have yielded better parameter estimates is difficult to determine, but we considered Lowet’s paradigm appropriate because it was designed to target the same V1 anatomical and physiological properties that map onto TWCO.

      I have concerns about a similar confound in the training effects. If I'm not mistaken, the Hebbian Learning rule encourages synchronization between the oscillators in the grid. As such, it causes synchronization to increase over several simulations. Clearly, the task performance of the participants also improves over the sessions. Again, an empirical threshold would be required to assess whether the similarity in learning between model and performance goes beyond what is expected based on learning alone. How much of these effects can be attributed to the model being oscillatory?

      The reviewer is correct that, in our framework, learning operates via changes in coupling that increase synchrony. Enhanced synchrony is the proposed (and in our model also the actual) pathway by which learning impacts behavior. We agree that learning could, in principle, act through pathways other than synchrony. Demonstrating this would not be achieved by a mediation analysis here, because that requires independent, trial-level neural measurements of the candidate pathways (synchrony and alternatives). In the absence of such data, the appropriate approach would be model comparison between competing mechanistic readouts. We have added such a model comparison for a synchrony readout versus two rate-based readouts derived from the same simulations for the first session; i.e., focusing on the pathway from stimulus features to behavior. However, a similar model comparison is not possible for learning. As we show in the supplementary materials, rate-based readouts of our V1 model are not at all affected by coupling strength. As such, they are insensitive to changes in coupling and are thus not viable as alternative mechanisms to explain performance changes due to learning. A fair test of rate-based alternatives would require building a detailed rate-based figure–ground segregation model that predicts session-wise changes. We agree that this is an important next step but it is also substantial undertaking beyond the scope of the present study.

      (4) Similarly, for the comparison of the Arnold Tongue in the transfer session and the early session:

      In the first part of the Results section, it says: "Our model rests on the assumption that learning-induced structural changes in early visual cortex are specific to the retinotopic locations of the trained stimuli. We evaluated whether this assumption holds for our human participants using the transfer session following the main training period. [...] If learning is indeed local, participants' performance in the transfer session should resemble that of early training sessions, indicating a reset in performance for the new retinal location."

      The authors find that a model fit to session 3 explains the data in the transfer session best and consider this as evidence for the above-stated expectation. Again, it is unclear where the cutoff would have been for a session to be declared as early or late. For instance, had the participants only performed 4 sessions, would the performance be best explained by session 3 or session 1?

      A high number of statistical tests are used, which, firstly, need to be corrected for multiple comparisons (did the authors do this?). Secondly, I feel that the regression models could be improved. For instance, the authors fit one model per session and then assess how well each model explains the variance in the transfer session. I think the authors might want to opt for one model with the regressors contrast heterogeneity, grid coarseness, and session (and their interaction). Using this approach, the authors would still be able to assess which session predicts the data best. Similarly, interindividual variability could be accounted for by adding participant-specific random effects to the model (and using a mixed model), instead of fitting individual models per participant.

      We agree the “early vs late” cutoff was underspecified. In the revision, we predefine Session 2 as the early-learning reference, excluding Session 1 to avoid familiarization/response–mapping effects. We then fit a single Bayesian hierarchical model with contrast heterogeneity, grid coarseness, and session, plus a transfer indicator, and participant-level random effects. This allows us to place the transfer session on the same scale as training and to test a) whether the transfer session precedes the state in session 2 via the posterior contrast P(βtransfer<βSess2) and b) whether it is indistinguishable from the state in session two using an equivalence test derived from the fitted model. We find that the transfer session is equivalent to session 2. We added this updated analysis of the transfer session in the Results (paragraph 15).

      In response to the suggestion to use a hierarchical regression model for analyzing the transfer session, we have decided to use such a model for all our analyses in a Bayesian framework. In this Bayesian framework, inference is based on the joint posterior (credible intervals/equivalence) of all predictors in a model and additional post-hoc multiplicity corrections are not required.

      (5) Questions regarding the model:

      What does it mean that the grid was "defined in visual space"? How biologically plausible with regard to the retinotopy and organization of the oscillators do the authors claim the model to be?

      We are happy to clarify this point. We have a total of 400 oscillators reflecting neural assemblies in V1. We start by defining a regular, 20x20, grid of the receptive field (RF) centers of these oscillators inside the figure region. Each oscillator is then also assigned a RF size based on the eccentricity of its RF center. We use the threshold-linear relationship between RF eccentricity and RF size reported in [1] to assign RF sizes. Each oscillator thus has an individual, eccentricity-dependent, RF size.

      For the coupling between oscillators, we need to know their cortical distances. We obtain these by first determining the cortical location of each oscillator through a complex-logarithmic topographic mapping of neuronal receptive field coordinates onto the cortical surface [2,3]. For this mapping, we use human parameter values estimated by [4]. From these cortical locations, we then compute pairwise Euclidean distances.

      The model thus captures realistic retinotopy, eccentricity-dependent RF sizes, and distance-dependent coupling on the cortical surface. We have adjusted our Methods to make these steps clearer.

      (1) Freeman, J., & Simoncelli, E. P. (2011). Metamers of the ventral stream. Nature neuroscience, 14(9), 1195-1201.

      (2) Balasubramanian, M., & Schwartz, E. L. (2002). The isomap algorithm and topological stability. Science, 295(5552), 7. https://doi.org/10.1126/science.1066234

      (3) Schwartz, E. L. (1980). Computational anatomy and functional architecture of striate cortex: a spatial mapping approach to perceptual coding. Vision Research, 20(8), 645–669. http://www.sciencedirect.com/science/article/pii/0042698980900905

      (4) Polimeni, J. R., Hinds, O. P., Balasubramanian, M., van der Kouwe, A. J. W., Wald, L. L., Dale, A. M., & Schwartz, E. L. (2005). Two-dimensional mathematical structure of the human visuotopic map complex in V1, V2, and V3 measured via fMRI at 3 and 7 Tesla. Journal of Vision, 5(8), 898. https://doi.org/10.1167/5.8.898

      Similarly, do the authors claim that each gabor annuli stimulates a single receptive field in V1?

      We hope that with the additional explanation above, it is clearer that there is not a one-to-one mapping. Each oscillator samples the local image by pooling over all Gabor annuli that overlap its receptive field (partially or fully) and computes the average contrast within its RF. Conversely, a single annulus typically overlaps multiple RFs and contributes to each in proportion to the overlap.

      I am unsure how the oscillators were organized, if not retinotopically. How is the retinotopic input fed into the non-retinotopically arranged oscillators?

      We hope that with the additional explanation above, it is clearer that the network is strictly retinotopic.

      The frequency of each oscillator changes according to ω=2πv with ν=25+0.25C. How were the values for the linear regression in v chosen? Reference?

      The slope and intercept parameters for this equation were first reported in [5]. We added the reference to the Methods.

      (5) Lowet, E., Roberts, M., Hadjipapas, A., Peter, A., van der Eerden, J., & De Weerd, P. (2015). Input-dependent frequency modulation of cortical gamma oscillations shapes spatial synchronization and enables phase coding. PLoS computational biology, 11(2), e1004072.

      (6) Hebbian Learning Rule:

      I am confused about how the effective learning rate E= ∈t is calculated. It is said that it is estimated based on the similarity between the second experimental session and the distribution of synchrony after letting the model learn. How can the model learn without knowing epsilon and t?

      We agree with the reviewer that our procedure to estimate the effective learning rate requires further clarification. We performed a nested grid search. Essentially, we let the model learn between session 1 and 2 with each of 25 candidate effective learning rates and evaluate how well each of them allow the model to fit performance in session 2. We then select the best effective learning rate and create a new, smaller, grid around this value and repeat that procedure. In total we perform 5 nested grids to arrive at the final effective learning rate. We expanded the explanation in the Methods.

      (B) Minor concerns:

      (1) Small N: 2/3 of the studies that were cited to justify the small sample were notably different from the current experiment, i.e., Intoy 2020 is an eye movement task, Lange 2020 is a memory task (Tesileanu 2020 is more similar). I think a power analysis would be great to support, as the sample size seems quite low

      Our study uses a within-subject design with ~750 trials per session (≈6,000 total) per participant, analyzed with a hierarchical model that pools information across trials and participants. To assess adequacy, we ran a simulation-based design analysis using the fitted hierarchical model (i.e., post hoc, based on the observed variance components). This analysis indicated a detection probability >90% for all key effects. We now report the results of this design analysis in the (Supplementary Table 1) and note this in the Results (paragraph 1).

      Regarding the literature context, we agree the cited studies are not identical to ours; we referenced them to illustrate a common practice (small N with many trials) when targeting low-level, early-visual mechanisms. Intoy (pattern/contrast sensitivity) and Lange (perceptual learning in early vision) share that focus, while Tesileanu is methodologically closest.

      (2) Figure 1 could be more informative and better described in the text. The authors often don't refer to the panels in Figure 1. Maybe it would help to swap a and b to describe the Arnold tongue first? It might also be a good idea to add the coupling strength and frequency detuning axes

      We have swapped panels a and b and now refer to each panel in the main text to enhance clarity.

      (3) Values of rho (distance - is this degrees visual angle)? Do the authors assume that the size of the stimuli corresponds to receptive fields in V1? If so, how is this justified?

      The center-to-center distance between any pair of neighboring annuli is indeed expressed in degrees of visual angle. Rho is a scaling factor for this distance. With rho=1, the center-to-center distance corresponds to the diameter of the annuli; i.e., they touch but do not overlap each other. We do not assume any relation between the size of receptive fields and the size of the annuli. Receptive field sizes in our model are purely determined by their eccentricity and each oscillator can have several annuli within its receptive field while each annulus can fall within several overlapping receptive fields of different oscillators. We believe that the schematic illustration in Figure 1 might have given the impression that each oscillator sees exactly one annulus and added a note that this is not the case and merely an oversimplification to illustrate the relationship between contrast and intrinsic frequency.

      (4) Some equations are embedded in the text, and some are not. It might be easier to find the respective equation if they all have an index. For instance, the authors mention the psychometric function that relates model synchrony and performance in the results section. It would be easier to find if it had an index that the authors could refer to.

      We moved this equation as well as the contrast intrinsic frequency mapping from inline to displayed and numbered them.

      (5) Is there a reference for "Our model rests on the assumption that learning-induced structural changes in early visual cortex are specific to the retinotopic locations of the trained stimuli"? (If so, it should be cited.)

      We added references supporting this assumption.

      (6) Figure 2b: colorbar missing label.

      We added the label.

      Reviewer #2 (Recommendations for the authors):

      Cool work!

      (1) The reader would benefit from (a single) comprehensive figure that visually explains the entire conceptual framework-from TWCO principles to neural implementation to behavioural predictions-accessible to readers without specialised knowledge of oscillatory dynamics. This will give the paper a greater impact.

      We have adjusted Figure 1 in accordance with suggestions made by reviewer 1 and added further explanations to the caption and the Introduction to enhance clarity on how the principles of TWCO relate to neural implementation.

      (2) I think this paper would benefit from the audience eLife provides, but the paper could move closer to the audience.

      (3) Pride comes before the fall, but I am not the most uninformed reader, and it took me some effort to process everything.

      Thank you, we took this to heart. In the Introduction, we now state more explicitly how each variable is operationalized and how these map onto TWCO with improved reference to relevant panels in the schematic figure. We agree the framework is conceptually dense. TWCO principles reach the stimuli through specific V1 anatomy and physiology, so there are several links to keep in mind. Our goal with the revised introduction and figure is to make those links better visible.

      (4) You could consider discussing potential implications for understanding perceptual disorders characterized by altered neural synchrony (e.g., schizophrenia, autism) and how your learning paradigm might inform perceptual training interventions.

      Thank you for this suggestion. We have added that TWCO might provide a new lens to study perceptual disorders to the Discussion. We provide a concrete example of the relation between grouping, gamma synchrony (in light of TWCO) and lateral connectivity in schizophrenia

      (5) I think this paper has real strength, but rather than dispersing limitations throughout the discussion, create a dedicated section that systematically addresses ecological validity, alternative explanations, and generalisability concerns. This will also preempt criticism.

      We appreciate the suggestion. Our preference is to discuss limitations in context, next to the specific results they qualify, so readers see why each limitation matters and how it affects interpretation. Nevertheless, paragraph 7 on page 20 summarizes most limitations in a single paragraph.

    1. Come away, O human child! To the waters and the wild

      This line repeats throughout the poem as a refrain. It sounds like the fairies are trying to persuade the child to leave the human world.

    2. Come away, O human child! To the waters and the wild With a faery, hand in hand,

      It has an inviting tone, but more so to me gives me an immediate sense of the faeries trying to deceive. To persuade the child to abandon the human world. Who's best interest is this really?

    1. Author response:

      The following is the authors’ response to the original reviews.

      We now performed new experiments that were included in the manuscript. Our new results show that that monocyte-derived dendritic cells primed in vivo during P. chabaudi infection, or in vitro with TNF express high levels or GLUT-1 (Figures 4M, 5D, 6L). Furthermore, our new data show that mice treated with 2-DG (na inhibitor of glycolysis) are more susceptible to infection (Figures 6N, O). In addition, new results of glucose uptake by muscle and adipose tissues were added to the manuscript. Finally, figure legends were revised, densitometric analysis performed, and other issues addressed in the text.

      Please see below a point-by-point reply to the Reviewers’ comments.

      Public Reviews:

      Reviewer #1 (Public Review):

      Summary:

      The manuscript by Kely C. Matteucci et al. titled "Reprogramming of host energy metabolism mediated by the TNF-iNOS-HIF-1α axis plays a key role in host resistance to Plasmodium infection" describes that TNF induces HIF-1α stabilization that increases GLUT1 expression as well as glycolytic metabolism in monocytic and splenic CD11b+ cells in P. chabaudi infected mice. Also, TNF signaling plays a crucial role in host energy metabolism, controlling parasitemia, and regulating the clinical symptoms in experimental malaria.

      This paper involves an incredible amount of work, and the authors have done an exciting study addressing the TNF-iNOS-HIF-1α axis as a critical role in host immune defense during Plasmodium infection.

      Reviewer #2 (Public Review):

      Summary:

      The premise of the manuscript by Matteucci et al. is interesting and elaborates on a mechanism via which TNFa regulates monocyte activation and metabolism to promote murine survival during Plasmodium infection. The authors show that TNF signaling (via an unknown mechanism) induces nitrite synthesis, which (via yet an unknown mechanism), and stabilizes the transcription factor HIF1a. Furthermore, HIF1a (via an unknown mechanism) increases GLUT1 expression and increases glycolysis in monocytes. The authors demonstrate that this metabolic rewiring towards increased glycolysis in a subset of monocytes is necessary for monocyte activation including cytokine secretion, and parasite control.

      Strengths:

      The authors provide elegant in vivo experiments to characterize metabolic consequences of Plasmodium infection, and isolate cell populations whose metabolic state is regulated downstream of TNFa. Furthermore, the authors tie together several interesting observations to propose an interesting model.

      Weaknesses:

      The main conclusion of this work - that "Reprogramming of host energy metabolism mediated by the TNF-iNOS-HIF1a axis plays a key role in host resistance to Plasmodium infection" is unsubstantiated. The authors show that TNFa induces GLUT1 in monocytes, but never show a direct role for GLUT1 or glucose uptake in monocytes in host resistance to infection (nor the hypoglycemia phenotype they describe).

      We kindly disagree with the Reviewer. There is a series of experiments showing that TNFR KO (Figures 1, 2, 4), HIF1a KO (Figure 5) and iNOS KO (Figure 6) mice have partially impaired inflammatory response and control of parasitemia (Figures Figures 1E, 5G and 6B).

      To further address the issue raised by the reviewer, we performed two sets of experiments. First, we show, in vitro, the impact of TNF stimulation on GLUT1 expression and glucose uptake (Figure 4M, 5D, 6L). Our results show that GLUT1 is increased after 18 hours with TNF (100 ng/mL) stimulation in MODCs from WT mice but not from iNOS KO, HIF1a KO e TNFR KO mice. Similar results were obtained with monocytic cells derived from infected mice (Figure 4L, 5C, 6K). The results support the discussion by demonstrating that TNF stimulation influences GLUT1 expression in monocytic cells. This aligns with the proposed mechanism that TNF signaling regulates HIF-1α stabilization and glycolytic metabolism via RNI. The absence of GLUT1 upregulation and glucose uptake in TNFR KO, iNOS KO and HIF-1α KO mice further reinforces the role of RNI in promoting HIF-1α stabilization, as suggested in the discussion.

      Recommendations for the authors:

      Reviewer #1 (Recommendations For The Authors):

      Major points

      All Figure legends are not precise about the data express means {plus minus} standard errors of the means (SEM) or SD. Figure 1D shows no SD in the data from the uninfected group. It strongly suggests precise and improving all figure legends, giving more details in terms of including an explanation of all symbols, non-standard abbreviations, error bars (standard deviation or standard error), experimental and biological replicates, and the number of animals, and representative of the independent experiments.

      We apologize for the lack of details in the Figure legends. As requested, we are now indicating whether we used SEM or STDV, number of mice per group, number of replicate experiments. We also clarified the groups that are being compared, and the statistical significance indicated by the symbols. We also standardized symbols as asterisk only, and number of asterisk indicating the significance.

      Figure 1. The figure legend has no information about the organ for which TNF mRNA was measured (Figure 1D). Also, regarding the TNF data, Figure 1 C e 1D shows that the circulating levels of TNF and the expression of TNF mRNA in the liver peaked at the same time point, and after 6h, there is no difference between infected and uninfected mice. It would be expected that the TNF mRNA expression would be detected earlier than the protein, assuming that the primary source of TNF is from the liver. Is there another organ that could mainly source blood TNF levels? Did the authors have a chance to measure the blood TNF levels during infection (0-8dpi), besides the measurement at different times only on day 8?

      We included in the legend of Figure 1D that mRNA was extracted from liver.

      Liver and spleen are the main reservoir of infected erythrocytes and the main source of cytokines during the infection with the erythrocytic stage of malaria. The results presented in Figures 1C and 1D are from in vivo experiments, not a controlled cellular experiment in vitro. So, we can not conclude about exact time and synchronous production of TNF mRNA and protein. We have published earlier that during P. chabaudi infection, the peaks of TNF mRNA expression and the levels of circulating TNF protein occur between midnight and 6 am (Hirako at al., 2018). Hence the results are consistent in the results described here. In addition, this earlier study also shows that the same pattern of TNF at days 6 and 8 post-infection are similar. Furthermore, in another studies, we reported that the peak of TNF production occurs between days 6 and 10 post P. chabaudi infection (Franklin et al, PNAS, 2009; Franklin et al, Microbes and Infection, 2007). This is now clarified in the text (page 05, line 132):

      “As previously demonstrated, the circulating levels of TNF and expression of TNF mRNA in the liver peaked at 6 am (end of dark cycle) at 8 dpi (Figure 1C and 1D), and has been reported to peak between days 6 and 10 post-infection, with a consistent pattern observed on days 6 and 8.”

      Figure 2. "We observed that in naïve animals, all of these parameters were similar in TNFR<sup>-/-</sup> and C57BL/6 mice (Figures 2A-D, top panels, and Figures 2E-H)." Interestingly, the respiratory exchange rate of TNFR<sup>-/-</sup> uninfected mice seems higher in TNFR<sup>-/-</sup> uninfected mice than in naïve uninfected mice, and this pattern seems to be more pronounced in TNFR<sup>-/-</sup> uninfected mice. Is there any suggestion that could explain the change in respiratory exchange rate behavior without infection in those animals?

      At the moment, we have not investigated the basis of this difference between uninfected WT and TNFR KO mice, which goes beyond the scope of this research. This is indeed an interesting observation that should be pursued in the future by our group and elsewhere. We mentioned this difference, when describing the results (page 06, lines 155):

      “We observed that in naïve animals, all of these parameters were similar in TNFR<sup>-/-</sup> and C57BL/6 mice (Figures 2A-D, top panels and Figures 2E-H), with a slightly higher respiratory exchange rate in uninfected TNFR<sup>-/-</sup> mice. In contrast, all the evaluated parameters were decreased in infected C57BL/6 mice compared to their naïve counterparts during the light and dark cycles. When we analyzed only infected mice, the alterations in all parameters were milder in TNFR<sup>-/-</sup> compared to C57BL/6 mice (Figures 2A-D bottom panels and 2E-H).”

      Figure 3. To give an idea of the main population of non-parenchymal cells, it will be helpful to clarify briefly how non-parenchymal cells from the liver of infected or uninfected mice were isolated.

      We described in detail at Material and Methods (Page 19, Lines 566.)

      Figure 3, B, C, D, G and Figure 4K and Figure 5 A and B - Semi-quantitative data through the densitometric analysis of western blots should be included in all figures.

      Thank you for the suggestion. We now included the densitometric analysis for all Western blot results in Supplementary figure.

      Figure 4. The author describes, "We observed that except for Hexokinase-3, the expression of mRNAs of glycolytic enzymes (Hexokinase-1, PFKP, and PKM) was increased in C57BL/6 but not TNFR-/- 8dpi." Sometimes, it is hard to understand which groups have been compared to some data. Be precise in describing the statistical analysis between the groups. It seems that those genes were increased in "infected C57BL/6 in comparison to uninfected mice, but not TNFR-/- 8-dpi. Moreover, even though the authors include statistic symbols "ι, ιι, ιιι" in other legends, there is no explanation about statistic symbols in the legend of Figure 4.

      As mentioned above, we improved the descriptions of all figures in the legend, and when necessary in the main text describing the results.

      Figure 5. The authors describe, "We found that GLUT1 protein and glycolysis (ECAR) was impaired, respectively, in monocytic cells and splenic CD11b+ cells from infected, as compared to uninfected HIF-1aΔLyz2 mice (Figures 5C-5E)." The GLUT-1 expression was inhibited in both cells compared to HIF-1afl/fl mice but not even close to impaired GLUT-1 expression. There is still a robust amount of GLUT-1 expression, and significantly higher when compared to cells from uninfected mice.

      We tuned our statement to partially impaired, indicating that other host or parasite components maybe be also influencing GLUT-1 expression. In fact, we have recently published that IFNγ has also an important role in regulating GLUT1 expression in MO-DCs and this reference is mentioned in the text (page 10, line 291):

      “We found that glycolysis (ECAR) and GLUT1 expression were impaired, though partially, in monocytic and splenic CD11b+ cells from infected HIF-1aΔLyz2 mice (Figures 5C-5E) compared to infected WT mice. The level of GLUT1 expression that is still maintained is likely due to other host or parasite factors, such as IFN-γ (Ramalho 2024).”

      Figure 6. It is essential to have more information about the number of replicates in Figure 6A. However, there are just two dots replicates in the condition CD11b+ splenic cells from C57BL/6 stimulated with or without LPS (purple bars). It is essential to be precise regarding the number of experimental and biological replicates in each experiment and the statistical analysis that has been applied, including this group. Furthermore, the author concludes, "...these data demonstrated that RNI induces HIF-1α expression...." This conclusion needs a more careful description since no data supports that monocytic cells or splenic CD11b+ cells from iNOS-/- infected mice decrease stabilization of HIF-1αm using blotting, as shown in Figure 5 A.

      As mentioned above the number of replicates for each experiment was included in the figure legends.

      Minor Points.

      Figure 3. "Hepatocytes have an important role in glucose uptake from the circulation, and they do this primarily through GLUT2 (38), whose mRNA expression was downregulated (Figure 3A) and protein expression unchanged in response to Pc infection (Figure 4K)." I suggest moving the Figure 4K to Figure 3 to make it easy to follow the data description.

      We thank the reviewer for the suggestion. However, we chose to keep Figure 4K in Figure 4, as this panel includes data from TNF receptor deficient mice, and the analysis of TNF knockout models is first introduced and discussed in Figure 4. For clarity and consistency, we therefore maintained this panel within Figure 4.

      Line 433. Replace iNOS for iNOS-/- mice.

      iNOS is now replaced for iNOS-/- mice.

      Reviewer #2 (Recommendations For The Authors):

      The premise of the manuscript by Matteucci et al. is interesting and elaborates on a mechanism via which TNFa regulates monocyte activation and metabolism to promote murine survival during Plasmodium infection. The authors show that TNF signaling (via an unknown mechanism) induces nitrite synthesis, which (via yet an unknown mechanism), and stabilizes the transcription factor HIF1a. Furthermore, HIF1a (via an unknown mechanism) increases GLUT1 expression and increases glycolysis in monocytes. The authors demonstrate that this metabolic rewiring towards increased glycolysis in a subset of monocytes is necessary for monocyte activation including cytokine secretion, and parasite control.

      The main goal of this work is to study the interplay of TNF/HIF1a/iNOs in the pathogenesis in an experimental model of malaria. To dissect the molecular mechanism by which TNF induces reactive nitrogen species and regulates HIFa expression is beyond the scope of our research. Nevertheless, there is a vast literature addressing these issues. We now include in the discussion a paragraph describing the main conclusion of these studies published previously (page 12, line 363):

      "Previous studies have shown that TNF induces the production of RNI through the upregulation of iNOS via the NF-κB pathway (63, 64). TNF-mediated iNOS expression is critical for NO production, which in turn stabilizes HIF-1α by inhibiting prolyl hydroxylases (PHDs) even under normoxic conditions (58, 59). HIF-1α then upregulates the expression of glycolytic genes, including GLUT1 (22, 62).”

      Major comments

      Issues concerning novelty

      Some of the reported observations are not novel. TNFa and TNFa signaling has been demonstrated to contribute to the release of certain cytokines, and to contribute to the control parasitemia (PMID: 10225939). TNFa has been shown to increase glucose uptake in tissues (PMID: 2589544). There is a textbook about the role of INOS during the pathogenesis of malaria, including its association with parasite control (https://link.springer.com/chapter/10.1007/0-306-46816-6_15). Furthermore, other mechanisms controlling glycemia during Plasmodium infection have been shown (PMID: 35841892). The authors should adequately discuss other papers which have reported some of their findings.

      Thanks for the comments on previously existing literature. We are well aware of some of this earlier literature. Some of these earlier findings are mentioned in our manuscript. We emphasized these fundamental findings in the discussion, as requested (page 12, line 368):

      “TNF has been described as a critical mediator in malaria, driving cytokine release and parasitemia control (PMID: 10225939). It also enhances glucose uptake in tissues, aligning with our findings of increased glycolysis in monocytes (PMID: 2589544). The role of iNOS in malaria is well documented. IFN-γ and TNF induced the production of NO, which inhibits parasite growth but can cause tissue damage and organ dysfunction, especially in severe malaria (Mordmüller et al., 2002). Recent studies also highlight the complexity of glycemia regulation during Plasmodium infection describing its role in modulating parasite virulence and transmission (PMID:35841892). These studies demonstrate the critical function of TNF and iNOS in immune responses against Plasmodium, aligning with our findings of this axis and metabolic rewiring that are essential for monocyte activation and outcome of Pc infection.”

      The authors claim that "Reprogramming of host energy metabolism mediated by the TNF-iNOS-HIF1a axis plays a key role in host resistance to Plasmodium infection," and contributes significantly to their effector functions (particularly parasite clearing), and the systemic drop in glycemia observed during Pc infection. Although the authors show that TNFa does result in altered metabolism and increased GLUT1 levels in a subpopulation of monocytes, the evidence that TNFa-induced glylcolysis plays a key role in host resistance is correlative at best.

      This is an important question. We did show that TNFR KO have higher parasitemia. But TNF is pleiotropic cytokine and has multiple roles on innate and acquired immunity. The experiment we have performed and helps to address this issue is the in vivo treatment with 2DG. We found that treatment with this inhibitor of glycolysis results in a increase of parasitemia. These results are now included in Figure 6.

      When considering that the majority of monocytic populations are reduced in frequency and only a small subset (i.e., Monocyte-derived DCs) increase in frequency (Fig 3K) during Pc infection, this makes it very difficult to demonstrate that a cell population whose overall frequency reduces contributes significantly to the drop in glycemia during Pc infection. The authors should therefore include experiments that demonstrate that the inhibition of glycolysis induced by TNFa in monocytes is protective and/or contributes to a decrease in extracellular glucose. The authors could assess the impact of the loss of function of GLUT1 on activated monocytes and monocyte-derived DCs on glycemia upon TNFa stimulation.

      We agree. We focused on monocytes and the derived inflammatory monocytes and MO-DCs. In fact, the frequency of monocytes, considering the inflammatory monocytes and MO-DCs, is increased both in spleen and liver. One interesting result is that the HIF1a Lysm KO mice has impaired metabolism, attenuated hypoglycemia and increased parasitemia (Figure 5). Nevertheless, we agree that our current data thus not proof that the glycemia is due to the consumption of glucose by the activated monocytes, and that these are the only cells with increased glucose consumption. This is now added to the discussion (page 13, line 395):

      "Although the frequency of MO-DCs increases during infection, other cell populations may also contribute to glucose consumption. Further experiments, including the assessment of GLUT1 function in these populations, are needed to clarify their contribution to glucose consumption during infection."

      Furthermore, in the current state of the manuscript, it is unclear how activated monocyte populations uptake glucose. The authors claim that glucose uptake by activated monocytes is GLUT1-dependent, however, glucose transport via GLUT1 is insulin-dependent. Since Plasmodium infection is associated with insulin resistance, and almost unquantifiable levels of insulin (PMID: 35841892), and TNFa itself induces insulin resistance (PMCID: PMC43887), it is unclear how the activated monocyte population uptakes glucose. If the authors consider TNFa to be sufficient for GLUT1 induction, in vitro experiments (TNFa+monocytes) could bolster this claim (and support that GLUT1 is induced in an insulin-independent mechanism.

      There is significant evidences indicating that in contrast to GLUT4, induction of GLUT1 in mice is independent of insulin (PMID: 9801136). In our case, seems to be induced by the cytokines TNF and IFN𝛾(this study and Ramalho et al., 2024). We now performed experiments exposing monocytes to TNF and evaluating GLUT1 expression. The results indicate that monocytes exposed to TNF (100 ng/mL) for 18 hours from WT mice exhibited a significant increase in GLUT1 expression. This increase was comparable to the increased-GLUT1 phenotype observed in infected animals. The results of this experiment were included in the manuscript.

      A text was included to the discussion to clarify the issue of insulin dependence of GLUT1 expression (page 13, line 388):

      “GLUT1 expression is recognized as independent of insulin, in contrast to GLUT4 (PMID: 9801136). In our model, this regulation appears to be driven by pro-inflammatory cytokines, particularly TNF. Supporting this, our results show that in vitro stimulation with TNF, significantly increases GLUT1 expression in monocytes, accordingly to the ex vivo phenotype observed in infected animals.”

      Alternative hypothesis which might explain their phenotypes

      Figure 2 A-H: The metabolic effects of the genetic manipulations including INOS KO, TNFR KO, and HIF-1α∆Lyz2 could be explained by lesser disease morbidity owed to a reduction of inflammatory response during infection. Under this condition, the development of anorexia will not be as profound in the knock-outs compared with wild-type littermate controls, since anorexia of infection is tightly linked to the magnitude of inflammatory response. Accordingly, infected knock-out animals can keep eating, which presumably impacts glycemia, maintenance of core body temperature, and overall energetics of infected mice. The authors should exclude this possibility.

      We consider this possibility and the discussion now elaborates about this alternative hypothesis. We believe, that these two mechanisms are not mutually exclusive (page 16, line 474):

      “Although restored physical activity, food consumption and energy expenditure in knockout mice may contribute to the observed systemic metabolic parameters by altering energy balance, these effects are not mutually exclusive with the TNF-driven, cell-intrinsic metabolic mechanisms described here.”

      Minor comments

      The authors showed increased parasitemia upon TNFR and HIF1a depletion in the LyZ2 compartment. The same was observed upon organismal INOS depletion. This raises the question of whether the TNFHIF-INOS signaling axis is adaptive or maladaptive during Pcc infection. The authors should show host survival in mice lacking TNFR and HIF1a in the LyZ2 compartment, and in mice lacking INOS (presumably, they have these data).

      Despite the fact the various knockout mice have increased parasitemia and signs of disease, they all survive the infection. This is now included in the Figure legends.

      Are the higher tissue glucose levels specific to the liver and the spleen or this is a more general event? Have the authors looked at other organs?

      We now added the results of glucose uptake in the muscle and adipose tissues in figure 2. The fact that the glucose uptake is not increased in muscle and adipose tissue, further suggest that the increased glucose uptake in this model is insulin independent.

      Figure 1F: All core body temperatures are within the physiological range, i.e., >36 degrees C. This makes it unclear why the authors regarded this as hypothermia. The authors should present experiments demonstrating the development of hypothermia in Figure 1F, as they claim this.

      Temperature changes in mouse kept in animal house have been an issue discussed in the field. It is clear, however, that early in the morning (end of active period) mice have torpor. Lower temperature and physical activity.

      In Figure 4, since the authors already suggested that extra-hepatic cells, and not the liver parenchyma, contribute to glucose uptake, the authors should clarify why they analyzed the whole liver in Figure 4, and not extra-hepatic cells. Furthermore, the authors should quantify the hepatic monocytic population in non-infected versus infected wild-type animals.

      The reason we used whole liver, is that the number of non-parenchymal cells obtained from liver is limited for Western blot analysis. We thought that was important to show that expression of GLUT1 was decreased in the liver of TNFR KO mice. Nevertheless, the level of TNFR expression in different cell types in the liver was shown by flow cytometry. In addition, we performed the WB with cells extracted from the spleen, where lymphoid and myeloid cells are more abundant.

      Line 87: Phagocytizing parasitized what?

      This has been corrected in the manuscript.

      Line 111 Define RNI before being used.

      Is there a gender disparity in the TNFR KO phenotype? If yes, the authors should comment about this in their discussion.

      This has been defined and addressed in the manuscript

      Line 192: Did the authors mean 3B??

      In 3M, please plot monocytes from uninfected animals.

      The plot of uninfected animals are now included in Figure 3M

      Line 390 Remove the extra dash in HIF1a.

      Extra dash has been removed.

      Line 397 Define RA

      RA is now defined.

    1. Lapum, J., St-Amant, O., Hughes, M., Tan, A., Bogdan, A., Dimaranan, F., Frantzke, R., & Savicevic, N. (2019). The scholarship of writing in nursing education: 1st Canadian edition (1st ed.). https://pressbooks.library.torontomu.ca/scholarlywriting/

      Is it possible to use a hanging indent here?

    1. We track three specific vectors: Heal, One Thing, and Walk with Jesus.

      The H.O.W. Ledger Mechanics. This is a "Low-Friction, High-Impact" protocol.

      Heal (H): Neutralises the "Glitch" of identity lies.

      One Thing (O): Tracks the "Obedience" metric (did you do what the Spirit prompted?).

      Walk (W): Documents the "Presence" data. By limiting this to three sentences and five minutes, you bypass the "resistance" of the ego that says you are too busy to lead. If you cannot spare five minutes to plot your position, you aren't leading; you are just drifting.

    Annotators

    1. Note: This response was posted by the corresponding author to Review Commons. The content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We sincerely thank all the reviewers for their thoughtful and constructive comments.

      In our revision, we have addressed the reviewer's specific criticisms with additional experiments and text edits as described below. We believe the constructive feedback from peer reviews helped us to significantly extend our mechanistic findings and strengthen the manuscript through revision.

      Point-by-point description of the revisions

      Reviewer #1:

      Summary:

      The study by Zatulovskiy et al. examined how cell size influences cell susceptibility to ferroptosis. The authors found a size dependence specifically for ferroptosis-inducing drug Era2, but not for other drugs. Using various human cell lines (HMEC, HT 1080, RPE 1), the authors generated populations of small and large G1 cells by FACS, CDK4/6 inhibition (palbociclib), or inducible cyclin D1 knockdown, and measured cell susceptibility to ferroptosis. Larger cells were more resistant than smaller cells. Mechanistically, larger cells showed reduced plasma membrane lipid peroxidation, higher glutathione concentrations, and changes in relevant cellular proteins levels, as analyzed using previously published data. Deleting ACSL4, which is involved in ferroptosis, partly eliminated the size dependence of ferroptosis. The work concludes that cell size is a key determinant of ferroptosis susceptibility.

      My major concerns about this work focus on whether many of the results reflect cell size or cell cycle effects, and whether the FACS-based size-scaling analyses have some misleading features to their design & presentation. If these concerns can be addressed with new experiments, then the conclusions of this paper are justified. If these concerns cannot be addressed, then the authors should more directly acknowledge the alternative hypothesis that cell cycle effects may explain many of their results.

      The experiments seem to be replicated sufficiently, and most conclusions rely on data from multiple cell lines. My minor comments focus on needs to provide statistics and method details, and on suggestions on how to improve text clarity, but these edits are easily done and don't require new experiments. Overall, this is an interesting study, and it should be published once the concerns below are addressed.

      Major comments:

      • In experiments reported in Fig 1 and 2A, the authors sort small and large cells in G1, plate them, and later start the drug treatments & cell monitoring. Are these cells actively cycling (progressing in the cell cycle), and how fast? The large cells are likely to enter S phase earlier than the small cells, so by the time that the authors start their drug treatments, they may be comparing cells in different cell cycle stages, which could influence drug sensitivity more than cell size (as the authors also suggest later in Fig 2). This needs to be controlled for. Furthermore, even if the cells remain in G1 after sorting until the drug treatments are started, the authors should address the fact that the drugs are present for a long time, thus targeting the cells in various cell cycle stages.

      We agree with the reviewer that the cell cycle stage could affect ferroptosis susceptibility and could be a confounding effect in asynchronous cells. One of us (Dixon) reported the cell cycle effects on ferroptosis previously, and we observe them in this manuscript too (Fig. 2B,C,E). We now state this more clearly both in the Results and in the Discussion sections, where we write:

      Line 159: "We note that non-arrested cells had a lower susceptibility to Era2-induced ferroptosis compared to cells that were arrested in G1 for 2-3 days, despite being smaller in size. This is likely due to the difference in the fraction of cells in different cell cycle phases between arrested and non-arrested conditions since cells in S/G2/M phases are known to be more resistant to ferroptosis than cells in G0/G1 phases (Rodencal et al, 2024; Kuganesan et al, 2023)"

      Line 533: "Cells in G1 phase of the cell cycle were reported to be more susceptible to ferroptosis (Rodencal et al, 2024; Kuganesan et al, 2023), which suggested that ferroptosis inducers could be used in combination with cancer drugs, like the CDK4/6 inhibitor palbociclib, that arrest cells in G1 phase of the cell cycle (Herrera-Abreu et al, 2024). However, while CDK4/6 inhibitors arrest cells in G1, they do not inhibit cell growth, such that the longer they are arrested, the larger the cells grow (Lanz et al, 2022; Crozier et al, 2023; Manohar et al, 2023). This results in a complex, non-monotonic ferroptotic response dynamics in cells treated with CDK4/6 inhibitors (Fig. 2B,E). Just following CDK4/6 inhibitor treatment, as more and more cells are arrested in G1 phase, cells become more sensitive to both RSL3- and erastin-induced ferroptosis (Kuganesan et al, 2023; Rodencal et al, 2024). However, the longer the cells are arrested, the larger they become, which further promotes their susceptibility to RSL3 (Fig. S1B) but reduces their susceptibility to Era2-induced ferroptosis (Fig. 2B). The fact that the cell cycle arrest and cell size increase have opposing effects on Era2-induced ferroptosis susceptibility could explain why different studies reported seemingly contradictory results, where sometimes an increased and sometimes a decreased or unchanged sensitivity to system xc- inhibitors was observed depending on the cell type, duration and type of cell cycle arrest (Lee et al, 2024; Kuganesan et al, 2023; Rodencal et al, 2024). Such complex interplay between the cell cycle and cell size effects on ferroptosis suggests that combination therapies utilizing CDK4/6 inhibitors and ferroptosis inducers would have to carefully choose a dosage schedule.""

      Given the potentially confounding effects of the cell cycle in cycling cells sorted by size, we performed an additional experiment, in which RPE-1 cells were pre-treated with the CDK4/6 inhibitor palbociclib to synchronize them in G1 phase prior to treatment. These cells were then continuously exposed to palbociclib during the Era2 treatment (Fig. 2C-E). RPE-1 cells pre-treated with palbociclib for 2 and 4 days had the same cell cycle distribution with 94% of cells being arrested in G1, but with different sizes. Cells treated with palbociclib for 4 days were significantly larger and more resistant to Era2 as can be seen in the Figure 2C-E.

      Additionally, in the experiment shown in Fig. 5E,F, where we FACS-sorted WT and ACSL4 KO HMEC cells by cell size, and then measured Era2 susceptibility, we pre-treated the cells with palbociclib for 24 h to synchronize them in G1 prior to the sorting. We then cultured the cells in the presence of palbociclib during the Era2 treatment to avoid the cell cycle effects observed in Fig. 2. In this case, we still observe that larger cells are more resistant to Era2, consistent with our conclusion that cell size protects against Era2-induced ferroptosis.

      Reviewer #1: "Can the G1 arrest-driven changes in drug susceptibility (Fig 2 C-D) be attributed to cell size? Can the authors rescue the palbociclib treatment with rapamycin or other growth inhibitors that allow size to remain small during G1 arrest?"

      We have attempted to perform these experiments, but when we co-treated the cells with palbociclib and mTORC inhibitors, but observed variable results, which are likely due to the fact that prolonged mTORC inhibition itself rewires cellular metabolism and reduces cell susceptibility to ferroptosis, as one of us (Dixon) found previously (Armenta et al. (2022), Ferroptosis inhibition by lysosome-dependent catabolism of extracellular protein. Cell Chemical Biology 29: 1588-1600.e7). Our results were consistent with this previous report and is now included in a new supporting figure panel (Fig. S3C).

      Thus, upon palbociclib+rapamycin co-treatment there seems to be a competition between cell-size-mediated and metabolism-mediated effects of mTORC inhibition on ferroptosis, which leads to variable outcomes.

      Reviewer #1: "In Fig 2E-F, is the cell cycle distribution of the samples influenced by CCND1 shRNA induction? Are the drug sensitivity effects due to cell size or cell cycle changes?"

      The CCND1 manipulation model is extensively characterized in our recent work cited in this manuscript (You et al. (2025), Cell size-dependent mRNA transcription drives proteome remodeling. 2025.10.30.685141 doi:10.1101/2025.10.30.685141). Indeed, CCND1 shRNA cells have a slightly elongated G1 phase due to a ~30% reduction in Cyclin D1 concentration: the G1 fraction changes from ~70% in wild-type to ~80% in CCND1 shRNA cells, which could potentially affect the ferroptosis susceptibility, but the additional results obtained on synchronized RPE-1 cells, described above (Fig. 2C-E), support the conclusion that the primary effect on Era2 sensitivity is due to cell size.

      Reviewer #1: "Can the authors address the meaningfulness of the FACS-based size-scaling results in cases where cell-to-cell variability is very large? For example, in Fig 4D&G, the results are so variable even in identically sized cells that the importance of the size-scaling pattern seems questionable."

      We do observe variability in fluorescent probe-based measurements of GSH and lipid oxidation, which could be due to biological (natural cell heterogeneity) and/or technical (low sensitivity of the probes) reasons. However, when we look at binned data and compare the mean values {plus minus} s.e.m. for each bin, we observe a robust and reproducible trend (black line with dark-grey shaded area), even though the SD is quite broad (lighter shaded area). We believe such trends are meaningful when describing cell death in probabilistic terms as we do. I.e., the GSH measurement might not be precise enough to predict cell death for a given individual cell, but the statistical trend is clear and these measurements help predict cell death probabilities for cells of different sizes.

      Reviewer #1: "In Figs 4B-D, the cell size axis seems to have over 4-fold size variability, but when the authors show the analysis of this data (Figs 4E-G) the variability is only 2-fold. What was excluded and on what basis?"

      To address this point, we have now clarified in the Methods section how the data were processed and what data points we excluded from this analysis:

      Line 671: "For all binned flow cytometry data plots, the cells below the 2nd and above the 98th cell size percentiles were excluded to remove the extreme outliers. Then, the remaining data were binned by size and plotted as background-corrected average fluorescence intensity for each bin against the bin's average cell size. Bins with fewer than 200 cells were excluded from the analysis to reduce noise."

      Typically, such pre-processing reduces the size range, mostly from the large-cell end, because of the long right tail of the size distribution containing a few very large cells.

      Reviewer #1: "Based on the methods section & figure legends of Fig 4B-I, the RPE cells were not pre-sorted to include only G1 cells, nor did the assay account for cell cycle differences. How can these data be used to explain results from earlier figures, where analyses were exclusively focused on size differences in G1?"

      This is a valid point: Cells in the GSH measurement experiment were not gated by Hoechst signal for G1 phase because the channel normally used for Hoechst staining was in this case occupied by the MCB probe. However, given the data in Fig. 4A,B showing that the GSH production machinery is superscaling when measured specifically in G1-phase cells, we believe the flow cytometry data in Fig. 4C-J showing GSH concentration increasing with cell size across the whole cell cycle is very likely true for G1 cells as well.

      Reviewer #1: "Minor comments:

      I recommend clarifying in the early introduction that all size changes discussed are in the absence of DNA content increase."

      We have now clarified this in the introduction (Line 41 and Line 81).

      Reviewer #1: "The introduction seems to cite primary research and review paper in the same sentences, which is a bit misleading as the reviews don't seem to add new evidence."

      We have removed review citations where they did not provide additional context.

      Reviewer #1: "*OPTIONAL* In the second introduction paragraph, consider the classification/description of the three different mechanisms. Currently, it seems that these mechanisms are not independent of each other, and the details provided about each mechanism are inconsistent."

      We have now modified this paragraph to make the description more consistent.

      Reviewer #1: "Please provide statistics for the IC50 values reported based on Fig 1C. Were small and large cells statistically different? Are the IC50 values reported as +/- standard deviation or some other metric?"

      This has now been clarified in the text as follows:

      "For example, at the 72 h time point, the Era2 IC50 was 28 {plus minus} 11 µM (mean {plus minus} SD) for large cells versus 2.0 {plus minus} 1.4 µM for small cells (Student's t-test: p = 0.039) (Fig. 1C)."

      Reviewer #1: "*OPTIONAL* Providing more insight into why Era2 and RSL3 treatments yield more opposite responses would be of great interest to the field."

      We agree this is an important point that should be discussed in more detail. In the field of ferroptosis, context-dependent (i.e., cell type-specific) effects are common and multiple groups including our own (Dixon) have published extensively on genes and mechanisms that can lead to differences between erastin2 and RSL3 sensitivity. For example, there are studies showing that the mTOR pathway or the p53 pathway can either prevent or promote ferroptosis, depending on the cell type and/or other currently unknown variables. To address more specifically the differences between Era2 and RSL3 in the context our observed cell-size-dependent response, we have now added more data and discussion. In the Results section we added panel 4B and the following text:

      Line 359: "While the upregulation of GSH biosynthesis may promote the resistance of larger cells to ferroptosis, such an upregulation alone cannot explain why larger cells become more resistant to ferroptosis induced by the cystine import inhibitor Era2, but not, for example, by the GPX4 inhibitor RSL3 (Chan et al, 2025) (Figs. 2B, S1B). We found previously that upon mTORC1 inhibition cells can evade cystine deprivation-induced ferroptosis by uptake and catabolism of cysteine-rich extracellular proteins, mostly albumin (Armenta et al, 2022) (Fig. S3C). This process involves albumin degradation in lysosomes, predominantly by cathepsin B (CatB), and subsequent export of cystine from lysosomes to fuel the synthesis of glutathione. Large cells undergo proteome rearrangements similar to those occurring upon mTORC1 inhibition (Zatulovskiy et al, 2022). This suggests that large cells may upregulate CatB expression to bypass the Era2-induced cystine import inhibition via system xc-. To test this hypothesis, we used flow cytometry to measure how the expression of cathepsin B and the system xc- cystine/glutamate transporter SLC7A11 (xCT) scales with cell size (Fig. 4B). We found that SLC7A11 concentration modestly decreases, while CatB concentration significantly increases with cell size (Fig. 4B). This shift in the ratio between SLC7A11 and CatB supports the hypothesis that larger cells may rely less on cystine import via system xc- and thus become more resistant to system xc- inhibition by Era2."

      Additionally, in the Discussion we added the following:

      Line 578: "We show that large cells may become resistant specifically to Era2 but not RSL3 through the upregulation of lysosomal function, particularly cathepsin B expression, which enables the uptake and catabolism of cysteine-rich extracellular proteins. A size-dependent shift in the ratio between SLC7A11 and cathepsin B makes large cells less dependent on cystine import via system xc-, and thus, more resistant to Era2. In addition to this, it was reported that RSL3 can induce ferroptosis independently of GPX4 and may target other selenoproteins (DeAngelo et al, 2025; Cheff et al, 2023), which could also contribute to the difference in size-dependent responses to RSL3 and Era2."

      Reviewer #1: "Is the BODIPY-C11 labeling specific to plasma membrane, as suggested by the writing of the authors, or do the results shown integrate signals over all cell membranes?"

      We thank the reviewer for pointing this out. BODIPY-C11 581/591 stains many membranes in the cell, not just the plasma membrane. We have changed the wording in the manuscript to reflect this.

      Reviewer #1: "How exactly is gating done for the flow cytometry samples? Especially when analyzing size-scaling, the results are likely to be sensitive to outliers, such as those seen in Fig 4C (a subpopulation of very low CFSE stained cells). Can the authors clarify their methods and/or display supplementary figures with gating examples?"

      We have now specified our gating strategy in the Methods section (Line 663) and added a corresponding Supplementary Figure S5:

      "Single cells were gated based on FSC-A vs SSC-A, then FSC-A vs FSC-H, then SSC-A vs SSC-W plots. From this population of single cells, G1 cells were selected using Hoechst-A vs FSC-A plot for subsequent scaling analysis"

      Reviewer #1: "In Fig 4, total protein staining was used as a control, whereas Fig 5B b-actin was used as a control. Why did the authors rely on different controls approaches for essentially the same measurements? Are these controls comparable?"

      In our flow cytometry experiments, we consistently use live-cell total protein stain (CFSE) for live cells, and anti-Tubulin immunofluorescent staining for fixed cells, both of which scale in proportion to cell volume and act as a read-out for total cellular protein content (Lanz and Zatulovskiy et al., Mol Cell 2022; Berenson et al. MBoC 2019), which we use to calculate concentrations of other cellular components (analogous to loading controls). In Fig. 5B, beta-Actin is used as a reference - a protein whose concentration does not change with cell size, as opposed to ACSL4 whose concentration decreases with cell size. In this plot, both ACSL4 and beta-Actin amounts were normalized to alpha-Tubulin, which is analogous to a concentration calculation using loading control. This is now explained in more detail in the Figure legend.

      Reviewer #2:

      "Zatulovskiy et al. demonstrate that cell size modulates susceptibility to ferroptosis, a form of iron-dependent cell death driven by lipid peroxidation. Using human cell lines (HMEC, HT-1080, RPE-1), the authors examined cell size through FACS sorting, CDK4/6 inhibition and inducible cyclin D1 knockdown. They found that larger cells are more resistant to ferroptosis induced by system xc⁻ inhibition (erastin2), but more sensitive to GPX4 inhibition (RSL3), highlighting pathway-specific size dependencies.

      Mechanistically, larger cells exhibited:

      • Higher glutathione levels, supporting lipid peroxide detoxification
      • Increased ferritin expression, promoting iron sequestration
      • Lower ACSL4 levels, reducing incorporation of peroxidation-prone lipids These findings were supported by high-throughput microscopy, flow cytometry (BODIPY-C11 lipid peroxidation assays), and proteomic analyses. The study concludes that cell size influences proteome composition and metabolic capacity, thereby shaping cell death decisions, an insight with implications for aging, cancer, and ferroptosis-based therapies.

      Major Comments

      1. Direct evaluation of SLC7A11 abundance and function is needed The opposite size-dependent effects of erastin2 and RSL3 strongly suggest a role for SLC7A11/system xc⁻ activity in size-dependent ferroptosis resistance. However, SLC7A11 levels were not quantified due to insufficient peptide detection in the proteomic data.

      o Direct measurement of SLC7A11 protein levels (immunoblotting or flow cytometry) in small vs large cells would test whether its expression scales with size.

      o Functional perturbation (siRNA/CRISPR knockdown) followed by erastin2 treatment would provide mechanistic validation.

      o Use of additional SLC7A11 inhibitors (e.g., sulfasalazine, sorafenib) could further test whether the size resistance phenotype is xc⁻-specific."

      We agree that the difference in size-dependent responses to RSL3 and Era2 is an important point that needs further investigation and discussion, as other reviewers also pointed out. To address more specifically the differences between Era2 and RSL3 in the context of cell-size-dependent response, we have now added more data and discussion. In the Results section we added panel 4B measuring SLC7A11 and Cathepsin B scaling with cell size and the following text:

      Line 359: "While the upregulation of GSH biosynthesis may promote the resistance of larger cells to ferroptosis, such an upregulation alone cannot explain why larger cells become more resistant to ferroptosis induced by the cystine import inhibitor Era2, but not, for example, by the GPX4 inhibitor RSL3 (Chan et al, 2025) (Figs. 2B, S1B). We found previously that upon mTORC1 inhibition cells can evade cystine deprivation-induced ferroptosis by uptake and catabolism of cysteine-rich extracellular proteins, mostly albumin (Armenta et al, 2022) (Fig. S3C). This process involves albumin degradation in lysosomes, predominantly by cathepsin B (CatB), and subsequent export of cystine from lysosomes to fuel the synthesis of glutathione. Large cells undergo proteome rearrangements similar to those occurring upon mTORC1 inhibition (Zatulovskiy et al, 2022). This suggests that large cells may upregulate CatB expression to bypass the Era2-induced cystine import inhibition via system xc-. To test this hypothesis, we used flow cytometry to measure how the expression of cathepsin B and the system xc- cystine/glutamate transporter SLC7A11 (xCT) scales with cell size (Fig. 4B). We found that SLC7A11 concentration modestly decreases, while CatB concentration significantly increases with cell size (Fig. 4B). This shift in the ratio between SLC7A11 and CatB supports the hypothesis that larger cells may rely less on cystine import via system xc- and thus become more resistant to system xc- inhibition by Era2."

      Additionally, in the Discussion we added the following:

      Line 578: "We show that large cells may become resistant specifically to Era2 but not RSL3 through the upregulation of lysosomal function, particularly cathepsin B expression, which enables the uptake and catabolism of cysteine-rich extracellular proteins. A size-dependent shift in the ratio between SLC7A11 and cathepsin B makes large cells less dependent on cystine import via system xc-, and thus, more resistant to Era2. In addition to this, it was reported that RSL3 can induce ferroptosis independently of GPX4 and may target other selenoproteins (DeAngelo et al, 2025; Cheff et al, 2023), which could also contribute to the difference in size-dependent responses to RSL3 and Era2."

      Reviewer #2: "2. Functional tests of ferritin contribution to resistance are needed

      Although elevated ferritin (FTH1/FTL) levels in larger cells represent a strong correlational signal, definitive experimental evidence establishing causality is currently lacking.

      o Measuring the labile iron pool directly in size-stratified populations would strengthen the link.

      o Knockdown of FTH1 or FTL could reveal whether ferritin upregulation is necessary for the resistance of large cells to ferroptosis."

      We thank the reviewer for raising this point. We have now completed additional experiments, as suggested by the reviewer, and found that iron chelation is unlikely to mediate the size-dependent response to Era2. We have modified the manuscript accordingly and added the following data and discussion to address this point:

      Line 296: "The observed increase in ferritin concentration with cell size could therefore lead to additional Fe2+ ion chelation, which in turn would protect large cells from iron-dependent lipid peroxidation and ferroptosis. However, when we measured the concentration of labile intracellular Fe2+ using a fluorescent probe FerroOrange (Hirayama et al, 2020), we did not observe any size-dependent decrease in labile iron concentration (Fig. S2A). Previous work suggests a link between increased sequestration of ferrous iron in lysosomes and resistance to ferroptosis. It was reported that senescent cells, which are also large (Fig. S3A,B), gain resistance to ferroptosis through lysosomal alkalinization and sequestration of ferrous iron in lysosomes (Loo et al, 2025). We therefore tested whether the superscaling of lysosomes observed in large cells (Lanz et al, 2022; You et al, 2025) promotes Era2 resistance through lysosomal iron sequestration. To do this, we stained the cells with the lysosomal iron detection probe Lyso-FerroRed (Saimoto et al, 2025) and measured its scaling using flow cytometry (Fig. S2B). We observed that the amount of Lyso-FerroRed, and therefore, the amount of lysosomal iron, scaled in direct proportion to cell size, just like the total cellular protein content (Fig. S2B). These results indicate that iron chelation by ferritin and its sequestration in lysosomes are unlikely to play a crucial role in size-dependent decrease in Era2 sensitivity."

      Reviewer #2: "3. Relevance to senescence should be addressed experimentally or explicitly discussed

      Given that senescent cells are enlarged and accumulate in aged and tumour tissues, testing senescent models for erastin2 resistance would greatly strengthen the physiological significance."

      We agree that an increase in cell size contributing to the resistance of senescent cells to ferroptosis is intriguing. We have now added a Supplementary Figure S3 and discussion of this point in the manuscript as follows:

      Discussion line 552: "our data suggest that previously reported resistance of senescent cells to ferroptosis can at least partially be due to the increased cell size, a well-established hallmark of senescence."

      Reviewer #2: "Minor Comments

      1. Mechanistic nuance regarding RSL3 should be included RSL3 has been reported to induce ferroptosis independently of GPX4 (PMID: 37087975, PMID: 40392234) and may target other selenoproteins such as TXNRD1. This nuance would help explain the observed divergence between RSL3 and erastin2 sensitivity across sizes."

      We have now added this in the Discussion as suggested by the reviewer (line 583):

      "In addition to this, it was reported that RSL3 can induce ferroptosis independently of GPX4 and may target other selenoproteins (DeAngelo et al, 2025; Cheff et al, 2023), which could also contribute to the difference in size-dependent responses to RSL3 and Era2."

      Reviewer #2: "2. Dynamic range of BODIPY-C11 assays needs commentary

      Despite high erastin2 doses, the oxidized BODIPY signal remains close to DMSO levels. The authors should comment on whether this reflects high GSH buffering capacity, probe limitations, or other factors."

      We believe there are both technical (narrow dynamic range of the probe) and biological reasons for the relatively small (2-3 fold) difference in Oxidized-to-Non-oxidized BODIPY-C11 ratios between DMSO and Era2-treated cells. The biological reason is that the cells continue producing GSH until they fully deplete the cystine pool, which happens ~20-24 h after Era2 addition. Once the cystine pool is depleted, the cells very rapidly deplete GSH and initiate cell death. Therefore, there is only a short time window where cells are strongly depleted of GSH before dying. We see this small fraction of cells with a high Oxidized BODIPY-C11 signal in our flow cytometry experiments and in previous microscopy analysis of BODIPY-C11 (Murray et al., Protocol for detection of ferroptosis in cultured cells. STAR Protoc. 2023), but at our chosen time point (20h Era2) most cells are not as bright because we aimed to analyze the population before the onset of widespread cell death.

      Reviewer #2: "3. Western blot for shCycD1 depletion should be included

      CycD1 depletion usually causes cells to stop proliferating, which is not the case here. Therefore, depletion must be partial. The level of depletion should be shown by immunblotting."

      The CCND1 manipulation model is extensively characterized in our recent work cited in this manuscript (You et al. (2025), Cell size-dependent mRNA transcription drives proteome remodeling. 2025.10.30.685141 doi:10.1101/2025.10.30.685141). CCND1 shRNA cells do not fully arrest in G0/G1 because the concentration of Cyclin D1 protein in this system is only partially decreased, as the reviewer noted. As a result, the cells have a slightly elongated G1 phase due to a ~30% reduction in Cyclin D1 concentration, but continue to proliferate. The G1 fraction changes from ~70% in wild-type to ~80% in CCND1 shRNA cells.

      Reviewer #3:

      "In this manuscript, Zatulovskiy and colleagues elaborate on their previous work describing cell size-dependent changes in the proteome by investigating whether these changes can be correlated in differences in cell physiology. Using a cleverly-designed high throughput screen, they searched for compounds that differently-sized cells display differential sensitivity towards. Their primary hit, Era2, is involved in the ferroptosis pathway and serves as the starting point for a detailed study of how excess cell size protects cells from ferroptosis-induced cell death via: 1) lower concentrations of ACSL4 (which produces peroxidation-prone PUFAs), 2) increased ferritin concentrations, and 3) increased GSH concentrations.

      Overall, the experiments in this manuscript are well-designed and interpreted. It is an extremely well-written manuscript with a clear trajectory of logic. I have only a few major concerns that should be addressed before publication:"

      We thank Reviewer #3 for their careful reading of the manuscript and for the clear summary of our study and its central findings. We appreciate their positive assessment of the experimental design, interpretation, and overall clarity of the writing and logical flow. We are also grateful for their constructive feedback and take their major concerns seriously; we have addressed each point in detail below.

      Reviewer #3: "Major concerns:

      1) In Figure 3E, the authors gate their flow cytometry data using SYTOX so that they are only analyzing live cells. Based on their gating scheme, it seems like there are really a lot of dead cells. Presumably the cells that died were the most sensitive to Era2, so it seems an oversight to discard these cells. Of course, it is not appropriate to analyze dead cells, but this could potentially be solved by using a shorter treatment duration than 24 hours wherein fewer cells die."

      This is a good point. To address it, we have now replaced this panel with a time point where most cells are still alive (20 h, 0.2 µM Era2), as suggested by the reviewer (Fig. 3E,F). This did not change the conclusion that BODIPY-C11 oxidation decreases with cell size.

      Reviewer #3: "2) In Figure 5, are the small, medium, and large bins for ACSL4 KO cells the same as for WT cells? If the ACSL4 KO cells are just bigger to begin with, this could explain why the "small" bin has greater cell survival than the WT small bin. Moreover, is the overlap between the three bins the same in the WT and KO cells?"

      This is an important point that we now address with data shown in Fig. S4B. We have now added a Supplementary Figure S4B to show the relative size of small, medium, and large WT and ACSL4 KO HMEC cells. As seen from this graph, the ACSL4 KO cells are not bigger than WT cells. Importantly, the fold-range between the small and large FACS-sorted cells is similar (~1.9 to 2-fold).

      Reviewer #3: "3) Loo, et al. Nat Comms 2025 similarly found that senescent cells (which are enlarged) are resistant to ferroptosis using the same inhibitor as the authors. In contrast to the authors, they show that this is due to lysosomal alkalinization and sequestration of ferrous iron in lysosomes. Given that Lanz et al. 2022 found that lysosomal components super-scale with cell size, it seems like this would be an important hypothesis to address. Free lysosomal iron can be easily measured with the LysoRhoNox stain. Loo et al. was able to restore ferroptosis sensitivity in senescent cells using the V-ATPase activator EN6, so it would be important for the authors to address whether this (or similar) treatment would have the same effect in enlarged cells."

      This is an excellent point. We have now performed this experiment and added it to the manuscript, as suggested by the reviewer. Based on the Lyso-FerroRed staining (another brand name for the LysoRhoNox probe), we do not see an increase in lysosomal iron sequestration in large cells (Fig. S2B) - see the graph and the corresponding discussion below:

      Line 301: "Previous work suggests a link between increased sequestration of ferrous iron in lysosomes and resistance to ferroptosis. It was reported that senescent cells, which are also large (Fig. S3A,B), gain resistance to ferroptosis through lysosomal alkalinization and sequestration of ferrous iron in lysosomes (Loo et al, 2025). We therefore tested whether the superscaling of lysosomes observed in large cells (Lanz et al, 2022; You et al, 2025) promotes Era2 resistance through lysosomal iron sequestration. To do this, we stained the cells with the lysosomal iron detection probe Lyso-FerroRed (Saimoto et al, 2025) and measured its scaling using flow cytometry (Fig. S2B). We observed that the amount of Lyso-FerroRed, and therefore, the amount of lysosomal iron, scaled in direct proportion to cell size, just like the total cellular protein content (Fig. S2B). These results indicate that iron chelation by ferritin and its sequestration in lysosomes are unlikely to play a crucial role in size-dependent decrease in Era2 sensitivity."

      Reviewer #3: "Minor concerns:

      1) It would be helpful if this manuscript were re-submitted with line numbers to more easily reference the text."

      We have added line numbers for convenience.

      Reviewer #3: "2) In Figure 5A and other figures that reproduce data from Lanz et al. 2022, it would be helpful to have a summary curve for the overall abundance of each protein rather than only the individual peptide curves. These plots (particularly Figure 5A) are difficult to interpret since some peptides were presumably more abundant / measured with higher confidence than others."

      We have added the average ACSL4 protein slope line to Fig. 5A.

      Reviewer #3: "3) In Figure 5, the authors show the validation of the ACSL4 KO HT-1080 cell line but not HMEC, even though both are used in this figure. It would be useful to show both. Additionally, the authors switch back and forth between the two cell lines for this figure, and it is not clear why."

      We have added the HMEC ACSL4 KO validation Western blot in Fig. S4A (see below).

      For the BODIPY oxidation experiment (Fig. 5D), we used HT-1080 instead of HMEC because HT1080 cells are sensitive to lower concentrations of Era2, and therefore, we could better optimize the Era2 concentrations and treatment durations to measure BODIPY oxidation at the time point when most cells are still alive but demonstrate a pronounced oxidized BODIPY signal.

      Reviewer #3: "4) In Figure 5B, the authors use antibody-based staining of ACSL4 and flow cytometry to correlate a loss of ACSL4 expression with increased cell size, validating the proteomics data in Figure 5A. This does not seem like a good way to do this. Firstly, fixing cells with formaldehyde alters their size (is this proportional across differently sized cells? It's impossible to know), which makes it inappropriate to use SSC as a proxy for size in this particular situation. Secondly, the normalization scheme here doesn't make sense. If actin was used as a reference protein, why was tubulin used to normalize ACSL4 abundance? Overall, this seems like a very round-about experiment that could have just been addressed by doing a simple western blot with the four size bins sorted from live cells (as it was in the proteomics). If the issue is that ACSL4 is not detectable by western in the HMEC cells, another solution would be plating the live, sorted bins on coverslips and measuring by IF (or using the HT-1080 cells)."

      We prefer IF flow cytometry to Western blotting for protein scaling analysis because it is more quantitative and provides cell size and protein content information for each individual cell. While in principle, different-sized cells might change their size differently during fixation, the cells that were larger or smaller prior to the fixation remain larger or smaller after fixation as well. Therefore, the SSC measurement after fixation still provides reliable information on size ranking, even if SSC does not perfectly linearly scale with cell volume. We do not use the SSC information to calculate protein concentrations here. Instead, we divide the amount of our protein of interest in the cell by the amount of constitutively-expressed Tubulin, which acts as an analogue of a loading control in this experiment. In Fig. 5B, both ACSL4 and Actin were normalized to Tubulin to estimate their concentrations. Actin is used just as a reference protein to show how the concentration of a perfectly scaling protein remains constant across cell size, as opposed to the sub-scaling ACSL4. Tubulin in this case was used as a proxy for total cellular protein content, which scales linearly in proportion to cell volume. This approach for determining the scaling behaviors of different proteins was previously validated in Lanz et al., Mol Cell 2022.

      Reviewer #3: "5) In Figure 5E/5F, the authors pre-arrest the cells in G1 with palbociclib before size-sorting them. The pre-arrest is not done in other experiments using this cell line for size-sorting, so it would be important for the authors to comment on why this was done for this experiment but not others."

      As we found in Fig. 2B-E, the cell cycle has confounding effects on size-dependent ferroptosis susceptibility measurements (as discussed in detail in our response to the first major point of Reviewer #1 above). Briefly, to avoid these confounding effects and isolate the effects of cell size from the effects of the cell cycle, we pre-synchronized the cells with 24 h treatment with palbociclib in Fig. 5E,F. This is now better clarified in the text, as follows:

      Line 456: "In this experiment, we synchronized cells in G1 phase using palbociclib prior to cell sorting and also incubated the sorted cells in the presence of palbociclib during Era2 treatment to isolate cell size effects from the previously observed confounding effects of the cell cycle on ferroptosis (Fig. 2B,E)."

      Reviewer #3: "6) Conceptually, it is difficult for me to understand why large cell size sensitizes cells to GPX4 inhibition but confers resistance to Era2 treatment. Particularly given the pathway described in Figure 3A, I am having trouble understanding why these would convey such opposing phenotypes. Shouldn't the extra ferritin in the bigger cells also help them cope with GPX4 inhibition if, as the authors state in the discussion, the increased sensitivity to the GPX4 inhibitor is reported to be mediated by (among other things) iron accumulation? A deeper discussion of this seeming-incongruity would be helpful for contextualizing the broader role of cell size in determining ferroptosis sensitivity."

      We agree this is an important point, which was also raised by the other reviewers. As such, we note that context-dependent (i.e., cell type-specific) effects are common in the ferroptosis field, and multiple groups including our own (Dixon) have published extensively on genes and mechanisms that can lead to differences between erastin2 and RSL3. For example, there are studies showing that the mTOR pathway or the p53 pathway can both prevent and promote ferroptosis, depending on the cell type or some other hidden variable.

      To better address the differences between Era2 and RSL3 in the context of the cell-size-dependent response, we have now added more data and discussion. In the Results section we added panel 4B and the following text:

      Line 359: "While the upregulation of GSH biosynthesis may promote the resistance of larger cells to ferroptosis, such an upregulation alone cannot explain why larger cells become more resistant to ferroptosis induced by the cystine import inhibitor Era2, but not, for example, by the GPX4 inhibitor RSL3 (Chan et al, 2025) (Figs. 2B, S1B). We found previously that upon mTORC1 inhibition cells can evade cystine deprivation-induced ferroptosis by uptake and catabolism of cysteine-rich extracellular proteins, mostly albumin (Armenta et al, 2022) (Fig. S3C). This process involves albumin degradation in lysosomes, predominantly by cathepsin B (CatB), and subsequent export of cystine from lysosomes to fuel the synthesis of glutathione. Large cells undergo proteome rearrangements similar to those occurring upon mTORC1 inhibition (Zatulovskiy et al, 2022). This suggests that large cells may upregulate CatB expression to bypass the Era2-induced cystine import inhibition via system xc-. To test this hypothesis, we used flow cytometry to measure how the expression of cathepsin B and the system xc- cystine/glutamate transporter SLC7A11 (xCT) scales with cell size (Fig. 4B). We found that SLC7A11 concentration modestly decreases, while CatB concentration significantly increases with cell size (Fig. 4B). This shift in the ratio between SLC7A11 and CatB supports the hypothesis that larger cells may rely less on cystine import via system xc- and thus become more resistant to system xc- inhibition by Era2."

      Figure 4. (B) Flow-cytometry-based measurement of cystine/glutamate transporter SLC7A11 (xCT) and cathepsin B (CatB) concentrations in G1-phase RPE-1 cells demonstrates a modest decrease in SLC7A11 and a significant increase in Cathepsin B concentrations with cell size. To calculate the concentrations of SLC7A11 and CatB, their amounts were measured with flow cytometry using immunofluorescence and normalized to the amounts of α-Tubulin. The data were binned by cell size, and mean values for each bin were plotted against normalized cell size (solid blue line for SLC7A11 and red line for CatB). Shaded areas denote the s.e.m. for each bin.

      Additionally, in the Discussion we added the following:

      Line 578: "We show that large cells may become resistant specifically to Era2 but not RSL3 through the upregulation of lysosomal function, particularly cathepsin B expression, which enables the uptake and catabolism of cysteine-rich extracellular proteins. A size-dependent shift in the ratio between SLC7A11 and cathepsin B makes large cells less dependent on cystine import via system xc-, and thus, more resistant to Era2. In addition to this, it was reported that RSL3 can induce ferroptosis independently of GPX4 and may target other selenoproteins (DeAngelo et al, 2025; Cheff et al, 2023), which could also contribute to the difference in size-dependent responses to RSL3 and Era2."

    1. xploration of Ottawa’s five O-Train stations acrosstwo offence types (commercial burglary and theft of vehicle) showedhigh levels of crime clustering in those areas with an O-Train station lo-cated within it or nearby

      logos: This is logos because it presents research findings and evidence.

    2. however, theft of vehi-cle High–High local crime clusters were statistically related to O-Trainstations, and with a high magnitude

      Logos: presents research findings and evidence

    1. la escritura de la tesis como actos de prototipado

      Esto rompe con el paradigma de la tesis como producto lineal y propone verla como un producto de diseño en evolución en el que se aprovechan las tensiones o fisuras como puentes para el aprendizaje

    1. Ecossistema

      Um reforço: incluir o Ecommerce na Prática em ecossistema, mostrando que oferecemos não só infraestrutura. Somos a parte educativa, o que ajuda a dar o próximo passo independente do estágio do lojista. Todo lojista tem acesso (alguns a mais áreas, outros a menos) e não sabe disso.

      + Não tenho certeza se é uma big bet, pra mim é algo que deve ser recorrente, seguindo o caminho dos marketplaces.

    2. sar a Copa como um "simulado

      Dúvida: a gente sabe como foi a performance das lojas no período da última Copa? Eu vejo que devemos ter cuidado em relacionar com Black Friday. Iria menos por esse gancho, salvo se tivermos dados internos de que as lojas tiveram pico durante o período. E lembrando que a copa foi em outro período: a última copa do mundo foi em nov/dez e a BF desse ano no e-commerce teve uma queda de 21%, em média (dado de mercado, não sei na Nuvem). Poucos setores tiveram alta

    3. Campanha Copa do Mundo

      Aqui pra mim é continuar com a ideia de Lumi, seguir ativações, e usar Copa como gancho. Dá para testar vários... exemplo: Sua equipe para para ver o brasil jogar? o Lumi não.

    4. Lumi Day

      Gosto evento online como um demo day e o EnP pode fazer o passo a passo. Mas vejo valor em também ter um evento físico, pra imprensa e pra lojistas, com apresentação da novidade, como ocorre com nuvemcommerce

      Eu não sei o nível que tá o Lumi, mas como ref: teve um evento há uns 2 anos onde a IA de uma empresa debatia com uma pessoa real sobre temas de inclusão. Eu esqueci o nome da empresa, mas na época foi algo super atrativo porque mostava a lucidez das respostas da IA da marca. Seria legal algo assim de demo.

    5. Demissão

      Esse conceito da Carta de Demissão é comum do mercado de infoproduto. Eu gosto bastante, acho provocativo. Consigo visualizar um vídeo de campanha bem interessante, talvez até com lojistas "tirando do ar" vagas no Linkedin - e aqui só entender se o tom não geraria desconforto demais. Do ponto de vista do lojista, ter tempo pra dedicar à gestão e estratégia do negócio é incrível. Minha dúvida é mais sobre o tom, pois se não tomar cuidado por soar como a "IA está substituindo pessoas" e gerar um buzz reverso. Não sei até que ponto Nuvemshop está disposta a este posicionamento, Vivi certamente pode falar mais sobre isso.

      Na raíz, o que estamos dando pro empreendedor é tempo. Com Lumi, ele pode dedicar o tempo para gerir e implementar/revisar estratégias para o negócio crescer. As mesmas 24h de antes, só que agora ele não está sozinho.

      Uma outra ideia de abordagem surge disso: início do turno 24/7, algo nesta linha. Brinca um pouco com a discussão do mercado sobre escala de trabalho...

      Um caminho foca na dor, outro no ganho

    1. variables de caracterización

      Sería bueno tener una tabla de caracterización por carrera para, por ejemplo, sabe la composición por genero en Ed. Parvulari o el % de colegios particulares en trabajo social, etc.

    1. The people elected Bill Clinton President

      分析句子结构:The people elected Bill Clinton President.

      这句话是一个典型的主谓宾补(SVOC)结构。它的核心逻辑是“主语动作了宾语,并使宾语处于某种状态或身份”。

      下面是该句子的详细拆解:

      1. 语法成分分析

      • The people (主语 - Subject): 执行动作的主体。
      • elected (谓语 - Verb): 动作。这是一个及物动词,且在此处作为不完全及物动词使用,因为它需要补足语才能表达完整意思。
      • Bill Clinton (宾语 - Object): 动作的承受者。
      • President (宾语补足语 - Object Complement): 重点就在这里。这个名词用来补充说明宾语 Bill Clinton 的身份

      2. 结构公式

      该句子的结构可以抽象为:

      Subject + Verb + Object + Object Complement (S + V + O + C)


      3. 深度解析:为什么是“补语”而不是“双宾语”?

      很多人会把这个结构跟“授予”类动词(如 Give me a book)混淆。辨别的方法很简单:

      • 看逻辑关系: 在本句中,宾语和补足语之间存在逻辑上的“主系表”关系。即:Bill Clinton IS President.(克林顿是总统)。
      • 对比双宾语:Give me a book 中,你不能说 I am a book

      4. 词法小贴士

      • 冠词省略: 在担任“唯一职位”或“头衔”的宾补位置上,名词前的冠词(如 the)通常可以省略。所以直接用 President 而不是 the President

      你想再尝试分析一个类似的结构,还是想看看这个句子如何转换成被动语态?

      那这两句又怎么说: John's father gave him a dog.  John's father called him a dog.

      如果用上面的逻辑关系分析方法,He is a dog,都说的通。

      这是一个非常经典的语法陷阱!你敏锐地察觉到了“逻辑关系”的相似性,但在这里,我们需要引入“语义逻辑”“动词属性”来做最终裁决。

      虽然从字面上看都能凑出 $He = a\ dog$,但它们在语法深层结构上完全不同:

      1. John's father gave him a dog. (双宾语结构)

      • 结构: 主语 + 谓语 + 间接宾语 (IO) + 直接宾语 (DO)
      • 逻辑: 这里的 gave 是一个授予动词(Ditative Verb)。它表示的是“所有权的转移”。
      • 为什么不是补语? 这里的 hima dog 是两个独立的实体。虽然你可以开玩笑说“他是一条狗”,但在正常的语义逻辑下,他(人)不等于狗(动物)。父亲把“狗”这个东西给了“他”。
      • 验证方法: 间接宾语和直接宾语通常可以用 tofor 改写:

        John's father gave a dog to him. (成立)


      2. John's father called him a dog. (宾补结构)

      • 结构: 主语 + 谓语 + 宾语 (O) + 宾语补足语 (C)
      • 逻辑: 这里的 called 是一个命名/定义动词。它不涉及任何实物的传递,而是涉及“认知”或“称呼”。
      • 为什么是补语? 这里的 a dog 是用来定义 him 的特征或身份的。在父亲的语言定义里,him = a dog(这里的狗通常是指骂人的隐喻)。
      • 验证方法: 1. 无法改写: 你不能说 John's father called a dog to him(这变成了把狗叫到他身边,意思全变了)。
      • 插入 to be: 在宾语和补语之间插入 to be 依然通顺:...called him to be a dog.

      对比总结表

      | 句子 | 动词类型 | 逻辑关系 | 结构名称 | | --- | --- | --- | --- | | Give him a dog | 授予动词 | 他 拥有 狗 (Ownership) | 双宾语 (S+V+IO+DO) | | Call him a dog | 定义动词 | 他 就是 狗 (Identity) | 宾补 (S+V+O+C) |

      💡 幽默警示

      这就是英语有趣的地方:

      • 如果你说 "Make me a sandwich," 你是在要吃的(双宾语:给我做个三明治)。
      • 如果你遇到一个会魔法的杠精,他可能会说 "Poof! You are a sandwich!"(宾补:把你变成了三明治)。

      既然聊到了这种容易混淆的结构,你想看看怎么通过“被动语态”的变换来一眼识别它们吗?(提示:其中一个句子有两个被动变法,另一个只有一个)

      既然你准备好了,咱们就用“被动语态测试法”来给这两个结构做个“亲子鉴定”。

      这个方法非常硬核,能让你在考场或写作时瞬间清醒:

      1. 双宾语 (Give him a dog) —— 左右逢源

      因为有两个宾语(人和物),所以它理论上有两种变法:

      • 变法 A(以人为中心): He was given a dog by John's father. (非常通顺)
      • 变法 B(以物为中心): A dog was given to him by John's father. (也通顺)
      • 结论: 既然两个词都能独立出来当主语,说明它们是两个平等的实体(两个宾语)。

      2. 宾补 (Call him a dog) —— 只有一条路

      因为 a dog 只是 him 的一个“标签”,它不能独立门户:

      • 变法 A(以人为中心): He was called a dog by John's father. (完全正确,他被骂成是狗)
      • 变法 B(以标签为中心): A dog was called him by John's father. (错误! 这变成了“一只狗被他父亲称呼为‘他’”,语义完全崩塌)
      • 结论: 补足语就像影子,必须跟着宾语走。一旦宾语变成主语,补语就变成了主语补足语

      ⚡️ 进阶挑战

      看看下面这两个句子,你能一眼看出哪个是“双宾语”,哪个是“宾补”吗?

      1. They found him a job.
      2. They found him a hero.

      提示: 试试看能不能改成 “He was found to be a...”?如果你觉得有难度,可以告诉我你的直觉!

    1. p.s. Want the visual map? You'll find a full FieldNote Sketch Summary of this inside the 'hidden' layer. Click this highlight to see the synthesis, share it with someone you know needs it and save a copy for yourself.

      Use this SketchNote in your own notes or share with a friend

    1. quando incorrer em dolo ou culpa
      • Vide que a regra constitucional, quanto à responsabilidade do empregador por acidentes de trabalho, é a responsabilidade subjetiva, exigindo-se demonstração de culpa ou dolo.
      • No entanto, sobretudo diante o recente Tema 932/STF, é constitucional a atribuição de responsabilidade objetiva ao empregador em hipóteses legais ou situações em que se impõe um risco de trabalho mais acentuado.
      • Por fim, importante frisar que não é correto atribuir indiscriminadamente responsabilidade objetiva ao empregador por todo e qualquer acidente de trabalho, na forma já pontuada.

      • Informativo 969
      • RE 828040 / DF
      • Órgão julgador: Tribunal Pleno
      • Relator(a): Min. ALEXANDRE DE MORAES
      • Julgamento: 12/03/2020 (Presencial)
      • Ramo do Direito: Civil, Constitucional
      • Matéria: Responsabilidade Civil - Direitos Sociais

      Responsabilidade civil objetiva e acidente de trabalho

      • O artigo 927, parágrafo único, do Código Civil é compatível com o artigo 7º, XXVIII, da Constituição Federal, sendo constitucional a responsabilização objetiva do empregador por danos decorrentes de acidentes de trabalho, nos casos especificados em lei, ou quando a atividade normalmente desenvolvida, por sua natureza, apresentar exposição habitual a risco especial, com potencialidade lesiva e implicar ao trabalhador ônus maior do que aos demais membros da coletividade.

      Resumo - É admissível — nos casos especificados por lei, ou em razão do risco inerente à própria atividade — a responsabilização objetiva do empregador por danos decorrentes de acidentes de trabalho.

      • O art. 927, parágrafo único, do Código Civil (CC) (1) é compatível com o art. 7º, XXVIII, da Constituição Federal (CF) (2), sendo constitucional a responsabilização objetiva do empregador por danos decorrentes de acidentes de trabalho nos casos especificados em lei ou quando a atividade normalmente desenvolvida, por sua natureza, apresentar exposição habitual a risco especial, com potencialidade lesiva, e implicar ao trabalhador ônus maior do que aos demais membros da coletividade.

      • Essa é a tese do Tema 932 da repercussão geral, fixada pelo Plenário, por maioria, ao negar provimento a recurso extraordinário (Informativo 950).

      Vencido o ministro Marco Aurélio.(1) CC/2002: “Art. 927. Aquele que, por ato ilícito (arts. 186 e 187), causar dano a outrem, fica obrigado a repará-lo. Parágrafo único. Haverá obrigação de reparar o dano, independentemente de culpa, nos casos especificados em lei, ou quando a atividade normalmente desenvolvida pelo autor do dano implicar, por sua natureza, risco para os direitos de outrem.” (2) CF/1988: “Art. 7º São direitos dos trabalhadores urbanos e rurais, além de outros que visem à melhoria de sua condição social: (...) XXVIII – seguro contra acidentes de trabalho, a cargo do empregador, sem excluir a indenização a que este está obrigado, quando incorrer em dolo ou culpa;”

      Legislação: CC/2002, art. 927. CF, art. 7º, XXVIII.

      Consultar todos os resumos relacionados ao processo (2)

  5. www.planalto.gov.br www.planalto.gov.br
    1. contados da ciência
      • O termo inicial do prazo decadencial para o direito de revisar/invalidar a tutela de urgência antecedente se constitui na data da ciência da decisão que extinguiu o processo.

      • Ou seja, <u>não</u> se deve contar da data da decisão que extinguiu o processo, nem mesmo da data da sua publicação; mas sim na data em que se tomou ciência inequívoca da referida decisão.

    1. qual é importância do perfil psicológico para investigação criminal?

      Traçar um perfil psicológico é muito importante em uma investigação criminal para entender quem é o agente do crime, se ele pode cometer outros crimes e qual a pena ideal para cada caso

    Annotators

    1. Author response:

      The following is the authors’ response to the current reviews.

      I thank the authors for their clarifications. The manuscript is much improved now, in my opinion. The new power spectral density plots and revised Figure 1 are much appreciated. However, there is one remaining point that I am unclear about. In the rebuttal, the authors state the following: "To directly address the question of whether the auditory signal was distracting, we conducted a follow-up MEG experiment. In this study, we observed a significant reduction in visual accuracy during the second block when the distractor was present (see Fig. 7B and Suppl. Fig. 1B), providing clear evidence of a distractor cost under conditions where performance was not saturated." 

      I am very confused by this statement, because both Fig. 7B and Suppl. Fig. 1B show that the visual- (i.e., visual target presented alone) has a lower accuracy and longer reaction time than visual+ (i.e., visual target presented with distractor). In fact, Suppl. Fig. 1B legend states the following: "accuracy: auditory- - auditory+: M = 7.2 %; SD = 7.5; p = .001; t(25) = 4.9; visual- - visual+: M = -7.6%; SD = 10.80; p < .01; t(25) = -3.59; Reaction time: auditory- - auditory +: M = -20.64 ms; SD = 57.6; n.s.: p = .08; t(25) = -1.83; visual- - visual+: M = 60.1 ms ; SD = 58.52; p < .001; t(25) = 5.23)." 

      These statements appear to directly contradict each other. I appreciate that the difficulty of auditory and visual trials in block 2 of MEG experiments are matched, but this does not address the question of whether the distractor was actually distracting (and thus needed to be inhibited by occipital alpha). Please clarify.

      We apologize for mixing up the visual and auditory distractor cost in our rebuttal. The reviewer is right in that our two statements contradict each other.

      To clarify: In the EEG experiment, we see significant distractor cost for auditory distractors in the accuracy (which can be seen in SUPPL Fig. 1A). We also see a faster reaction time with auditory distractors, which may speak to intersensory facilitation. As we used the same distractors for both experiments, it can be assumed that they were distracting in both experiments.

      In our follow-up MEG-experiment, as the reviewer stated, performance in block 2 was higher than in block 1, even though there were distractors present. In this experiment, distractor cost and learning effects are difficult to disentangle. It is possible that participants improved over time for the visual discrimination task in Block 1, as performance at the beginning was quite low. To illustrate this, we divided the trials of each condition into bins of 10 and plotted the mean accuracy in these bins over time (see Author response image 1). Here it can be seen that in Block 2, there is a more or less stable performance over time with a variation < 10 %. In Block 1, both for visual as well as auditory trials, an improvement over time can be seen. This is especially strong for visual trials, which span a difference of > 20%. Note that the mean performance for the 80-90 trial bin was higher than any mean performance observed in Block 2. 

      Additionally, the same paradigm has been applied in previous investigations, which also found distractor costs for the here-used auditory stimuli in blocked and non-blocked designs. See:

      Mazaheri, A., van Schouwenburg, M. R., Dimitrijevic, A., Denys, D., Cools, R., & Jensen, O. (2014). Region-specific modulations in oscillatory alpha activity serve to facilitate processing in the visual and auditory modalities. NeuroImage, 87, 356–362. https://doi.org/10.1016/j.neuroimage.2013.10.052

      Van Diepen, R & Mazaheri, A 2017, 'Cross-sensory modulation of alpha oscillatory activity: suppression, idling and default resource allocation', European Journal of Neuroscience, vol. 45, no. 11, pp. 1431-1438. https://doi.org/10.1111/ejn.13570

      Author response image 1.

      Accuracy development over time in the MEG experiment. During block 1, a performance increase over time can be observed for visual as well as for auditory stimuli. During Block 2, performance is stable over time. Data are presented as mean ± SEM. N = 27 (one participant was excluded from this analysis, as their trial count in at least one condition was below 90 trials).


      The following is the authors’ response to the previous reviews

      Reviewer #1 (Public review):

      In this study, Brickwedde et al. leveraged a cross-modal task where visual cues indicated whether upcoming targets required visual or auditory discrimination. Visual and auditory targets were paired with auditory and visual distractors, respectively. The authors found that during the cue-to-target interval, posterior alpha activity increased along with auditory and visual frequency-tagged activity when subjects were anticipating auditory targets. The authors conclude that their results disprove the alpha inhibition hypothesis, and instead implies that alpha "regulates downstream information transfer." However, as I detail below, I do not think the presented data irrefutably disproves the alpha inhibition hypothesis. Moreover, the evidence for the alternative hypothesis of alpha as an orchestrator for downstream signal transmission is weak. Their data serves to refute only the most extreme and physiologically implausible version of the alpha inhibition hypothesis, which assumes that alpha completely disengages the entire brain area, inhibiting all neuronal activity.

      We thank the reviewer for taking the time to provide additional feedback and suggestions and we improved our manuscript accordingly.

      (1) Authors assign specific meanings to specific frequencies (8-12 Hz alpha, 4 Hz intermodulation frequency, 36 Hz visual tagging activity, 40 Hz auditory tagging activity), but the results show that spectral power increases in all of these frequencies towards the end of the cue-to-target interval. This result is consistent with a broadband increase, which could simply be due to additional attention required when anticipating auditory target (since behavioral performance was lower with auditory targets, we can say auditory discrimination was more difficult). To rule this out, authors will need to show a power spectral density curve with specific increases around each frequency band of interest. In addition, it would be more convincing if there was a bump in the alpha band, and distinct bumps for 4 vs 36 vs 40 Hz band.

      This is an interesting point with several aspects, which we will address separately

      Broadband Increase vs. Frequency-Specific Effects:

      The suggestion that the observed spectral power increases may reflect a broadband effect rather than frequency-specific tagging is important. However, Supplementary Figure 11 shows no difference between expecting an auditory or visual target at 44 Hz. This demonstrates that (1) there is no uniform increase across all frequencies, and (2) the separation between our stimulation frequencies was sufficient to allow differentiation using our method.

      Task Difficulty and Performance Differences:

      The reviewer suggests that the observed effects may be due to differences in task difficulty, citing lower performance when anticipating auditory targets in the EEG study. This issue was explicitly addressed in our follow-up MEG study, where stimulus difficulty was calibrated. In the second block—used for analysis—accuracy between auditory and visual targets was matched (see Fig. 7B). The replication of our findings under these controlled conditions directly rules out task difficulty as the sole explanation. This point is clearly presented in the manuscript.

      Power Spectrum Analysis:

      The reviewer’s suggestion that our analysis lacks evidence of frequency-specific effects is addressed directly in the manuscript. While we initially used the Hilbert method to track the time course of power fluctuations, we also included spectral analyses to confirm distinct peaks at the stimulation frequencies. Specifically, when averaging over the alpha cluster, we observed a significant difference at 10 Hz between auditory and visual target expectation, with no significant differences at 36 or 40 Hz in that cluster. Conversely, in the sensor cluster showing significant 36 Hz activity, alpha power did not differ, but both 36 Hz and 40 Hz tagging frequencies showed significant effects These findings clearly demonstrate frequency-specific modulation and are already presented in the manuscript.

      (2) For visual target discrimination, behavioral performance with and without the distractor is not statistically different. Moreover, the reaction time is faster with distractor. Is there any evidence that the added auditory signal was actually distracting?

      We appreciate the reviewer’s observation regarding the lack of a statistically significant difference in behavioral performance for visual target discrimination with and without the auditory distractor. While this was indeed the case in our EEG experiment, we believe the absence of an accuracy effect may be attributable to a ceiling effect, as overall visual performance approached 100%. This high baseline likely masked any subtle influence of the distractor.

      To directly address the question of whether the auditory signal was distracting, we conducted a follow-up MEG experiment. In this study, we observed a significant reduction in visual accuracy during the second block when the distractor was present (see Fig. 7B and Suppl. Fig. 1B), providing clear evidence of a distractor cost under conditions where performance was not saturated.

      Regarding the faster reaction times observed in the presence of the auditory distractor, this phenomenon is consistent with prior findings on intersensory facilitation. Auditory stimuli, which are processed more rapidly than visual stimuli, can enhance response speed to visual targets—even when the auditory input is non-informative or nominally distracting (Nickerson, 1973; Diederich & Colonius, 2008; Salagovic & Leonard, 2021). Thus, while the auditory signal may facilitate motor responses, it can simultaneously impair perceptual accuracy, depending on task demands and baseline performance levels.

      Taken together, our data suggest that the auditory signal does exert a distracting influence, particularly under conditions where visual performance is not at ceiling. The dual effect—facilitated reaction time but reduced accuracy—highlights the complexity of multisensory interactions and underscores the importance of considering both behavioral and neurophysiological measures.

      (3) It is possible that alpha does suppress task-irrelevant stimuli, but only when it is distracting. In other words, perhaps alpha only suppresses distractors that are presented simultaneously with the target. Since the authors did not test this, they cannot irrefutably reject the alpha inhibition hypothesis.

      The reviewer’s claim that we did not test whether alpha suppresses distractors presented simultaneously with the target is incorrect. As stated in the manuscript and supported by our data (see point 2), auditory distractors were indeed presented concurrently with visual targets, and they were demonstrably distracting. Therefore, the scenario the reviewer suggests was not only tested—it forms a core part of our design.

      Furthermore, it was never our intention to irrefutably reject the alpha inhibition hypothesis. Rather, our aim was to revise and expand it. If our phrasing implied otherwise, we have now clarified this in the manuscript. Specifically, we propose that alpha oscillations:

      (a) Exhibit cyclic inhibitory and excitatory dynamics;

      (b) Regulate processing by modulating transfer pathways, which can result in either inhibition or facilitation depending on the network context.

      In our study, we did not observe suppression of distractor transfer, likely due to the engagement of a supramodal system that enhances both auditory and visual excitability. This interpretation is supported by prior findings (e.g., Jacoby et al., 2012), which show increased visual SSEPs under auditory task load, and by Zhigalov et al. (2020), who found no trial-by-trial correlation between alpha power and visual tagging in early visual areas, despite a general association with attention.

      Recent evidence (Clausner et al., 2024; Yang et al., 2024) further supports the notion that alpha oscillations serve multiple functional roles depending on the network involved. These roles include intra- and inter-cortical signal transmission, distractor inhibition, and enhancement of downstream processing (Scheeringa et al., 2012; Bastos et al., 2015; Zumer et al., 2014). We believe the most plausible account is that alpha oscillations support both functions, depending on context.

      To reflect this more clearly, we have updated Figure 1 to present a broader signal-transfer framework for alpha oscillations, beyond the specific scenario tested in this study.

      We have now revised Figure 1 and several sentences in the introduction and discussion, to clarify this argument.

      L35-37: Previous research gave rise to the prominent alpha inhibition hypothesis, which suggests that oscillatory activity in the alpha range (~10 Hz) plays a mechanistic role in selective attention through functional inhibition of irrelevant cortical areas (see Fig. 1; Foxe et al., 1998; Jensen & Mazaheri, 2010; Klimesch et al., 2007).

      L60-65: In contrast, we propose that functional and inhibitory effects of alpha modulation, such as distractor inhibition, are exhibited through blocking or facilitating signal transmission to higher order areas (Peylo et al., 2021; Yang et al., 2023; Zhigalov & Jensen, 2020; Zumer et al., 2014), gating feedforward or feedback communication between sensory areas (see Fig. 1; Bauer et al., 2020; Haegens et al., 2015; Uemura et al., 2021).

      L482-485: This suggests that responsiveness of the visual stream was not inhibited when attention was directed to auditory processing and was not inhibited by occipital alpha activity, which directly contradicts the proposed mechanism behind the alpha inhibition hypothesis.

      L517-519: Top-down cued changes in alpha power have now been widely viewed to play a functional role in directing attention: the processing of irrelevant information is attenuated by increasing alpha power in areas involved with processing this information (Foxe, Simpson, & Ahlfors, 1998; Hanslmayr et al., 2007; Jensen & Mazaheri, 2010).

      L566-569: As such, it is conceivable that alpha oscillations can in some cases inhibit local transmission, while in other cases, depending on network location, connectivity and demand, alpha oscillation can facilitate signal transmission. This mechanism allows to increase transmission of relevant information and to block transmission of distractors.

      (4) In the abstract and Figure 1, the authors claim an alternative function for alpha oscillations; that alpha "orchestrates signal transmission to later stages of the processing stream." In support, the authors cite their result showing that increased alpha activity originating from early visual cortex is related to enhanced visual processing in higher visual areas and association areas. This does not constitute a strong support for the alternative hypothesis. The correlation between posterior alpha power and frequency-tagged activity was not specific in any way; Fig. 10 shows that the correlation appeared on both 1) anticipating-auditory and anticipating-visual trials, 2) the visual tagged frequency and the auditory tagged activity, and 3) was not specific to the visual processing stream. Thus, the data is more parsimonious with a correlation than a causal relationship between posterior alpha and visual processing.

      Again, the reviewer raises important points, which we want to address

      The correlation between posterior alpha power and frequency-tagged activity was not specific, as it is present both when auditory and visual targets are expected:

      If there is a connection between posterior alpha activity and higher-order visual information transfer, then it can be expected that this relationship remains across conditions and that a higher alpha activity is accompanied by higher frequency-tagged activity, both over trials and over conditions. However, it is possible that when alpha activity is lower, such as when expecting a visual target, the signal-to-noise ratio is affected, which may lead to higher difficulty to find a correlation effect in the data when using non-invasive measurements.

      The connection between alpha activity and frequency-tagged activity appears both for auditory as well as visual stimuli and The correlation is not specific to the visual processing stream:

      While we do see differences between conditions (e.g. in the EEG-analysis, mostly 36 Hz correlated with alpha activity and only in one condition 40 Hz showed a correlation as well), it is true that in our MEG analysis, we found correlations both between alpha activity and 36 Hz as well as alpha activity and 40 Hz.  

      We acknowledge that when analysing frequency-tagged activity on a trial-by-trial basis, where removal of non-timelocked activity through averaging (which we did when we tested for condition differences in Fig. 4 and 9) is not possible, there is uncertainty in the data. Baseline-correction can alleviate this issue, but it cannot offset the possibility of non-specific effects. We therefore decided to repeat the analysis with a fast-fourier calculated power instead of the Hilbert power, in favour of a higher and stricter frequency-resolution, as we averaged over a time-period and thus, the time-domain was not relevant for this analysis. In this more conservative analysis, we can see that only 36 Hz tagged activity when expecting an auditory target correlated with early visual alpha activity.

      Additionally, we added correlation analyses between alpha activity and frequency-tagged activity within early visual areas, using the sensor cluster which showed significant condition differences in alpha activity. Here, no correlations between frequency-tagged activity and alpha activity could be found (apart from a small correlation with 40 Hz which could not be confirmed by a median split; see SUPPL Fig. 14 C). The absence of a significant correlation between early visual alpha and frequency-tagged activity has previously been described by others (Zhigalov & Jensen, 2020) and a Bayes factor of below 1 also indicated that the alternative hypotheses is unlikely.

      Nonetheless, a correlation with auditory signal is possible and could be explained in different ways. For example, it could be that very early auditory feedback in early visual cortex (see for example Brang et al., 2022) is transmitted alongside visual information to higher-order areas. Several studies have shown that alpha activity and visual as well as auditory processing are closely linked together (Bauer et al., 2020; Popov et al., 2023). Inference on whether or how this link could play out in the case of this manuscript expands beyond the scope of this study.

      To summarize, we believe the fact that 36 Hz activity within early visual areas does not correlate with alpha activity on a trial-by-trial basis, but that 36 Hz activity in other areas does, provides strong evidence that alpha activity affects down-stream signal processing.

      We mention this analysis now in our discussion:

      L533-536: Our data provides evidence in favour of this view, as we can show that early sensory alpha activity does not covary over trials with SSEP magnitude in early visual areas, but covaries instead over trials with SSEP magnitude in higher order sensory areas (see also SUPPL. Fig. 14).

      Reviewer #1 (Recommendations for the authors):

      The evidence for the alternative hypothesis, that alpha in early sensory areas orchestrates downstream signal transmission, is not strong enough to be described up front in the abstract and Figure 1. I would leave it in the Discussion section, but advise against mentioning it in the abstract and Figure 1.

      We appreciate the reviewer’s concern regarding the inclusion of the alternative hypothesis—that alpha activity in early sensory areas orchestrates downstream signal transmission—in the abstract and Figure 1. While we agree that this interpretation is still developing, recent studies (Keitel et al., 2025; Clausner et al., 2024; Yang et al., 2024) provide growing support for this framework.

      In response, we have revised the introduction, discussion, and Figure 1 to clarify that our intention is not to outright dismiss the alpha inhibition hypothesis, but to refine and expand it in light of new data. This revision does not invalidate the prior literature on alpha timing and inhibition; rather, it proposes an updated mechanism that may better account for observed effects.

      We have though retained Figure 1, as it visually contextualizes the broader theoretical landscape. while at the same time added further analyses to strengthen our empirical support for this emerging view.

      References:

      Bastos, A. M., Litvak, V., Moran, R., Bosman, C. A., Fries, P., & Friston, K. J. (2015). A DCM study of spectral asymmetries in feedforward and feedback connections between visual areas V1 and V4 in the monkey. NeuroImage, 108, 460–475. https://doi.org/10.1016/j.neuroimage.2014.12.081

      Bauer, A. R., Debener, S., & Nobre, A. C. (2020). Synchronisation of Neural Oscillations and Cross-modal Influences. Trends in cognitive sciences, 24(6), 481–495. https://doi.org/10.1016/j.tics.2020.03.003

      Brang, D., Plass, J., Sherman, A., Stacey, W. C., Wasade, V. S., Grabowecky, M., Ahn, E., Towle, V. L., Tao, J. X., Wu, S., Issa, N. P., & Suzuki, S. (2022). Visual cortex responds to sound onset and offset during passive listening. Journal of neurophysiology, 127(6), 1547–1563. https://doi.org/10.1152/jn.00164.2021

      Clausner T., Marques J., Scheeringa R. & Bonnefond M (2024). Feature specific neuronal oscillations in cortical layers BioRxiv :2024.07.31.605816. https://doi.org/10.1101/2024.07.31.605816

      Diederich, A., & Colonius, H. (2008). When a high-intensity "distractor" is better then a low-intensity one: modeling the effect of an auditory or tactile nontarget stimulus on visual saccadic reaction time. Brain research, 1242, 219–230. https://doi.org/10.1016/j.brainres.2008.05.081

      Haegens, S., Nácher, V., Luna, R., Romo, R., & Jensen, O. (2011). α-Oscillations in the monkey sensorimotor network influence discrimination performance by rhythmical inhibition of neuronal spiking. Proceedings of the National Academy of Sciences of the United States of America, 108(48), 19377–19382. https://doi.org/10.1073/pnas.1117190108

      Jacoby, O., Hall, S. E., & Mattingley, J. B. (2012). A crossmodal crossover: opposite effects of visual and auditory perceptual load on steady-state evoked potentials to irrelevant visual stimuli. NeuroImage, 61(4), 1050–1058. https://doi.org/10.1016/j.neuroimage.2012.03.040

      Keitel, A., Keitel, C., Alavash, M., Bakardjian, K., Benwell, C. S. Y., Bouton, S., Busch, N. A., Criscuolo, A., Doelling, K. B., Dugue, L., Grabot, L., Gross, J., Hanslmayr, S., Klatt, L.-I., Kluger, D. S., Learmonth, G., London, R. E., Lubinus, C., Martin, A. E., … Kotz, S. A. (2025). Brain rhythms in cognition – controversies and future directions. ArXiv. https://doi.org/10.48550/arXiv.2507.15639

      Nickerson R. S. (1973). Intersensory facilitation of reaction time: energy summation or preparation enhancement?. Psychological review, 80(6), 489–509. https://doi.org/10.1037/h0035437

      Popov, T., Gips, B., Weisz, N., & Jensen, O. (2023). Brain areas associated with visual spatial attention display topographic organization during auditory spatial attention. Cerebral cortex (New York, N.Y. : 1991), 33(7), 3478–3489. https://doi.org/10.1093/cercor/bhac285

      Salagovic, C. A., & Leonard, C. J. (2021). A nonspatial sound modulates processing of visual distractors in a flanker task. Attention, perception & psychophysics, 83(2), 800–809. https://doi.org/10.3758/s13414-020-02161-5

      Scheeringa, R., Petersson, K. M., Kleinschmidt, A., Jensen, O., & Bastiaansen, M. C. (2012). EEG α power modulation of fMRI resting-state connectivity. Brain connectivity, 2(5), 254–264. https://doi.org/10.1089/brain.2012.0088

      Spaak, E., Bonnefond, M., Maier, A., Leopold, D. A., & Jensen, O. (2012). Layer-specific entrainment of γ-band neural activity by the α rhythm in monkey visual cortex. Current biology : CB, 22(24), 2313–2318. https://doi.org/10.1016/j.cub.2012.10.020

      Yang, X., Fiebelkorn, I. C., Jensen, O., Knight, R. T., & Kastner, S. (2024). Differential neural mechanisms underlie cortical gating of visual spatial attention mediated by alpha-band oscillations. Proceedings of the National Academy of Sciences of the United States of America, 121(45), e2313304121. https://doi.org/10.1073/pnas.2313304121

      Zhigalov, A., & Jensen, O. (2020). Alpha oscillations do not implement gain control in early visual cortex but rather gating in parieto-occipital regions. Human brain mapping, 41(18), 5176–5186. https://doi.org/10.1002/hbm.25183

      Zumer, J. M., Scheeringa, R., Schoffelen, J. M., Norris, D. G., & Jensen, O. (2014). Occipital alpha activity during stimulus processing gates the information flow to object-selective cortex. PLoS biology, 12(10), e1001965. https://doi.org/10.1371/journal.pbio.1001965

    1. Author response:

      The following is the authors’ response to the previous reviews

      Public Reviews:

      Reviewer #1 (Public review):

      The authors have adequately responded to all comments.

      We thank Reviewer 1 for their positive assessment of our previous round of revisions.

      Reviewer #2 (Public review):

      Summary:

      The authors combine a clever use of historical clinical data on infection duration in immunologically naive individuals and queuing theory to infer the force of infection (FOI) from measured multiplicity of infection (MOI) in a sparsely sampled setting. They conduct extensive simulations using agent based modeling to recapitulate realistic population dynamics and successfully apply their method to recover FOI from measured MOI. They then go on to apply their method to real world data from Ghana before and after an indoor residual spraying campaign.

      Strengths:

      - The use of historical clinical data is very clever in this context

      - The simulations are very sophisticated with respect to trying to capture realistic population dynamics

      - The mathematical approach is simple and elegant, and thus easy to understand

      Weakness:

      The assumptions of the approach are quite strong, and the authors have made clear that applicability is constrained to individuals with immune profiles that are similar to malaria naive patients with neurosyphilis. While the historical clinical data is a unique resource and likely directionally correct, it remains somewhat dubious to use the exact estimated values as inputs to other models without extensive sensitivity analysis.

      We thank reviewer 2 for their comments on our previous round of revisions. The statement here that “it remains somewhat dubious to use the exact estimated values as inputs to other models” suggests that we may not have been sufficiently clear on how infection duration is represented in our agent-based model (ABM) of malaria population dynamics. Because our analysis uses simulated outputs from the ABM to validate the performance of the two queuing-theory methods, we believe this point warrants clarification, which we provide below.

      When simulating with the ABM, we do not use empirical estimates of infection duration in immunologically naïve individuals from the historical clinical data as direct inputs. Instead, infection duration emerges from the within-host dynamics modeled in the ABM (lines 800-816, second paragraph of the subsection Within-host dynamics in Appendix 1-Simulation data of the previous revision). Briefly, each Plasmodium falciparum parasite carries approximately 50-60 var genes, each encoding a distinct variant surface antigen expressed during the blood stage of infection. Empirical evidence[1,2] indicates that these var genes are expressed largely sequentially. If a host has previously encountered the antigenic product of a given var gene and retains immunity to it, subject to waning at empirically estimated rates[3,4], the corresponding parasite subpopulation is rapidly cleared. Conversely, if the host is naïve to that gene, it takes approximately seven days for the immune system to mount an effective antibody response, resulting in a rapid decline or elimination of the expressed variant[5]. This seven-day timescale aligns with the duration of each successive parasitemia peak observed in Plasmodium falciparum infections[6,7], each arising primarily from the expression of a single var gene and occasionally from a small number of var genes.

      In our previous analyses, we therefore modeled an average expression duration of seven days per gene in naïve hosts. Specifically, the switching time to the next gene was drawn from an exponential distribution with a mean of seven days. Each var gene is represented as a linear combination of two epitopes (alleles), based on the empirical characterization of two hypervariable regions in the var tag region[8], and immunity is acquired against these alleles. Immunity to one allele of a given gene reduces its average expression duration by approximately half, whereas immunity to both alleles results in an immediate switch to another var gene within the infection. Consequently, the total duration of infection is proportional to the number of unseen alleles by the host across all var genes expressed during that infection (lines 800-816, second paragraph of the subsection Within-host dynamics in Appendix 1-Simulation data of the previous revision).

      Prompted by the reviewer’s comments, in this revision we additionally tested mean expression durations of 7.5 and 8 days per var gene, together with an extension of the within-host rules. These values were applied in combination with the extended within-host rules (see the next paragraph for motivation and details). Although differences among the three mean expression durations are modest at the per-gene level, when aggregated across all var genes expressed within an individual parasite, the resulting total infection duration can differ by on the order of several months. The resulting distributions of infection duration across immunologically naïve individuals and those aged 1-5 years, together with those generated under our previous simulation settings, span a range of means and variances that lies above and below, but encompasses, scenarios comparable to the historical clinical data from naïve neurosyphilis patients treated with P. falciparum malaria. We have provided example supplementary figures illustrating that the distributions of infection duration from the simulated outputs overlap with, and closely resemble, the empirical distribution from the historical clinical data (Appendix 1-Figure 27-32).

      We considered the following modification of the within-host rules. In our previous ABM simulations, we had assumed that an infection would clear only once the parasite had exhausted its entire var gene repertoire, that is, after every var gene had been expressed and recognized. However, biological evidence indicates that clearance can occur earlier for several reasons, including stochastic extinction before full repertoire exhaustion. Even if some var genes remain unexpressed, an infection can terminate due to demographic stochasticity once parasite densities fall to very low levels. This decline in parasite densities may result from non-variant-specific immune mechanisms or from cross-immunity among var genes that share sequence similarity or alleles[9,10,11], both of which can substantially reduce parasite numbers. To model the possibility of termination or clearance before full repertoire exhaustion, we implemented a simple scenario in which there is a small probability of clearing the current infection while a given var gene-whether non-final or final-is being expressed. This probability is a function of the host’s pre-existing immunity to the two epitopes (alleles) of that gene, thereby capturing in a parsimonious manner the effects of cross-immunity among sequence- or allele-sharing var genes in reducing parasitemia. Specifically, it is modeled as a Bernoulli draw whose success probability equals the immunity level against the gene (0 for no immunity to either epitope, 0.5 for immunity to one epitope, and 1 for immunity to both epitopes) multiplied by a constant factor of 0.025. Thus, the probability scales with pre-existing variant-specific immunity to the gene but remains small overall, while introducing additional variance into the emergent distribution of total infection duration across hosts.

      We acknowledge that the ABM used to simulate malaria population dynamics cannot capture all mechanisms and complexities underlying within-host processes, many of which remain poorly understood. However, we emphasize that the resulting distributions of infection duration generated by the ABM span a broad range of means, variances, and shapes, including distributions that closely match those observed in the clinical historical data. Because the queueing-theory methods rely on only the mean and variance of infection duration to estimate the force of infection (FOI), these scenarios, which collectively span and encompass values comparable to the empirical ones, provide an appropriate basis for evaluating the performance of the methods using simulated outputs. We have added supplementary figures (see Appendix 1-Figure 16-22) illustrating the corresponding FOI inference results when we allow for clearance before the complete expression of the var repertoire, and the accuracy of FOI estimation remains comparable across all the scenarios examined.

      Finally, we emphasize that the application of the queuing-theory methods to the simulated outputs and to the Ghana field survey data involve two self-contained steps. For the simulations, FOI is inferred directly from the emergent distributions of infection duration generated by the ABM. For the Ghana surveys, FOI is inferred using the historical clinical data, which remains one of the few credible and widely used empirical sources for infection duration in immunologically naïve individuals[6]. By exploring different mean expression durations and within-host rules in the ABM, which generates distributions of infection duration that span and encompass those comparable to the empirical distribution, we demonstrate that the queueing-theory methods perform comparably across diverse scenarios and are well suited for application to the Ghana field surveys.

      We expanded the section on within-host dynamics in Appendix 1 to elaborate on this point (Lines 817-854).

      Reviewer #3 (Public review):

      I think the authors gave a robust but thorough response to our reviews and made some important changes to the manuscript which certainly clarify things for me.

      We thank Reviewer 3 for their positive feedback on our previous round of revisions.

      References

      (1) Zhang, X. & Deitsch, K. W. The mystery of persistent, asymptomatic Plasmodium falciparum infections. Curr. Opin. Microbiol 70, 102231 (2022).

      (2) Deitsch, K. W. & Dzikowski, R. Variant gene expression and antigenic variation by malaria parasites. Annu. Rev. Microbiol. 71, 625–641 (2017).

      (3) Collins, W. E., Skinner, J. C. & Jeffery, G. M. Studies on the persistence of malarial antibody response. American journal of epidemiology, 87(3), 592–598 (1968).

      (4) Collins, W. E., Jeffery, G. M. & Skinner, J. C. Fluorescent Antibody Studies in Human Malaria. II. Development and Persistence of Antibodies to Plasmodium falciparum. The American journal of tropical medicine and hygiene, 13, 256–260 (1964).

      (5) Gatton, M. L., & Cheng, Q. Investigating antigenic variation and other parasite-host interactions in Plasmodium falciparum infections in naïve hosts. Parasitology, 128(Pt 4), 367–376 (2004).

      (6) Maire, N., Smith, T., Ross, A., Owusu-Agyei, S., Dietz, K., & Molineaux, L. A model for natural immunity to asexual blood stages of Plasmodium falciparum malaria in endemic areas. The American journal of tropical medicine and hygiene, 75(2 Suppl), 19–31 (2006).

      (7) Chen D. S., Barry A. E., Leliwa-Sytek A., Smith T-A., Peterson I., Brown S. M., et al. A Molecular Epidemiological Study of var Gene Diversity to Characterize the Reservoir of Plasmodium falciparum in Humans in Africa. PLoS ONE 6(2): e16629 (2011).

      (8) Larremore D. B., Clauset A., & Buckee C. O. A Network Approach to Analyzing Highly Recombinant Malaria Parasite Genes. PLoS Comput Biol 9(10): e1003268 (2013).

      (9) Holding T. & Recker M. Maintenance of phenotypic diversity within a set of virulence encoding genes of the malaria parasite Plasmodium falciparum. J. R. Soc. Interface.1220150848 (2015).

      (10) Crompton, P. D., Moebius, J., Portugal, S., Waisberg, M., Hart, G., Garver, L. S., Miller, L. H., Barillas-Mury, C., & Pierce, S. K. Malaria immunity in man and mosquito: insights into unsolved mysteries of a deadly infectious disease. Annual review of immunology, 32, 157–187 (2014).

      (11) Langhorne, J., Ndungu, F., Sponaas, AM. et al. Immunity to malaria: more questions than answers. Nat Immunol 9, 725–732 (2008).

    1. 2.5.3 Propiedades espectrales y convergencia La matriz P resultante posee propiedades espectrales fundamentales que garantizan la existencia, unicidad y estabilidad numérica del vector PageRank: Estocasticidad: Cada columna de P suma la unidad, ∑i=1124pij=1 para todo j. Irreducibilidad: Para cualquier par de municipios i,j, existe un entero k≥1 tal que (Pk)ij>0. Esta propiedad asegura que cualquier nodo puede alcanzarse desde cualquier otro con probabilidad positiva. Aperiodicidad: El máximo común divisor de las longitudes de todos los ciclos que retornan a un estado dado es igual a 1. Esta condición evita que el proceso quede atrapado en ciclos periódicos. Autovalor dominante: λ1=1 es un autovalor simple de P, y todos los demás autovalores λk satisfacen |λk|≤p<1. Por el teorema de Perron-Frobenius para matrices estocásticas irreducibles y aperiódicas, existe un único vector estacionario π con componentes estrictamente positivas que satisface π=Pπ. Además, para cualquier distribución inicial π(0) válida, la sucesión definida por: π(k+1)=Pπ(k),k=0,1,2,… converge exponencialmente rápido hacia π, con tasa de convergencia O(pk).

      quiatr la sección porque ya se dijo antes

    1. Juliet. The clock struck nine when I did send the nurse; 1375In half an hour she promised to return. Perchance she cannot meet him: that's not so. O, she is lame! love's heralds should be thoughts, Which ten times faster glide than the sun's beams, Driving back shadows over louring hills: 1380Therefore do nimble-pinion'd doves draw love, And therefore hath the wind-swift Cupid wings. Now is the sun upon the highmost hill Of this day's journey, and from nine till twelve Is three long hours, yet she is not come. 1385Had she affections and warm youthful blood, She would be as swift in motion as a ball; My words would bandy her to my sweet love, And his to me: But old folks, many feign as they were dead; 1390Unwieldy, slow, heavy and pale as lead. O God, she comes! [Enter Nurse and PETER] O honey nurse, what news? Hast thou met with him? Send thy man away. 1395 Nurse. Peter, stay at the gate

      The Nurse asks where she can find Romeo. Romeo jokingly replies that “young Romeo” will be older by the time she finds him and says he is the youngest Romeo, showing his playful and witty humor.

    2. riar Laurence. The grey-eyed morn smiles on the frowning night, Chequering the eastern clouds with streaks of light, 1060And flecked darkness like a drunkard reels From forth day's path and Titan's fiery wheels: Now, ere the sun advance his burning eye, The day to cheer and night's dank dew to dry, I must up-fill this osier cage of ours 1065With baleful weeds and precious-juiced flowers. The earth that's nature's mother is her tomb; What is her burying grave that is her womb, And from her womb children of divers kind We sucking on her natural bosom find, 1070Many for many virtues excellent, None but for some and yet all different. O, mickle is the powerful grace that lies In herbs, plants, stones, and their true qualities: For nought so vile that on the earth doth live 1075But to the earth some special good doth give, Nor aught so good but strain'd from that fair use Revolts from true birth, stumbling on abuse: Virtue itself turns vice, being misapplied; And vice sometimes by action dignified. 1080Within the infant rind of this small flower Poison hath residence and medicine power: For this, being smelt, with that part cheers each part; Being tasted, slays all senses with the heart. Two such opposed kings encamp them still 1085In man as well as herbs, grace and rude will; And where the worser is predominant, Full soon the canker death eats up that plant.

      Friar Laurence explains that nature has both good and bad qualities. Plants can heal or poison depending on how they are used. He compares this to humans, saying people also have both good and evil inside them.

    1. Se inicia con la pregunta de ¿qué pasa si un medio pone en circulación ideas nuevas? y de cómo esto ha ocurrido desde hace mucho tiempo con varios de los inventos que fueron creados con el próposito de la paz mundial pero se enfatiza de que esto nunca se logró. Lo que llega a evidenciar que entre más ideas existas, habrían más ideas con las qque poder estar de acuerdo o no a nivel personal.

      A esta idea, es pertinente especificar la marca del tiempo.

    1. Note: This response was posted by the corresponding author to Review Commons. The content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Manuscript number: RC-2025-03242R

      Corresponding author(s): Shinya Kuroda

      1. General Statements

      We appreciate the reviewers for the critical review of the manuscript and the valuable comments. We have carefully considered the reviewer's comments and have revised our manuscript accordingly.

      The reviewers' comments in this letter are in Bold and Italics.

      2. Point-by-point description of the revisions

      Response to Reviewer #1's Comments

      Evidence, reproducibility and clarity:

      Major comments

      1. This study leaves out lipid metabolism as a major energy metabolism pathway relevant to AD. The authors themselves cite the significance of acylcarnitines and CPT1A in AD (pg. 3, lines 32-33, pg. 4, lines 1-2). Lipid metabolism and homeostasis is known to be disrupted in AD1. Fatty acid oxidation is a known energy source in the prefrontal cortex2 and will also generate acetyl coA, which this study reveals is a significant decreased metabolite in AD. Furthermore, sphingomyelin emerges as one of the major decreased DEMs as well. Thus, lipid metabolism should be highlighted in Figure 3 and discussed throughout the manuscript; otherwise its omission should be clearly stated and justified.

      We appreciate the reviewer's insightful comment regarding a critical role of lipid metabolism in AD. We recognize that lipid metabolism is a metabolic pathway deeply involved in AD pathology (Baloni et al., 2022, 2020; Varma et al., 2021). Accordingly, we have revised the Limitations section to more strongly emphasize its role as a vital energy source (pg. 13, lines 15-17). Regarding the visualization of lipid metabolism, we extracted lipid-related pathway from the trans-omic network but found that the regulatory relationships among DEPs and DEMs were excessively complex and interconnected. Thus, interpreting this regulatory network seemed to be more challenging compared to the other energy production pathways presented in our manuscript. Therefore, we have concluded that the pathway analysis in our trans-omic network may not be suitable for deeply elucidating the lipid dysregulation in AD. We have added a statement acknowledging this as a limitation of our current methodology in the revised manuscript (pg. 13, lines 13-22).

      The covariates used for differential analysis should be discussed and justified. Notably, age is used as a covariate for transcriptomic analysis but not proteomic and metabolomic analysis, with no justification. Additionally, given the known importance of lipid metabolism in AD and the putative role of APOE in lipid homeostasis3, APOE genetic status should be considered as a covariate, or its omission should be justified.<br />

      We appreciate the reviewer's comment regarding the included covariates in differential analyses of our study. The reason we did not include other variables, such as age at death and RIN, is that these data were not available for each sample. Thus, we referred to the original research articles from which proteomic or metabolomic datasets used in our study were derived. Regarding the metabolomic dataset, in the original article (Batra et al., 2023), only two metabolites, 1-methyl-5-imidazoleacetate and N6-carboxymethyllysine, were significantly associated with age. In addition, no metabolites were significantly associated with sex, BMI, and years of education. Regarding the proteomic dataset, in the original article (Johnson et al., 2020), age at death, PMI, and sex were included as covariates in the analyses, though these variables were not found to strongly influence the data (Extended Data Fig.2 in (Johnson et al., 2020)).

      The authors make a conclusion statement that suggests intervention: "Collectively, our data suggests that preserving or improving the ability to produce ATP and early intervention in the process of nitrogen metabolism are candidates for the prevention and treatment of dementia" (pg. 12, lines 12-14). This claim is not well-supported by the evidence provided in the study. There are a few limitations: (a) This was an observational, not interventional study; (b) The study did not establish whether the metabolic disruptions are causes or effects in AD; and (c) ATP or other bioenergetic indicators were not directly measured. Therefore, any statements about potential interventions should be removed or qualified as highly speculative.

      We agree with the reviewer that the statement regarding potential interventions was not sufficiently supported by our analyses. Accordingly, we have removed the sentence regarding prevention and treatment from the revised manuscript (e.g., we have deleted final paragraph of the previous manuscript).

      In conjunction with the last point, the main conclusion of the study is that energy production is down in AD. The data presented in Figure 3 are consistent with this conclusion, but it is far from definitive due to limitations stated above in comments 3a and 3b. The authors should offer additional support for this conclusion: experimental follow-up, flux modeling, analysis of alternative datasets with ATP measurement, causal inference.<br />

      We sincerely thank the reviewer for this valuable and constructive suggestion. Regarding flux modeling, we agree that metabolic flux analysis could provide important mechanistic insight. Indeed, previous studies have applied flux modeling in the context of lipid metabolism in Alzheimer's disease (Baloni et al., 2022). We also attempted to perform flux modeling focusing on energy metabolism. However, we found it difficult to obtain biologically meaningful and robust results and therefore decided not to include these analyses in the current manuscript.

      With respect to ATP measurements, we fully agree that direct evidence of altered ATP levels would further strengthen our conclusion. However, to the best of our knowledge, there are currently no publicly available large-scale datasets that directly measure ATP levels in human postmortem brain tissues. This limitation makes it challenging to incorporate validation in the present study.

      Regarding experimental follow-up, we agree that functional validation is essential to confirm the mechanistic implications of our findings. We are actively considering follow-up experimental studies. However, we consider the present work to be a multi-omic integrative analysis aimed at identifying key molecular alterations and generating biologically important hypotheses. We have revised the Limitation section to more clearly position this manuscript as an observational systems-level analysis (pg. 13, lines 20-22).

      The validation analysis did not sufficiently show the generalizability of this study's results. The authors demonstrated a correlation of 0.53 to the MSBB transcriptomics data and 0.60 to the AMP-AD DiverseCohorts proteomics data. Beyond these correlation coefficients, no meaningful comparison between the datasets is offered. How concordant are the differentially expressed features (or pathways) between the datasets? How robust would the trans-omic network be if incorporating the alternate datasets? Is the main conclusion (energy metabolism is down in AD) supported by the validation datasets? We think this analysis should be expanded and described in the main text. Although the results for external metabolomics datasets are reported in Fig S2C, correlation coefficients with the external data are not reported. The authors state, "Note that each study used different definitions for AD and CT groups, had variations in measurement methods and brain regions analyzed." We appreciate these limitations. However, the external data should be re-analyzed using the same definitions of AD and CT, if possible. The limitations and results (which DEMs are shared between datasets) should be discussed in the main text. __

      We thank the reviewer for this important comment regarding the generalizability of our findings. In the revised manuscript, we have expanded the validation analyses and summarized the results in Figure S2. First, at the transcriptomic level, Figure S2B and S2C show the overlap between up- and downregulated genes in AD identified in our ROSMAP-derived analyses and those reported in a previously published large-scale meta-analysis of 2,114 postmortem samples across seven brain regions (Wan et al., 2020). A substantial proportion of DEGs were shared, supporting cross-cohort and cross-region robustness to some extent. At the proteomic level, Figure S2E shows a comparison between the ROSMAP and the AMP-AD DiverseCohorts datasets. We highlighted the subset of enzymes involved in the energy metabolism analysis shown in Fig. 3 and calculated a separate correlation coefficient for this subset (Pearson coefficient = 0.86, p-value = 1.5e-7), further supporting our main conclusion. In addition, to assess the concordance between the two datasets in a threshold-independent manner, we additionally performed Rank-Rank Hypergeometric Overlap (RRHO) analysis (Figure S2E). RRHO analysis (Cahill et al., 2018; Plaisier et al., 2010) enables the comparison of ranked protein lists without relying on arbitrary differential expression cutoffs and has been used for cross-dataset comparison in several previous studies (Fröhlich et al., 2024; Maitra et al., 2023). The RRHO heatmaps demonstrated significant enrichment in the concordant quadrants, confirming systematic agreement between datasets beyond simple correlation coefficients. For metabolomics, Figure S2G shows RRHO analyses comparing the ROSMAP metabolomic data with other datasets measured by the same UPLC-MS/MS platform (Batra et al., 2024; Novotny et al., 2023), demonstrating significant concordance in ranked metabolite changes in AD.

      The glycolysis analysis and discussion needs more development. Glycolysis and gluconeogenesis share many of the same enzymes, but they are not the same pathway and should not be discussed as such. To make a claim about the overall influence of enzyme and metabolite levels on glycolysis, the authors should focus on the energetically committing steps of glycolysis (hexokinase, phosphofructokinase, pyruvate kinase) in Figure 3A, and include the full/current version of the figure in the supplement. Gluconeogenesis-specific enzymes (pyruvate carboxylase, PEPCK) are not mentioned at all - are they among the DEPs/DEGs?<br />

      We appreciate the reviewer's comment regarding the distinction between glycolysis and gluconeogenesis pathway. Among the gluconeogenesis-specific enzyme proteins, G6PC1, FBP1, PC, and PCK2 were measured in our dataset, but none of them were identified as DEPs. In addition, gluconeogenesis is a process that occurs primarily in the liver and kidney rather than the brain. Given this biological context and the lack of significant changes in relevant enzymes, we have revised the terminology throughout the manuscript, replacing "glycolysis/gluconeogenesis pathway" with "glycolysis pathway" in the revised version.

      Given that there wasn't good concordance between the DEGs and DEPs, did including the mRNA and transcription factor layers in the network really add anything useful? It seems like the main conclusions of the manuscript were driven by the protein and metabolite layers only. How many of the DE metabolic enzymes were coregulated at the transcript and protein level? It would be useful to include the 5-layer trans-omic network in the supplement to display these results. Given your network, at what level does it appear that energy metabolism is regulated?<br />

      It is true that our primary conclusion regarding the regulation of energy metabolism is driven by the changes in protein and metabolite abundance. However, we consider the low concordance between mRNA and protein expression itself to be an important feature of AD pathology, as also reported in previous studies (Johnson et al., 2022; Tasaki et al., 2022). Although we did not perform a further analysis of this discordance, we believe that including the TF and mRNA layers into the metabolic trans-omic network strengthens a system-wide view of metabolic dysregulation in AD.

      Regarding the mRNA changes corresponding to the DEP enzymes, please refer to Figure S7A.

      Comment further on the results from Figure 2D. What can be learned from identifying metabolites with the greatest degree centrality? What pathways other than energy metabolism are highlighted by the trans-omic network?<br />

      We assume that some energetic indicators, including AMP and acetyl-CoA, and nitrogen metabolism-related metabolites, Glu, 2-oxoglutarate, and urea, can be potential key regulators of dysregulated metabolism in AD.

      (Suggestion) We suggest the authors leverage their trans-omic network in additional ways beyond giving a snapshot of a few energy metabolism pathways. The analysis of top DEMs could go further. What pathways are impacted beyond energy metabolism? Among the metabolic reactions allosterically regulated by top DEMs, what metabolic pathways are enriched?<br />

      We identified the enriched metabolic pathways that were allosterically regulated by DEMs in AD using Fisher's exact test. Alanine, aspartate, and glutamate metabolism pathways were significantly enriched in 2-oxoglutarate, glutarate, alanine, and glutamate-regulating metabolic reactions. Arginine and proline metabolism pathway was enriched in N-methyl-L-arginine and putrescine-regulating metabolic reactions. Arginine biosynthesis pathway was enriched in arginine-regulating metabolic reactions. Glycerophospholipid metabolism pathway was enriched in CDP-ethanolamine-regulating metabolic reactions. Glycine, serine, and threonine metabolism pathway was enriched in serine-regulating metabolic reactions. Purine metabolism pathway was enriched in AMP-regulating metabolic reactions. Pyrimidine metabolism pathway was enriched in deoxyuridine and thymidine-regulating metabolic reactions. Sphingolipid metabolism pathway was enriched in sphingosine-regulating metabolic reactions. However, this analysis did not yield sufficiently valuable insights into the regulatory relationships among biomolecules in AD. Thus, we did not include these results in the revised manuscript.

      (Suggestion) Figure 3 shows that most differential signal in AD points to lower energy production due to the combination of differentially expressed metabolites and enzymes, but we are not given much context about the strength of these among all the differential signals. We would suggest including volcano plots where the features of interest, i.e. DE enzymes and metabolites, are colored differently (or a similar figure).<br />

      We thank the reviewer for this constructive suggestion. To provide better context regarding the importance of the differential signals, we have added volcano plots for mRNAs, proteins, and metabolites in Figure S4A, B, and C.

      (Suggestion) The PPI network could be better leveraged to understand metabolic changes in AD. If nodes are grouped into subnetworks (e.g. by Louvain / Leiden clustering) and tested for pathway enrichment, could you find functional subnetworks of coordinately up- and down- regulated metabolic enzymes? This could yield some pathways of interest beyond the energy metabolism pathways already highlighted.<br />

      We appreciate the reviewer's suggestion to utilize the PPI network for subnetwork analysis. However, it is important to note that the proteomic dataset analyzed in this study is derived from the original work of (Johnson et al., 2020). In that paper, the authors already performed a Weighted Gene Co-expression Network Analysis (WGCNA) across several datasets to identify co-expressed modules and functional pathways.

      Given this, we assumed that applying additional clustering methods to the same dataset would be unlikely to yield significant biological insights beyond the established findings.

      __ ____Minor comments __

      12. "All genes" and "all metabolites" should not be the background for the proteomic and metabolic pathway enrichment analysis by Metascape and MetaboAnalyst. The background should be limited to the proteins and metabolites that were measured.

      We fully agree with the reviewer that using "all gene" or "all metabolites" as a background is not suitable for enrichment analyses. As suggested, we have revised the enrichment analyses using the measured proteins and metabolites as a background in both Metascape and MetaboAnalyst (Fig. S4D).

      Highlight the metabolic enzymes in Fig S2B. Calculate a separate correlation coefficient for the enzymes extracted in the energy metabolism analysis from Fig 3.<br />

      We appreciate the reviewer's suggestion to refine the correlation analysis. As requested, we have revised Fig. S2D to explicitly highlight the subset of enzymes involved in the energy metabolism analysis shown in Fig. 3. We calculated a separate correlation coefficient for the subset (Pearson coefficient = 0.86, p-value = 1.5e-7).

      Use a multiple hypothesis adjusted p-value or q-value in Figure S3.<br />

      We agree with the reviewer regarding the necessity of correcting for multiple comparisons. Accordingly, we have revised Fig. S4D using q-values.

      Describe the methods used to calculate the logFC values from the validation dataset.<br />

      We have revised the Methods to include a detailed description of the procedure used to calculate the log2FC values for the validation datasets (pg. 21, lines 13-15).

      It is difficult to read Figure 3. We would recommend really emphasizing to the reader to refer to Fig S7B as a "key" to this figure. The description of the red/blue arrows and nodes in the methods section (pg. 24, lines 21-36, pg 25, lines 1-4) were also helpful, but very lengthy. We recommend putting an abridged version of this description into the Fig S7 figure legend.<br />

      We appreciate the feedback regarding the readability of Fig. 3. As recommended, we have revised the manuscript to explicitly direct readers to Fig. S8B as an essential "key" for interpreting the network visualization (pg. 8, lines 28). Furthermore, we have added an abridged description of the network elements to the legend of Fig. S8B.

      The S7 figure legend should refer to panels A and B, not E and F.<br />

      We apologize for this oversight. We have corrected the legend of Fig. S8.

      (Suggestion) Are any of the differentially expressed metabolites allosteric regulators of the DE transcription factors? This could be interesting to discuss.<br />

      We appreciate the reviewer's insightful suggestion about the potential allosteric regulation of the DETFs by DEMs. We conducted an extensive literature search to identify any reports related to this perspective. However, to the best of our knowledge, no such direct interactions have been reported to date.

      Significance:

      The study's strength lies in leveraging three omics modalities across large patient cohorts (n ~ 150-240) to identify coherent signals between transcriptomics, proteomics, and metabolomics in postmortem DLPFC tissue. It was encouraging to see that the main result, showing downregulation for TCA, oxidative phosphorylation, and ketone body metabolism, emerged from consistent signals across both proteomics and metabolomics. This result was consistent with previous findings in other models cited by the author4,5 and other studies 6,7 demonstrating deficiency in energy-producing pathways in AD. Another strength of the study is the application of thoughtful methodology to connect differentially expressed proteins and metabolites via an intermediate data layer of metabolic reactions. The authors leverage the KEGG and BRENDA databases and apply sound logic to estimate the effects of enzyme level and metabolite level on pathway activity, with metabolites serving as substrate, product, or allosteric regulator for reactions. This trans-omic network methodology was developed in previous studies cited by the author8,9. However, as written, this study is limited in its contribution of new knowledge to the AD research field. The main conclusion (energy production is down in AD, due to regulatory disruption of energy metabolism) is not strongly supported (see comments 1, 3, and 4 for elaboration). The evidence could be improved by orthogonal approaches: further experimentation, further integration of external datasets, causal modeling, or flux modeling. Alternatively, even in the absence of new experimental and computational approaches, the story could be made more complete by further leveraging the trans-omic network to provide insights into (a) the regulation of energy metabolism; and (b) the impacts of key disrupted metabolites (see comments 7-9). The study is also limited in its demonstrating the power of these methodologies to provide integrative insights. As mentioned above, the integration of enzyme levels and metabolite levels is clearly useful (Figure 3). In contrast, the utility of the mRNA and transcription factor layers was not evident. The study did not appear to improve or expand upon trans-omic network methodology described in the previous works. Finally, the various analyses (analyzing the trans-omic network for nodes with the highest degree centrality, the PPI analysis, and viewing the energy metabolism pathways in the network) provided disparate results that were only tenuously connected in the discussion section.


      Response to Reviewer #2's Comments____

      Evidence, reproducibility and clarity: Summary

      This manuscript integrates public transcriptomic, proteomic, and metabolomic datasets from ROSMAP DLPFC samples to construct a multi-layer metabolic trans-omic network in Alzheimer's disease. By linking transcription factors, enzyme mRNAs, proteins, metabolic reactions, and metabolites, the authors report coordinated downregulation of the TCA cycle, oxidative phosphorylation, and ketone body metabolism, along with mixed regulatory signals in glycolysis/gluconeogenesis. They interpret these patterns as indicative of broad energetic dysfunction and alterations in amino-acid/nitrogen metabolism in AD. While the framework is conceptually appealing, much of the analysis remains descriptive, and several biological interpretations extend beyond what the data can robustly support. The reliance on bulk tissue without accounting for cell-type composition, limited covariate adjustment, and the absence of validation or sensitivity analyses reduce confidence in the mechanistic conclusions. Overall, the study provides a preliminary systems-level overview, but additional rigor is needed before the proposed trans-omic regulatory insights can be considered convincing.

      Major Comments

      1. Interpretation requires more cautious phrasing, and validation is essential. The manuscript frequently asserts that specific pathways are "inhibited" or that energetic deficits are "compensated," but these conclusions extend beyond what the descriptive, bulk-level data can support. Because no metabolic flux, causality, or direct functional measurements are included, the results should be framed as putative regulatory shifts, not confirmed impairments. Critically, key claims about pathway inhibition would require flux modeling, perturbation analyses, or experimental validation to be convincing. Without such validation, the mechanistic interpretations remain speculative.

      We thank the reviewer for this crucial comment. We fully agree that, given the descriptive and bulk-level nature of our analysis, mechanistic interpretations must be made with caution. In the absence of direct metabolic flux measurements or experimental validation, our findings should be interpreted as putative regulatory shifts rather than confirmed functional impairments. Accordingly, we have revised the manuscript to temper mechanistic claims. We have replaced definitive statements with more speculative phrasing (e.g., "Our analysis revealed a putative coordinated downregulation ..." instead of "Our analysis revealed a coordinated downregulation ..." in Abstract section; "we demonstrate the systems-level view of the potential dysregulated energy production ..." instead of "we demonstrate the systems-level view of the dysregulated energy production ..." in pg. 10, lines 25-26).

      Although the authors acknowledge this in the limitations, bulk-level differences may primarily reflect altered proportions of neurons, astrocytes, microglia, and oligodendrocytes rather than true within-cell-type regulation. Incorporating a cell-type deconvolution or performing a sensitivity analysis would substantially improve interpretability. This issue also impacts the trans-omic network: if the molecules included originate from different cell types, the inferred regulatory relationships may not reflect true intracellular processes.

      We appreciate the reviewer's point that bulk-level differences can reflect altered proportions of different brain cell types, subsequently affecting the inferred trans-omic network analysis. To assess the changes in cell type proportions of the samples that we used in our study, we additionally used public single-cell transcriptomic datasets, which were obtained from DLPFC tissue of 465 subjects in the ROSMAP cohort (Green et al., 2024). For each omic data that we used in our analyses, we matched the same subjects and calculated the following cell type proportions, astrocytes, excitatory neurons, inhibitory neurons, microglias, oligodendrocytes, and OPCs. Then, we statistically compared the cell type proportions between control subjects and patients with AD (Fig. S3). In the transcriptomic data, we confirmed that the proportion of inhibitory neurons in the AD group was smaller than in the CT group, and that the proportion of oligodendrocytes in the AD group was larger than in the CT group. In the proteomic data, we did not observe any statistically significant changes in the cell type proportion between the two group. In the metabolomic data, we found that the proportion of inhibitory neurons in the AD group was smaller than in the CT group (pg. 6, lines 8-11).

      Differential analysis covariates. For the differential expression analyses, only gender and PMI were included as covariates. Additional variables, such as age at death, RIN, neuropathological measures, and comorbidities, can strongly influence molecular profiles and should be considered to ensure that the observed differences reflect AD-related biology rather than confounding pathological or technical factors.

      We appreciate the reviewer's comment regarding the included covariates in differential analyses of our study. The reason we did not include other variables, including age at death and RIN, is that these data for each sample were not available. Thus, we referred to original research articles from which proteomic or metabolomic datasets used in our study were derived. Regarding the metabolomic dataset, in the original article (Batra et al., 2023), only two metabolites, 1-methyl-5-imidazoleacetate and N6-carboxymethyllysine, were significantly associated with age. In addition, no metabolites were significantly associated with sex, BMI, or education. Regarding the proteomic dataset, in the original article, age at death, PMI, and sex were included as covariates in the analyses, though these variables were not found to strongly influence the data (Extended Data Fig.2 in (Johnson et al., 2020)).

      Network stability and sample non-overlap. Proteomic, transcriptomic, and metabolomic data come from partially overlapping individuals. The authors should test whether the reconstructed network is robust to: different significance thresholds, restricting analyses to overlapping samples and alternative definitions of AD vs control.

      __ __We appreciate the reviewer's comment for the trans-omic network stability. In our study, the number of individuals for whom all omic modalities were measured was relatively small (n=25 in CT and n=35 in AD). This limited overlap reduces statistical power and can affect the downstream network construction. We have acknowledged this limitation in the revised manuscript and clarified that the reconstructed networks should be interpreted with caution regarding reproducibility and generalizability (pg. 13, lines 13-23).

      Minor Comments

      1. Some TF enrichment and regulatory inferences lack explicit mention of multiple-testing correction.

      We apologize for the lack of clarity in our original description. We have corrected for multiple-testing for the TF inference. Thus, we have revised the Methods section to explicitly describe the correction method used and the threshold applied (pg. 23, lines 23-24).

      The limitations section is strong but should explicitly discuss the influence of postmortem interval on metabolite levels.<br />

      We appreciate the reviewer's comment about the effect of postmortem interval on changes in metabolite levels. Accordingly, we have added the description of this perspective in our revised manuscript (pg. 13, lines 1-5).

      __*Reviewer #2 (Significance (Required)):

      Significance *__

      The study extends a trans-omic integration framework, originally applied to metabolic disease, into the context of Alzheimer's pathology. Although the biological findings largely confirm known alterations in mitochondrial and energy metabolism, the network-based approach offers a structured way to view cross-layer regulatory changes. Its main advance is conceptual rather than biological, providing a unified framework rather than uncovering fundamentally new mechanisms. This work will primarily interest researchers in neurodegeneration and systems biology, as well as computational groups developing multi-omics integration methods.

      Response to Reviewer #3's Comments


      Evidence, reproducibility and clarity

      This study leverages existing transcriptomic, metabalomic and proteomic datasets from prefrontal cortex (PFC) to assess metabolic dysregulation in Alzheimer's disease (AD). They found a downregulation of multiple metabolic pathways, including TCA cycle, oxidative phosphorylation, and ketone metabolism, that may explain bioenergetic alterations in AD. The study used matching ROSMAP omics datasets from the DLPFC that have allowed more robust data integration. However, the datasets are all generated using bulk tissue, which makes data interpretation difficult. For example, the AD changes they observed may be due to shifts in cell type proportion with disease (e.g. cell death, neuron inflammation). Did the authors account for any potential shifts in cell type proportion in their analysis?* *

      __If the assumption is that the changes in AD are cell intrinsic, which cell types are likely to be impacted? Can the authors integrate any existing single-cell analysis to infer which cell types may be driving the signals they detect, and whether this accounts for some of the antagonistic regulatory effects that were detected?______

      We thank the reviewer for their insightful comments. We agree that the use of bulk tissue datasets cannot account for cell-type heterogeneity. As noted in our Limitations section (pg. 12, lines 24-27), we recognize that previous studies have found that the Braak stage is correlated positively with microglia and astrocyte proportions and negatively with oligodendrocyte proportion (Hannon et al., 2024; Shireby et al., 2022). Regarding the integration of single-cell analysis, we have referenced recent snRNA-seq findings (Mathys et al., 2024) in our Limitations section (pg. 12, lines 28-32) to deconvolve our bulk signatures.

      Furthermore, in our revised manuscript, we additionally used public single-cell transcriptomic datasets, which were obtained from DLPFC tissue of 465 subjects in the ROSMAP cohort (Green et al., 2024). For each omic data that we used in our analyses, we matched the same subjects and calculated the following cell type proportions, astrocytes, excitatory neurons, inhibitory neurons, microglia, oligodendrocytes, and OPCs. Then, we statistically compared the cell type proportions between control subjects and patients with AD (Fig. S3). In the transcriptomic data, we confirmed that the proportion of inhibitory neurons in the AD group was smaller than in the CT group, and that the proportion of oligodendrocytes in the AD group was larger than in the CT group. In the proteomic data, we did not observe any statistically significant changes in the cell type proportion between the two groups. In the metabolomic data, we found that the proportion of inhibitory neurons in the AD group was smaller than in the CT group (pg. 6, lines 8-11).

      Significance

      The manuscript provides multimodal insight into metabolic dysregulation in AD in the PFC. Given that metabolic dysfunction is likely to play a major in disease pathogenesis, this is a study of importance. However, the findings lack granularity at the cell type level, which limits the impact of the study.

      Reference

      1. Baloni, P., Arnold, M., Buitrago, L., Nho, K., Moreno, H., Huynh, K., Brauner, B., Louie, G., Kueider-Paisley, A., Suhre, K., Saykin, A. J., Ekroos, K., Meikle, P. J., Hood, L., Price, N. D., Alzheimer's Disease Metabolomics Consortium, Doraiswamy, P. M., Funk, C. C., Hernández, A. I., ... Kaddurah-Daouk, R. (2022). Multi-Omic analyses characterize the ceramide/sphingomyelin pathway as a therapeutic target in Alzheimer's disease. Communications Biology, 5(1), 1074.
      2. Baloni, P., Funk, C. C., Yan, J., Yurkovich, J. T., Kueider-Paisley, A., Nho, K., Heinken, A., Jia, W., Mahmoudiandehkordi, S., Louie, G., Saykin, A. J., Arnold, M., Kastenmüller, G., Griffiths, W. J., Thiele, I., Alzheimer's Disease Metabolomics Consortium, Kaddurah-Daouk, R., & Price, N. D. (2020). Metabolic Network Analysis Reveals Altered Bile Acid Synthesis and Metabolism in Alzheimer's Disease. Cell Reports. Medicine, 1(8), 100138.
      3. Batra, R., Arnold, M., Wörheide, M. A., Allen, M., Wang, X., Blach, C., Levey, A. I., Seyfried, N. T., Ertekin-Taner, N., Bennett, D. A., Kastenmüller, G., Kaddurah-Daouk, R. F., Krumsiek, J., & Alzheimer's Disease Metabolomics Consortium (ADMC). (2023). The landscape of metabolic brain alterations in Alzheimer's disease. Alzheimer's & Dementia: The Journal of the Alzheimer's Association, 19(3), 980-998.
      4. Batra, R., Krumsiek, J., Wang, X., Allen, M., Blach, C., Kastenmüller, G., Arnold, M., Ertekin-Taner, N., Kaddurah-Daouk, R., & Alzheimer's Disease Metabolomics Consortium (ADMC). (2024). Comparative brain metabolomics reveals shared and distinct metabolic alterations in Alzheimer's disease and progressive supranuclear palsy. Alzheimer's & Dementia: The Journal of the Alzheimer's Association, 20(12), 8294-8307.
      5. Cahill, K. M., Huo, Z., Tseng, G. C., Logan, R. W., & Seney, M. L. (2018). Improved identification of concordant and discordant gene expression signatures using an updated rank-rank hypergeometric overlap approach. Scientific Reports, 8(1), 9588.
      6. Fröhlich, A. S., Gerstner, N., Gagliardi, M., Ködel, M., Yusupov, N., Matosin, N., Czamara, D., Sauer, S., Roeh, S., Murek, V., Chatzinakos, C., Daskalakis, N. P., Knauer-Arloth, J., Ziller, M. J., & Binder, E. B. (2024). Single-nucleus transcriptomic profiling of human orbitofrontal cortex reveals convergent effects of aging and psychiatric disease. Nature Neuroscience, 27(10), 2021-2032.
      7. Green, G. S., Fujita, M., Yang, H.-S., Taga, M., Cain, A., McCabe, C., Comandante-Lou, N., White, C. C., Schmidtner, A. K., Zeng, L., Sigalov, A., Wang, Y., Regev, A., Klein, H.-U., Menon, V., Bennett, D. A., Habib, N., & De Jager, P. L. (2024). Cellular communities reveal trajectories of brain ageing and Alzheimer's disease. Nature, 633(8030), 634-645.
      8. Hannon, E., Dempster, E. L., Davies, J. P., Chioza, B., Blake, G. E. T., Burrage, J., Policicchio, S., Franklin, A., Walker, E. M., Bamford, R. A., Schalkwyk, L. C., & Mill, J. (2024). Quantifying the proportion of different cell types in the human cortex using DNA methylation profiles. BMC Biology, 22(1), 17.
      9. Johnson, E. C. B., Carter, E. K., Dammer, E. B., Duong, D. M., Gerasimov, E. S., Liu, Y., Liu, J., Betarbet, R., Ping, L., Yin, L., Serrano, G. E., Beach, T. G., Peng, J., De Jager, P. L., Haroutunian, V., Zhang, B., Gaiteri, C., Bennett, D. A., Gearing, M., ... Seyfried, N. T. (2022). Large-scale deep multi-layer analysis of Alzheimer's disease brain reveals strong proteomic disease-related changes not observed at the RNA level. Nature Neuroscience, 25(2), 213-225.
      10. Johnson, E. C. B., Dammer, E. B., Duong, D. M., Ping, L., Zhou, M., Yin, L., Higginbotham, L. A., Guajardo, A., White, B., Troncoso, J. C., Thambisetty, M., Montine, T. J., Lee, E. B., Trojanowski, J. Q., Beach, T. G., Reiman, E. M., Haroutunian, V., Wang, M., Schadt, E., ... Seyfried, N. T. (2020). Large-scale proteomic analysis of Alzheimer's disease brain and cerebrospinal fluid reveals early changes in energy metabolism associated with microglia and astrocyte activation. Nature Medicine, 26(5), 769-780.
      11. Maitra, M., Mitsuhashi, H., Rahimian, R., Chawla, A., Yang, J., Fiori, L. M., Davoli, M. A., Perlman, K., Aouabed, Z., Mash, D. C., Suderman, M., Mechawar, N., Turecki, G., & Nagy, C. (2023). Cell type specific transcriptomic differences in depression show similar patterns between males and females but implicate distinct cell types and genes. Nature Communications, 14(1), 2912.
      12. Mathys, H., Boix, C. A., Akay, L. A., Xia, Z., Davila-Velderrain, J., Ng, A. P., Jiang, X., Abdelhady, G., Galani, K., Mantero, J., Band, N., James, B. T., Babu, S., Galiana-Melendez, F., Louderback, K., Prokopenko, D., Tanzi, R. E., Bennett, D. A., Tsai, L.-H., & Kellis, M. (2024). Single-cell multiregion dissection of Alzheimer's disease. Nature, 632(8026), 858-868.
      13. Novotny, B. C., Fernandez, M. V., Wang, C., Budde, J. P., Bergmann, K., Eteleeb, A. M., Bradley, J., Webster, C., Ebl, C., Norton, J., Gentsch, J., Dube, U., Wang, F., Morris, J. C., Bateman, R. J., Perrin, R. J., McDade, E., Xiong, C., Chhatwal, J., ... Harari, O. (2023). Metabolomic and lipidomic signatures in autosomal dominant and late-onset Alzheimer's disease brains. Alzheimer's & Dementia: The Journal of the Alzheimer's Association, 19(5), 1785-1799.
      14. Plaisier, S. B., Taschereau, R., Wong, J. A., & Graeber, T. G. (2010). Rank-rank hypergeometric overlap: identification of statistically significant overlap between gene-expression signatures. Nucleic Acids Research, 38(17), e169.
      15. Shireby, G., Dempster, E. L., Policicchio, S., Smith, R. G., Pishva, E., Chioza, B., Davies, J. P., Burrage, J., Lunnon, K., Seiler Vellame, D., Love, S., Thomas, A., Brookes, K., Morgan, K., Francis, P., Hannon, E., & Mill, J. (2022). DNA methylation signatures of Alzheimer's disease neuropathology in the cortex are primarily driven by variation in non-neuronal cell-types. Nature Communications, 13(1), 5620.
      16. Tasaki, S., Xu, J., Avey, D. R., Johnson, L., Petyuk, V. A., Dawe, R. J., Bennett, D. A., Wang, Y., & Gaiteri, C. (2022). Inferring protein expression changes from mRNA in Alzheimer's dementia using deep neural networks. Nature Communications, 13(1), 655.
      17. Varma, V. R., Wang, Y., An, Y., Varma, S., Bilgel, M., Doshi, J., Legido-Quigley, C., Delgado, J. C., Oommen, A. M., Roberts, J. A., Wong, D. F., Davatzikos, C., Resnick, S. M., Troncoso, J. C., Pletnikova, O., O'Brien, R., Hak, E., Baak, B. N., Pfeiffer, R., ... Thambisetty, M. (2021). Bile acid synthesis, modulation, and dementia: A metabolomic, transcriptomic, and pharmacoepidemiologic study. PLoS Medicine, 18(5), e1003615.
      18. Wan, Y.-W., Al-Ouran, R., Mangleburg, C. G., Perumal, T. M., Lee, T. V., Allison, K., Swarup, V., Funk, C. C., Gaiteri, C., Allen, M., Wang, M., Neuner, S. M., Kaczorowski, C. C., Philip, V. M., Howell, G. R., Martini-Stoica, H., Zheng, H., Mei, H., Zhong, X., ... Logsdon, B. A. (2020). Meta-Analysis of the Alzheimer's Disease Human Brain Transcriptome and Functional Dissection in Mouse Models. Cell Reports, 32(2), 107908.
    1. Prince Escalus. Come, Montague; for thou art early up, To see thy son and heir more early down. Montague. Alas, my liege, my wife is dead to-night; Grief of my son's exile hath stopp'd her breath: 3185What further woe conspires against mine age? Prince Escalus. Look, and thou shalt see. Montague. O thou untaught! what manners is in this? To press before thy father to a grave? Prince Escalus. Seal up the mouth of outrage for a while, 3190Till we can clear these ambiguities, And know their spring, their head, their true descent; And then will I be general of your woes, And lead you even to death: meantime forbear, 3195And let mischance be slave to patience. Bring forth the parties of suspicion. Friar Laurence. I am the greatest, able to do least, Yet most suspected, as the time and place Doth make against me of this direful murder; 3200And here I stand, both to impeach and purge Myself condemned and myself excused. Prince Escalus. Then say at once what thou dost know in this. Friar Laurence. I will be brief, for my short date of breath Is not so long as is a tedious tale. 3205Romeo, there dead, was husband to that Juliet; And she, there dead, that Romeo's faithful wife: I married them; and their stol'n marriage-day Was Tybalt's dooms-day, whose untimely death Banish'd the new-made bridegroom from the city, 3210For whom, and not for Tybalt, Juliet pined. You, to remove that siege of grief from her, Betroth'd and would have married her perforce To County Paris: then comes she to me, And, with wild looks, bid me devise some mean 3215To rid her from this second marriage, Or in my cell there would she kill herself. Then gave I her, so tutor'd by my art, A sleeping potion; which so took effect As I intended, for it wrought on her 3220The form of death: meantime I writ to Romeo, That he should hither come as this dire night, To help to take her from her borrow'd grave, Being the time the potion's force should cease. But he which bore my letter, Friar John, 3225Was stay'd by accident, and yesternight Return'd my letter back. Then all alone At the prefixed hour of her waking, Came I to take her from her kindred's vault; Meaning to keep her closely at my cell, 3230Till I conveniently could send to Romeo: But when I came, some minute ere the time Of her awaking, here untimely lay The noble Paris and true Romeo dead. She wakes; and I entreated her come forth, 3235And bear this work of heaven with patience: But then a noise did scare me from the tomb; And she, too desperate, would not go with me, But, as it seems, did violence on herself. All this I know; and to the marriage 3240Her nurse is privy: and, if aught in this Miscarried by my fault, let my old life Be sacrificed, some hour before his time, Unto the rigour of severest law. Prince Escalus. We still have known thee for a holy man. 3245Where's Romeo's man? what can he say in this? Balthasar. I brought my master news of Juliet's death; And then in post he came from Mantua To this same place, to this same monument. This letter he early bid me give his father, 3250And threatened me with death, going in the vault, I departed not and left him there. Prince Escalus. Give me the letter; I will look on it. Where is the county's page, that raised the watch? Sirrah, what made your master in this place? 3255 Page. He came with flowers to strew his lady's grave; And bid me stand aloof, and so I did: Anon comes one with light to ope the tomb; And by and by my master drew on him; And then I ran away to call the watch. 3260 Prince Escalus. This letter doth make good the friar's words, Their course of love, the tidings of her death: And here he writes that he did buy a poison Of a poor 'pothecary, and therewithal Came to this vault to die, and lie with Juliet. 3265Where be these enemies? Capulet! Montague! See, what a scourge is laid upon your hate, That heaven finds means to kill your joys with love. And I for winking at your discords too Have lost a brace of kinsmen: all are punish'd. 3270 Capulet. O brother Montague, give me thy hand: This is my daughter's jointure, for no more Can I demand. Montague. But I can give thee more: For I will raise her statue in pure gold; 3275That while Verona by that name is known, There shall no figure at such rate be set As that of true and faithful Juliet. Capulet. As rich shall Romeo's by his lady's lie; Poor sacrifices of our enmity! 3280 Prince Escalus. A glooming peace this morning with it brings; The sun, for sorrow, will not show his head: Go hence, to have more talk of these sad things; Some shall be pardon'd, and some punished: For never was a story of more woe 3285Than this of Juliet and her Romeo. [Exeunt]

      the prince enter and ask what is going on friar Laurence explains the entire plan saying romeo and juliet were secretly married hearing this the montaque and capulet decides to build statues honoring them and setting the beef aside

    2. Romeo. Give me that mattock and the wrenching iron. Hold, take this letter; early in the morning 2960See thou deliver it to my lord and father. Give me the light: upon thy life, I charge thee, Whate'er thou hear'st or seest, stand all aloof, And do not interrupt me in my course. Why I descend into this bed of death, 2965Is partly to behold my lady's face; But chiefly to take thence from her dead finger A precious ring, a ring that I must use In dear employment: therefore hence, be gone: But if thou, jealous, dost return to pry 2970In what I further shall intend to do, By heaven, I will tear thee joint by joint And strew this hungry churchyard with thy limbs: The time and my intents are savage-wild, More fierce and more inexorable far 2975Than empty tigers or the roaring sea. Balthasar. I will be gone, sir, and not trouble you. Romeo. So shalt thou show me friendship. Take thou that: Live, and be prosperous: and farewell, good fellow. Balthasar. [Aside] For all this same, I'll hide me hereabout: 2980His looks I fear, and his intents I doubt. [Retires] Romeo. Thou detestable maw, thou womb of death, Gorged with the dearest morsel of the earth, Thus I enforce thy rotten jaws to open, 2985And, in despite, I'll cram thee with more food! [Opens the tomb] Paris. This is that banish'd haughty Montague, That murder'd my love's cousin, with which grief, It is supposed, the fair creature died; 2990And here is come to do some villanous shame To the dead bodies: I will apprehend him. [Comes forward] Stop thy unhallow'd toil, vile Montague! Can vengeance be pursued further than death? 2995Condemned villain, I do apprehend thee: Obey, and go with me; for thou must die. Romeo. I must indeed; and therefore came I hither. Good gentle youth, tempt not a desperate man; Fly hence, and leave me: think upon these gone; 3000Let them affright thee. I beseech thee, youth, Put not another sin upon my head, By urging me to fury: O, be gone! By heaven, I love thee better than myself; For I come hither arm'd against myself: 3005Stay not, be gone; live, and hereafter say, A madman's mercy bade thee run away. Paris. I do defy thy conjurations, And apprehend thee for a felon here. Romeo. Wilt thou provoke me? then have at thee, boy! 3010 [They fight] Page. O Lord, they fight! I will go call the watch. [Exit] Paris. O, I am slain! [Falls] 3015If thou be merciful, Open the tomb, lay me with Juliet. [Dies] Romeo. In faith, I will. Let me peruse this face. Mercutio's kinsman, noble County Paris! 3020What said my man, when my betossed soul Did not attend him as we rode? I think He told me Paris should have married Juliet: Said he not so? or did I dream it so? Or am I mad, hearing him talk of Juliet, 3025To think it was so? O, give me thy hand, One writ with me in sour misfortune's book! I'll bury thee in a triumphant grave; A grave? O no! a lantern, slaughter'd youth, For here lies Juliet, and her beauty makes 3030This vault a feasting presence full of light. Death, lie thou there, by a dead man interr'd. [Laying PARIS in the tomb] How oft when men are at the point of death Have they been merry! which their keepers call 3035A lightning before death: O, how may I Call this a lightning? O my love! my wife! Death, that hath suck'd the honey of thy breath, Hath had no power yet upon thy beauty: Thou art not conquer'd; beauty's ensign yet 3040Is crimson in thy lips and in thy cheeks, And death's pale flag is not advanced there. Tybalt, liest thou there in thy bloody sheet? O, what more favour can I do to thee, Than with that hand that cut thy youth in twain 3045To sunder his that was thine enemy? Forgive me, cousin! Ah, dear Juliet, Why art thou yet so fair? shall I believe That unsubstantial death is amorous, And that the lean abhorred monster keeps 3050Thee here in dark to be his paramour? For fear of that, I still will stay with thee; And never from this palace of dim night Depart again: here, here will I remain With worms that are thy chamber-maids; O, here 3055Will I set up my everlasting rest, And shake the yoke of inauspicious stars From this world-wearied flesh. Eyes, look your last! Arms, take your last embrace! and, lips, O you The doors of breath, seal with a righteous kiss 3060A dateless bargain to engrossing death! Come, bitter conduct, come, unsavoury guide! Thou desperate pilot, now at once run on The dashing rocks thy sea-sick weary bark! Here's to my love! 3065[Drinks] O true apothecary! Thy drugs are quick. Thus with a kiss I die. [Dies] [Enter, at the other end of the churchyard, FRIAR] 3070LAURENCE, with a lantern, crow, and spade] Friar Laurence. Saint Francis be my speed! how oft to-night Have my old feet stumbled at graves! Who's there? Balthasar. Here's one, a friend, and one that knows you well. Friar Laurence. Bliss be upon you! Tell me, good my friend, 3075What torch is yond, that vainly lends his light To grubs and eyeless skulls? as I discern, It burneth in the Capel's monument. Balthasar. It doth so, holy sir; and there's my master, One that you love. 3080 Friar Laurence. Who is it? Balthasar. Romeo. Friar Laurence. How long hath he been there? Balthasar. Full half an hour. Friar Laurence. Go with me to the vault. 3085 Balthasar. I dare not, sir My master knows not but I am gone hence; And fearfully did menace me with death, If I did stay to look on his intents. Friar Laurence. Stay, then; I'll go alone. Fear comes upon me: 3090O, much I fear some ill unlucky thing. Balthasar. As I did sleep under this yew-tree here, I dreamt my master and another fought, And that my master slew him. Friar Laurence. Romeo! 3095[Advances] Alack, alack, what blood is this, which stains The stony entrance of this sepulchre? What mean these masterless and gory swords To lie discolour'd by this place of peace? 3100[Enters the tomb] Romeo! O, pale! Who else? what, Paris too? And steep'd in blood? Ah, what an unkind hour Is guilty of this lamentable chance! The lady stirs. 3105 [JULIET wakes] Juliet. O comfortable friar! where is my lord? I do remember well where I should be, And there I am. Where is my Romeo? [Noise within] Friar Laurence. I hear some noise. Lady, come from that nest Of death, contagion, and unnatural sleep: A greater power than we can contradict Hath thwarted our intents. Come, come away. Thy husband in thy bosom there lies dead; 3115And Paris too. Come, I'll dispose of thee Among a sisterhood of holy nuns: Stay not to question, for the watch is coming; Come, go, good Juliet, [Noise again] 3120I dare no longer stay. Juliet. Go, get thee hence, for I will not away. [Exit FRIAR LAURENCE] What's here? a cup, closed in my true love's hand? Poison, I see, hath been his timeless end: 3125O churl! drunk all, and left no friendly drop To help me after? I will kiss thy lips; Haply some poison yet doth hang on them, To make die with a restorative. [Kisses him] 3130Thy lips are warm. First Watchman. [Within] Lead, boy: which way? Juliet. Yea, noise? then I'll be brief. O happy dagger! [Snatching ROMEO's dagger] This is thy sheath; 3135[Stabs herself] there rust, and let me die. [Falls on ROMEO's body, and dies] [Enter Watch, with the Page of PARIS] Page. This is the place; there, where the torch doth burn. 3140 First Watchman. The ground is bloody; search about the churchyard: Go, some of you, whoe'er you find attach. Pitiful sight! here lies the county slain, And Juliet bleeding, warm, and newly dead, Who here hath lain these two days buried. 3145Go, tell the prince: run to the Capulets: Raise up the Montagues: some others search: We see the ground whereon these woes do lie; But the true ground of all these piteous woes We cannot without circumstance descry. 3150 [Re-enter some of the Watch, with BALTHASAR] Second Watchman. Here's Romeo's man; we found him in the churchyard. First Watchman. Hold him in safety, till the prince come hither. [Re-enter others of the Watch, with FRIAR LAURENCE] Third Watchman. Here is a friar, that trembles, sighs and weeps: 3155We took this mattock and this spade from him, As he was coming from this churchyard side. First Watchman. A great suspicion: stay the friar too. [Enter the PRINCE and Attendants] Prince Escalus. What misadventure is so early up, 3160That calls our person from our morning's rest? [Enter CAPULET, LADY CAPULET, and others] Capulet. What should it be, that they so shriek abroad? Lady Capulet. The people in the street cry Romeo, Some Juliet, and some Paris; and all run, 3165With open outcry toward our monument. Prince Escalus. What fear is this which startles in our ears? First Watchman. Sovereign, here lies the County Paris slain; And Romeo dead; and Juliet, dead before, Warm and new kill'd. 3170 Prince Escalus. Search, seek, and know how this foul murder comes. First Watchman. Here is a friar, and slaughter'd Romeo's man; With instruments upon them, fit to open These dead men's tombs. Capulet. O heavens! O wife, look how our daughter bleeds! 3175This dagger hath mista'en—for, lo, his house Is empty on the back of Montague,— And it mis-sheathed in my daughter's bosom! Lady Capulet. O me! this sight of death is as a bell, That warns my old age to a sepulchre.

      romeo kills paris and places his body inside juliets tomb believing juliet is dead he drinks the poison and dies beside her friar arrives just as juliet is awakening but romeo is already dead when the friar leaves she sees romeos body and decide to stab herself with the dagger

    3. Paris. Give me thy torch, boy: hence, and stand aloof: Yet put it out, for I would not be seen. 2935Under yond yew-trees lay thee all along, Holding thine ear close to the hollow ground; So shall no foot upon the churchyard tread, Being loose, unfirm, with digging up of graves, But thou shalt hear it: whistle then to me, 2940As signal that thou hear'st something approach. Give me those flowers. Do as I bid thee, go. Page. [Aside] I am almost afraid to stand alone Here in the churchyard; yet I will adventure. [Retires] Paris. Sweet flower, with flowers thy bridal bed I strew,— O woe! thy canopy is dust and stones;— Which with sweet water nightly I will dew, Or, wanting that, with tears distill'd by moans: The obsequies that I for thee will keep 2950Nightly shall be to strew thy grave and weep. [The Page whistles] The boy gives warning something doth approach. What cursed foot wanders this way to-night, To cross my obsequies and true love's rite? 2955What with a torch! muffle me, night, awhile. [Retires] [Enter ROMEO and BALTHASAR, with a torch, mattock, &c] Romeo. Give me that mattock and the wrenching iron. Hold, take this letter; early in the morning 2960See thou deliver it to my lord and father. Give me the light: upon thy life, I charge thee, Whate'er thou hear'st or seest, stand all aloof, And do not interrupt me in my course. Why I descend into this bed of death, 2965Is partly to behold my lady's face; But chiefly to take thence from her dead finger A precious ring, a ring that I must use In dear employment: therefore hence, be gone: But if thou, jealous, dost return to pry 2970In what I further shall intend to do, By heaven, I will tear thee joint by joint And strew this hungry churchyard with thy limbs: The time and my intents are savage-wild, More fierce and more inexorable far 2975Than empty tigers or the roaring sea. Balthasar. I will be gone, sir, and not trouble you. Romeo. So shalt thou show me friendship. Take thou that: Live, and be prosperous: and farewell, good fellow. Balthasar. [Aside] For all this same, I'll hide me hereabout: 2980His looks I fear, and his intents I doubt. [Retires] Romeo. Thou detestable maw, thou womb of death, Gorged with the dearest morsel of the earth, Thus I enforce thy rotten jaws to open, 2985And, in despite, I'll cram thee with more food! [Opens the tomb] Paris. This is that banish'd haughty Montague, That murder'd my love's cousin, with which grief, It is supposed, the fair creature died; 2990And here is come to do some villanous shame To the dead bodies: I will apprehend him. [Comes forward] Stop thy unhallow'd toil, vile Montague! Can vengeance be pursued further than death? 2995Condemned villain, I do apprehend thee: Obey, and go with me; for thou must die. Romeo. I must indeed; and therefore came I hither. Good gentle youth, tempt not a desperate man; Fly hence, and leave me: think upon these gone; 3000Let them affright thee. I beseech thee, youth, Put not another sin upon my head, By urging me to fury: O, be gone! By heaven, I love thee better than myself; For I come hither arm'd against myself: 3005Stay not, be gone; live, and hereafter say, A madman's mercy bade thee run away. Paris. I do defy thy conjurations, And apprehend thee for a felon here. Romeo. Wilt thou provoke me? then have at thee, boy! 3010 [They fight] Page. O Lord, they fight! I will go call the watch. [Exit] Paris. O, I am slain! [Falls] 3015If thou be merciful, Open the tomb, lay me with Juliet.

      paris goes to juliets grave to mourn romeo arrives to open the tomb paris confront romeo they fight romeo kills paris who then ask to be placed in a tomb next to juliet

    4. Romeo. If I may trust the flattering truth of sleep, 2805My dreams presage some joyful news at hand: My bosom's lord sits lightly in his throne; And all this day an unaccustom'd spirit Lifts me above the ground with cheerful thoughts. I dreamt my lady came and found me dead— 2810Strange dream, that gives a dead man leave to think!— And breathed such life with kisses in my lips, That I revived, and was an emperor. Ah me! how sweet is love itself possess'd, 2815When but love's shadows are so rich in joy! [Enter BALTHASAR, booted] News from Verona!—How now, Balthasar! Dost thou not bring me letters from the friar? How doth my lady? Is my father well? 2820How fares my Juliet? that I ask again; For nothing can be ill, if she be well. Balthasar. Then she is well, and nothing can be ill: Her body sleeps in Capel's monument, And her immortal part with angels lives. 2825I saw her laid low in her kindred's vault, And presently took post to tell it you: O, pardon me for bringing these ill news, Since you did leave it for my office, sir. Romeo. Is it even so? then I defy you, stars! 2830Thou know'st my lodging: get me ink and paper, And hire post-horses; I will hence to-night. Balthasar. I do beseech you, sir, have patience: Your looks are pale and wild, and do import Some misadventure. 2835 Romeo. Tush, thou art deceived: Leave me, and do the thing I bid thee do. Hast thou no letters to me from the friar? Balthasar. No, my good lord. Romeo. No matter: get thee gone, 2840And hire those horses; I'll be with thee straight. [Exit BALTHASAR] Well, Juliet, I will lie with thee to-night. Let's see for means: O mischief, thou art swift To enter in the thoughts of desperate men! 2845I do remember an apothecary,— And hereabouts he dwells,—which late I noted In tatter'd weeds, with overwhelming brows, Culling of simples; meagre were his looks, Sharp misery had worn him to the bones: 2850And in his needy shop a tortoise hung, An alligator stuff'd, and other skins Of ill-shaped fishes; and about his shelves A beggarly account of empty boxes, Green earthen pots, bladders and musty seeds, 2855Remnants of packthread and old cakes of roses, Were thinly scatter'd, to make up a show. Noting this penury, to myself I said 'An if a man did need a poison now, Whose sale is present death in Mantua, 2860Here lives a caitiff wretch would sell it him.' O, this same thought did but forerun my need; And this same needy man must sell it me. As I remember, this should be the house. Being holiday, the beggar's shop is shut. 2865What, ho! apothecary!

      romeo is told that juliet killed herself and decide to buy poison from a vendor and kill himself beside her

    1. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      The authors present an approach that uses the transformer architecture to model epistasis in deep mutational scanning datasets. This is an original and very interesting idea. Applying the approach to 10 datasets, they quantify the contribution of higher-order epistasis, showing that it varies quite extensively.

      Suggestions:

      (1) The approach taken is very interesting, but it is not particularly well placed in the context of recent related work. MAVE-NN, LANTERN, and MoCHI are all approaches that different labs have developed for inferring and fitting global epistasis functions to DMS datasets. MoCHI can also be used to infer multidimensional global epistasis (for example, folding and binding energies) and also pairwise (and higher order) specific interaction terms (see 10.1186/s13059-024-03444-y and 10.1371/journal.pcbi.1012132). It doesn't distract from the current work to better introduce these recent approaches in the introduction. A comparison of the different capabilities of the methods may also be helpful. It may also be interesting to compare the contributions to variance of 1st, 2nd, and higher-order interaction terms estimated by the Epistatic transformer and MoCHI.

      We thank the reviewer for the very thoughtful suggestion.

      Although these methods are conceptually related to our method, none of them can be realistically used to perform the type of inference we have done in the paper on most the datasets we used, as they all require explicitly enumerating the large number of interaction terms.

      We have included new text (Line 65-74) in the introduction to discuss the advantages and disadvantages of these models. We believe this has made our contribution better placed in the broader context of the field.

      (2) https://doi.org/10.1371/journal.pcbi.1004771 is another useful reference that relates different metrics of epistasis, including the useful distinction between biochemical/background-relative and backgroundaveraged epistasis.

      We have included this very relevant reference in the introduction. We also pointed out the limitation of these class of methods is that they typically require near combinatorically complete datasets and often have to rely on regularized regression to infer the parameters, making the inferred model parameters disconnected from their theoretical expectations. Line 49-56.

      (3) Which higher-order interactions are more important? Are there any mechanistic/structural insights?

      We thank the reviewer for pointing out this potential improvement. We have now included a detailed analysis of the GRB2-SH3 abundance landscape in the final section of the results. In particular, we estimated the contribution of individual amino acid sites to different orders (pairwise, 3-4th order, 4-8th order) of epistasis and discuss our finding in the context of the 3D structure of this domain. We also analyzed the sparsity of specific interactions among subsets of sites.

      Please see Results section “Architecture of specific epistasis for GRB2-SH3 abundance.”

      Reviewer #2 (Public review):

      Summary:

      This paper presents a novel transformer-based neural network model, termed the epistatic transformer, designed to isolate and quantify higher-order epistasis in protein sequence-function relationships. By modifying the multi-head attention architecture, the authors claim they can precisely control the order of specific epistatic interactions captured by the model. The approach is applied to both simulated data and ten diverse experimental deep mutational scanning (DMS) datasets, including full-length proteins. The authors argue that higher-order epistasis, although often modest in global contribution, plays critical roles in extrapolation and capturing distant genotypic effects, especially in multi-peak fitness landscapes.

      Strengths:

      (1) The study tackles a long-standing question in molecular evolution and protein engineering: "how significant are epistatic interactions beyond pairwise effects?" The question is relevant given the growing availability of large-scale DMS datasets and increasing reliance on machine learning in protein design.

      (2) The manuscript includes both simulation and real-data experiments, as well as extrapolation tasks (e.g., predicting distant genotypes, cross-ortholog transfer). These well-rounded evaluations demonstrate robustness and applicability.

      (3) The code is made available for reproducibility.

      We thank the reviewer for the positive feedback.

      Weaknesses:

      (1) The paper mainly compares its transformer models to additive models and occasionally to linear pairwise interaction models. However, other strong baselines exist. For example, the authors should compare baseline methods such as "DANGO: Predicting higher-order genetic interactions." There are many works related to pairwise interaction detection, such as: "Detecting statistical interactions from neural network weights", "shapiq: Shapley interactions for machine learning", and "Error-controlled nonadditive interaction discovery in machine learning models."

      We thank the reviewer for this very helpful comment. These references are indeed conceptually quite similar to our framework. Although they are not directly applicable to the types of analyses we performed in this paper (partitioning contribution of epistasis into different interaction orders in terms of variance components), we have included a discussion of these methods in the introduction (Line 70-74). We believe this helps better situate our method within the broader conceptual context of interpreting machine learning models for epistatic interactions.

      (2) While the transformer architecture is cleverly adapted, the claim that it allows for "explicit control" and "interpretability" over interaction order may be overstated. Although the 2^M scaling with MHA layers is shown empirically, the actual biological interactions captured by the attention mechanism remain opaque. A deeper analysis of learned attention maps or embedding similarities (e.g., visualizations, site-specific interaction clusters) could substantiate claims about interpretability.

      Again, we thank the reviewer for the thoughtful comment. We have addressed this comment together with a related comment by Reviewer1 by including a detailed analysis of the GRB2-SH3 landscape using a marginal epistasis framework, where we quantified the contribution of individual sites to different orders of epistasis as well as the sparsity of epistatic interactions. We also present these results in the context of the structure of this protein. Please see Results section “Architecture of specific epistasis for GRB2-SH3 abundance.”

      (3) The distinction between nonspecific (global) and specific epistasis is central to the modeling framework, yet it remains conceptually underdeveloped. While a sigmoid function is used to model global effects, it's unclear to what extent this functional form suffices. The authors should justify this choice more rigorously or at least acknowledge its limitations and potential implications.

      We agree that the under parameterization of the simple sigmoid function could be be potentially confounding. We did compare different choices of functional forms for modeling global epistasis. Overall, we found that there is no difference between a simple sigmoid function with four trainable parameters and the more complex version (sum of multiple sigmoid functions, used by popular methods such as MAVENN). Therefore, all results we presented in the paper were based on the model with a single scalable sigmoid function.

      We have added relevant text; line 153-158. We have also included side-by-side comparisons of the model performance for the GRB-abundance and the AAV2 dataset to corroborate this claim (Supplemental Figure 1).

      (4) The manuscript refers to "pairwise", "3-4-way", and ">4-way" interactions without always clearly defining the boundaries of these groupings or how exactly the order is inferred from transformer layer depth. This can be confusing to readers unfamiliar with the architecture or with statistical definitions of interaction order. The authors should clarify terminology consistently. Including a visual mapping or table linking a number of layers to the maximum modeled interaction order could be helpful.

      We thank the reviewer for the thoughtful suggestion. We have rewritten the description of our metrics for measuring the importance of "pairwise", "3-4-way", and ">4-way" interactions; Line 232-239.

      We have also added a table to improve clarity, as suggested; Table 2.

      Reviewer #3 (Public review):

      Summary:

      Sethi and Zou present a new neural network to study the importance of epistatic interactions in pairs and groups of amino acids to the function of proteins. Their new model is validated on a small simulated data set and then applied to 10 empirical data sets. Results show that epistatic interactions in groups of amino acids can be important to predict the function of a protein, especially for sequences that are not very similar to the training data.

      Strengths:

      The manuscript relies on a novel neural network architecture that makes it easy to study specifically the contribution of interactions between 2, 3, 4, or more amino acids. The study of 10 different protein families shows that there is variation among protein families.

      Weaknesses:

      The manuscript is good overall, but could have gone a bit deeper by comparing the new architecture to standard transformers, and by investigating whether differences between protein families explain some of the differences in the importance of interactions between amino acids. Finally, the GitHub repository needs some more information to be usable.

      We thank the reviewer for the thoughtful comments. We have listed our response below in the “Recommendations for the authors” section.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      Some of the dataset labels are confusing. For example, GRB is actually the protein GRB2 and more specifically just one of the two SH3 domains from GRB2 (called GRB2-SH3 in Faure et al.).

      We thank the reviewer for catching this. Our original naming of the datasets followed the designation of library number in the Faure et al paper (which constructed 3 variant libraries and performed different assays on them). To avoid confusion (and also save space in the figure titles), we have now renamed the datasets using this mapping:

      Author response table 1.

      Reviewer #3 (Recommendations for the authors):

      (1) What is the cost of the interpretability of the model? It would be interesting to evaluate how a standard transformer, complete with its many non-linearities, performs on the simulated 13-position data, using the r2 metric. This is important as the last sentence of the discussion seems to suggest that the model proposed by the authors could be used in other contexts, where perhaps interpretability would be less important.

      We thank the reviewer for this suggestion. We have run a generic transformer model on the GRBabundance and AAV2 datasets. Overall, we found minimal difference between the generic model and our interpretable model, suggesting that fitting the interpretable transformer does not incur significant cost in performance.

      We have included a side-by-side comparison of the performance of the generic transformer and our three-layer model in Supplemental Figure 5 and a discussion of this finding in Line 256-259.

      (2) The 10 data sets analyzed by the authors differ in their behaviour. I was wondering whether the proteins have different characteristics, beyond the number and distribution of mutants in the data sets. For instance, do high-order interactions play a bigger role in longer proteins, in proteins with more secondary structures, in more hydrophobic proteins?

      We fully agree that this is a highly relevant question. Unfortunately, the paucity of datasets suitable for the type of analyses we performed in the paper limit our ability to draw general conclusions. Furthermore, the differences in genotype distribution among the 10 datasets may be the main driving factor in the behaviors of the models.

      We included our thoughts on this issue in the discussion (Line 477-481).

      We will definitely revisit this question if this type of high-order combinatorial DMS data becomes more available in the (hopefully) near future.

      (3) Although the code appears to be available in the repository, there is no information about the content of the different folders, about what the different scripts do, or about how to reproduce the article's results. More work should be done to clarify it all.

      Thank you for pointing this out. We have substantially improved our github repository and included many annotations for reproducibility.

      (4) Typos and minor comments:

      (a) p3 "a multi-peak fitness landscapes": landscape.

      (b) p3 "Here instead of directly fitting the the regression coefficients in Eq. 2": remove 'the'.

      (c) p3 "neural network architectures do not allow us to control the highest order of specific epistasis": a word is missing.

      (d) p6 "up to 1,926, 3,014, and 4,102 parameters, respectively-all smaller than the size of the training dataset": it's not very clear what size of the dataset means: number of example sequences?

      (e) p6 "This results confirm": This result confirms.

      (f) p6 "to the convergence of of the variance components of the model landscape to the ground truth.": remove 'of'.

      (g) p7 "to characterize the importance higher-order interactions": the importance of.

      (h) p7 "The improvement varies across datasets and range": and ranges.

      (i) p9 "over the pairwise model is due to the its ability": remove 'the'.

      (j) p13 "This results suggest that pairwise": result suggests.

      (k) p13 "although the role assessed by prediction for randomly sampled genotypes seems moderate": sampled. Also, I'm not sure I understand this part of the sentence: what results are used to support this claim? It's not 6b, which is only based on the mutational model.

      This is in Supplemental Figure 7.

      (l) p13 "potentially by modeling how the these local effects": remove the.

      (m) p13 "We first note that the the higher-order models": remove the.

      (n) p15 "M layers of MHA leads to a models that strictly": lead to a model.

      (o) Supp Figure 1: "Solid lines shows the inverse": show.

      (p) Supp p 10 "on 90% of randomly sample data": sampled.

      (q) Supp p11 "Next, assume that Eq. 5 is true for m > 0. We need to show that Eq. 5 is also true for m + 1.": shouldn't it be m>=0 ? It seems important to start the recursive argument.

      Good catch.

      (r) Supp p11 "Since the sum in line 9 run through subsets": runs.

      (s) Supp p11 "we can further simplify Eq. 11 it to": remove it.

      We have fixed all these problems. We very much appreciate the reviewer’s attention.

    1. o interpret quantitative findings as objective facts.

      Again, this is probably intentional on some researhcers behalf because they know how readers will interpret it.

    1. Limited instruction diversity
      1. Hạn chế này nằm ở các Instruction thiếu tính đa dạng
      2. Magic Brush sử dụng instruction từ con người để điều hướng
      3. InstructPix2Pix thay vì dùng human-aligned thì dụng LLM để sinh caption cho ảnh và instruction tuy nhiên điều này vẫn còn hạn chế bởi tính khái quát về sự đa dạng.
  6. s3.amazonaws.com s3.amazonaws.com
    1. Why, I don’t think she minded—one way or other. She didn’t pay much attention. I said, “How do,Mrs. Wright, it’s cold, ain’t it?” And she said, “Is it?"—and went on kind of pleating at her apron. Well, Iwas surprised; she didn’t ask me to come up to the stove, or to set down, but just sat there, not even lookingat me, so I said, “I want to see John.” And then she—laughed. I guess you would call it a laugh. I thoughtof Harry and the team outside, so I said a little sharp. “Can’t I see John?” “No,” she says, kind o’ dull like.“Ain’t he home?” says I. “Yes,” says she, “he’s home.” “Then why can’t I see him?” I asked her, out ofpatience. “’Cause he’s dead,” says she. “Dead?” says I. She just nodded her head, not getting a bit excited,but rockin’ back and forth. “Why—where is he?” says I, not knowing what to say. She just pointed upstairs—like that (himself pointing to the room above). I got up, with the idea of going up there. I talked fromthere to here—then I says, “Why, what did he die of?” “He died of a rope around his neck,” says she, andjust went on pleatin’ at her apron. Well, I went out and called Harry. I thought I might—need help. We wentupstairs, and there he was lying’

      You can sense the uneasiness and near-emotional detachment in this section when Hale recalls the conversation with Mrs. Wright. In a circumstance like this, Mrs. Wright appears to cool down and is acting strangely. This section of the narrative suggests that Mrs. Wright had a profound detachment from reality. It delves a bit farther into the character's potential identity. Additionally, this sequence heightens the tension in the narrative.

    2. HALE. Why, I don’t think she minded—one way or other. She didn’t pay much attention. I said, “How do,Mrs. Wright, it’s cold, ain’t it?” And she said, “Is it?"—and went on kind of pleating at her apron. Well, Iwas surprised; she didn’t ask me to come up to the stove, or to set down, but just sat there, not even lookingat me, so I said, “I want to see John.” And then she—laughed. I guess you would call it a laugh. I thoughtof Harry and the team outside, so I said a little sharp. “Can’t I see John?” “No,” she says, kind o’ dull like.“Ain’t he home?” says I. “Yes,” says she, “he’s home.” “Then why can’t I see him?” I asked her, out ofpatience. “’Cause he’s dead,” says she. “Dead?” says I. She just nodded her head, not getting a bit excited,but rockin’ back and forth. “Why—where is he?” says I, not knowing what to say. She just pointed upstairs—like that (himself pointing to the room above). I got up, with the idea of going up there. I talked fromthere to here—then I says, “Why, what did he die of?” “He died of a rope around his neck,” says she, andjust went on pleatin’ at her apron. Well, I went out and called Harry. I thought I might—need help. We wentupstairs, and there he was lying’

      In this part it shows when hale is recalling the conversation with mrs wright and you can feel the unease and almost emotional withdrawal. Mrs wright seems to calm and is behaving unnaturally during a situation like this. This part of the story implies mrs wright had a deep seperation from reality . it dives a little more into who the character ay be. This scene also builds suspense in the story.

    1. deverá preceder autorização legislativa

      A União poderá desapropriar qualquer bem, assim como o Estado o bem de seu município, entretanto, para ambos os casos, deverá haver prévia autorização legislativa.


      • Esse artigo do Decreto-lei nº 3.365/41 tem sido objeto de crítica pelos doutrinadores, segundo os quais a desapropriação de bens estaduais, pela União, ou de bens municipais, pela União e pelos Estados, fere a autonomia estadual e municipal.

      • Esse entendimento, no entanto, não pode ser aceito, tendo em vista o próprio fundamento político em que se baseia o instituto da desapropriação, a saber, a ideia de <u>domínio eminente</u> do Estado, entendido como o poder que o Estado exerce sobre todas as coisas que estão em seu território; trata-se de poder inerente à própria ideia de soberania e não poderia ser obstado por um poder de igual natureza exercido pelos Estados e Municípios dentro de suas respectivas áreas geográficas, mesmo porque tais entidades não detêm soberania, mas apenas autonomia nos termos defendidos pela Constituição.

      • Os interesses definidos pela União são de abrangência muito maior, dizendo respeito a toda a nação, tendo que prevalecer sobre os interesses regionais.

      (PIETRO, Maria Sylvia Zanella D. Direito Administrativo - 38ª Edição 2025. 38. ed. Rio de Janeiro: Forense, 2025. E-book. p.181.)

    1. Wittgenstein's stumbling block, I believe, arises from an anxiety or fear that The Bard's language stirs up in him. The telltale evidence for this is the sentence that concludes his disparaging of Shakespeare's similes. Wittgenstein writes: "That I do not understand him could then be explained by the fact that I cannot read him with ease. Not, that is, as one views a splendid piece of scenery." The notion of an inability to read "with ease" is related to a concept that occupies Wittgenstein throughout his later career and that he names "aspect-seeing." The iconic figure for illustrating the meaning of "aspect-seeing" is the duck-rabbit – a line drawing that can be seen as either duck or rabbit. Wittgenstein notes the ease with which we typically effect the gestalt-switch from one to the other. But to someone incapable of exercising this freedom or ease in reading the aspects of the world, Wittgenstein gives the name "aspect-blind." And a characteristic of the aspect-blind is the inability to register how something invites the seeing of different aspects.

      Interesante párrafo acerca de cómo pueden o no interpretarse los aspectos de la realidad, incapacidad vs práctica. aspect-seeing y aspect-blind.

    1. defensible

      forse invece di defensible ci serve una spiegazione più ampia, tipo Turn scattered evidence into clear, decision-ready outcomes/summaries/? o esempi: “investment memos, underwriting packages, regulatory dossiers” (tailor by page or by industry toggle).

    1. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      In the ecological interactions between wild plants and specialized herbivorous insects, structural innovation-based diversification of secondary metabolites often occurs. In this study, Agrawal et al. utilized two milkweed species (Asclepias curassavica and Asclepias incarnata) and the specialist Monarch butterfly (Danaus plexippus) as a model system to investigate the effects of two N,S-cardenolides - formed through structural diversification and innovation in A. curassavica-on the growth, feeding, and chemical sequestration of D. plexippus, compared to other conventional cardenolides. Additionally, the study examined how cardenolide diversification resulting from the formation of N,S-cardenolides influences the growth and sequestration of D. plexippus. On this basis, the research elucidates the ecophysiological impact of toxin diversity in wild plants on the detoxification and transport mechanisms of highly adapted herbivores.

      Strengths:

      The study is characterized by the use of milkweed plants and the specialist Monarch butterfly, which represent a well-established model in chemical ecology research. On one hand, these two organisms have undergone extensive co-evolutionary interactions; on the other hand, the butterfly has developed a remarkable capacity for toxin sequestration. The authors, building upon their substantial prior research in this field and earlier observations of structural evolutionary innovation in cardenolides in A. curassavica, proposed two novel ecological hypotheses. While experimentally validating these hypotheses, they introduced the intriguing concept of a "non-additive diversity effect" of trace plant secondary metabolites when mixed, contrasting with traditional synergistic perspectives, in their impact on herbivores.

      Weaknesses:

      The manuscript has two main weaknesses. First, as a study reliant on the control of compound concentrations, the authors did not provide sufficient or persuasive justification for their selection of the natural proportions (and concentrations) of cardenolides. The ratios of these compounds likely vary significantly across different environmental conditions, developmental stages, pre- and post-herbivory, and different plant tissues. The ecological relevance of the "natural proportions" emphasized by the authors remains questionable. Furthermore, the same compound may even exert different effects on herbivorous insects at different concentrations. The authors should address this issue in detail within the Introduction, Methods, or Discussion sections.

      Second, the study was conducted using leaf discs in an in vitro setting, which may not accurately reflect the responses of Monarch butterflies on living plants. This limitation undermines the foundation for the novel ecological theory proposed by the authors. If the observed phenomena could be validated using specifically engineered plant lines-such as those created through gene editing, knockdown, or overexpression of key enzymes involved in the synthesis of specific N,S-cardenolides - the findings would be substantially more compelling.

      Reviewer #2 (Public review):

      This study examined the effects of several cardenolides, including N,S-ring containing variants, on sequestration and performance metrics in monarch larvae. The authors confirm that some cardenolides, which are toxic to non-adapted herbivores, are sequestered by monarchs and enhance performance. Interestingly, N,S-ring-containing cardenolides did not have the same effects and were poorly sequestered, with minimal recovery in frass, suggesting an alternate detoxification or metabolic strategy. These N,S-containing compounds are also known to be less potent defences against non-adapted herbivores. The authors further report that mixtures of cardenolides reduce herbivore performance and sequestration compared to single compounds, highlighting the important role of phytochemical diversity in shaping plant-herbivore interactions.

      Overall, this study is clearly written, well-conducted and has the potential to make a valuable contribution to the field. However, I have one major concern regarding the interpretations of the mixture results. From what I understand of the methods, all tested mixtures contain all five compounds. As such, it is not possible to determine whether reduced performance and sequestration result from the complete mixture or from the presence of a single compound, such as voruscharin for performance and uscharin for sequestration. For instance, if all compounds except voruscharin (or uscharin) were combined, would the same pattern emerge? I suspect not, since the effects of the individual N,S-containing compounds alone are generally similar to those of the full mixture (Figure S3). By taking the average of all single compounds, the individual effects of the N,S-containing ones are being inflated by the non-N,S-containing ones (in the main text, Figure 4). In the mix, of course, they are not being 'diluted', as they are always present. This interpretation is further supported by the fact that in the equimolar mix, the relative proportion of voruscharin decreases (from 50% in the 'real mix'), and the target measurements of performance and sequestration tend to increase in the equimolar mix compared to the real mix.

      Despite this issue, the discussion of mixtures in the context of plant defence against both adapted and non-adapted herbivores is fascinating and convincing. The rationale that mixtures may serve as a chemical tool-kit that targets different sets of herbivores is compelling. The non-N,S cardenolides are effective against non-adapted herbivores and the N,S-containing cardenolides are effective against adapted herbivores. However, the current experiments focus exclusively on an adapted species. It would be especially interesting to test whether such mixtures reduce overall herbivory when both adapted and non-adapted species are present.

      It remains possible that mixtures, even in the absence of voruscharin or uscharin, genuinely reduce sequestration or performance; however, this would need to be tested directly to address the abovementioned concern.

      Thanks for these insightful reviews and your summary assessment. We certainly agree that ours was a laboratory study with a single specialized insect, and both mixtures types had all five compounds (controlling for total toxin concentration). Thus, our conclusion that combined effects of naturally occurring toxins (within the cardenolide class) have non-additive effects for the specialized sequestering monarch are constrained by our experimental conditions. In our assay we used two mixture types, equimolar and “natural” proportions. We acknowledge that the natural proportions will vary with plant age, damage history, etc. of the host plant, Asclepias curassavica. Our proportions were based on growing the plants a few different times under variable conditions. Although we did not conduct these experiments on non-adapted insects, we discuss a related experiment that was conducted with wild-type and genetically engineered Drosophila (Lopez-Goldar et al. 2024, PNAS). In sum, we appreciate the reviewers’ comments.

      Recommendations for the authors:

      Reviewing Editor Comments:

      (i) More convincingly justify the choice and ecological relevance of the "natural" cardenolide ratios, (ii) Clarify the interpretation of mixture effects, and (iii) more explicitly discuss the limitations of leaf-disc assays and the absence of non-adapted herbivores in light of the broader coevolutionary claims.

      Thank you for these suggestions. We have added several sentences of text to the Discussion section to make these points.

      Reviewer #1 (Recommendations for the authors):

      (1) Statistical analysis is missing from Figure 3 and Figure S3, making it difficult to assess the significance of the data.

      Much of the data in Fig. 3 is meant for descriptive presentation, with the main statistical analysis (contrast between N,S and non-N,S cardenolides given in the main text of the results. We have added treatment differences between the sequestration efficiencies to the figure as well.

      (2) To help readers intuitively understand how certain results (such as ECD and sequestration efficiency) were calculated, the authors can provide the equations used for these computations.

      Thank you, this was given in the methods and we have added it to the Result on first mention as well.

      (3) For Figure 4, we suggest presenting the results of the equal mixture treatment and the realistic mixture treatment separately, rather than averaging the results from these two types of treatments.

      We understand and appreciate this comment – all of the treatment means are given in Fig. S3. For this particular figure we have opted to stick with the binary comparison (singles vs. mixed) to maximize replication for statistical tests (typically n = 25 vs. 10).

      Reviewer #2 (Recommendations for the authors):

      Given the interpretations and discussion generally, I feel the manuscript would benefit from either additional experiments (mixtures w/o N-S compounds), inclusion of non-adapted herbivore performance, or reframing of the explicit interpretations from your findings.

      We have added some caveats to the text but not added any additional experiments.

      Also, for all treatments/mixtures are concentrations above the IC50? Perhaps this could be calculated from the information presented, but it may be best to explicitly mention this.

      This is an interesting question. IC50’s are estimated from in vitro assays (with the enzyme and toxins in microplate wells) and so are not translatable to foliar concentrations. As indicated in the text, we chose cardenolide levels based on foliar concentrations to match A. curassavica.

      Some minor points:

      (1) Although the intact N,S-ring-containing compounds are recovered in low amounts in frass (and not sequestered), is there evidence of N,S-ring components being otherwise traceable in the frass? For example, can excess S or N be detected in frass? This could provide insight into differential detoxification or reincorporation of these elements, potentially explaining variation between voruscharin and uscharin.

      Great question! We have not been able to detect breakdown projects. In other experiments we have conducted mass spectrometric analysis of bodies and frass, but have not been able to find the features representing breakdown products. Nonetheless, as mentioned below, the main conversion products are evident and measurable, as in this study.

      (2) As a point of curiosity, is there evidence of interconversion between such compounds? For instance, if monarchs are fed only voruscharin, can other cardenolides be detected in their tissues?

      Yes, we have tried to make this more clear in the text. Both uscharin and voruscharin are converted to calotropin and calactin.

    1. 就将网络IO的处理改成多线程的方式了

      主线程是“事件分发器”:主线程的核心工作不再是亲自读写数据,而是专注于通过 I/O 多路复用机制(epoll_wait)高效地监听海量连接,快速发现哪些连接已经准备好数据了。它的作用就像一个“事件感知器”和“任务分发器”。

      I/O 线程是“数据搬运工”:主线程一旦感知到有数据就绪,就将具体的“搬运”任务(读取、解析、写回)交给多个 I/O 线程并行执行。这充分利用了多核 CPU 的能力来加速网络数据的处理,从而让主线程可以腾出手来,更快地处理源源不断的就绪事件。

    2. 就将网络IO的处理改成多线程的方式了

      当主线程通过 epoll 发现有多个 socket 已经准备好数据后,它会将这些 读/写任务分发给一个 I/O 线程池,由这些线程并行地去执行数据的读取、解析和写入操作。

    3. 所以 Redis 采用单线程(网络 I/O 和执行命令)那么快

      假设一个典型的Redis操作流程

      1. 从网络读取命令(I/O)

      2. 在内存中执行数据结构操作(内存访问)

      3. 将结果写回网络(I/O)

      耗时分布(经验值)

      network_io_time = 70% # 网络传输 memory_access_time = 28% # 内存操作 cpu_compute_time = 2% # 实际CPU计算

  7. Feb 2026
    1. Author response:

      The following is the authors’ response to the original reviews.

      Joint Public review:

      Weaknesses:

      (1) Controls for the genetic background are incomplete, leaving open the possibility that the observed oviposition timing defects may be due to targeted knockdown of the period (per) gene but from the GAL4, Gal80, and UAS transgenes themselves. To resolve this issue the authors should determine the egg-laying rhythms of the relevant controls (GAL4/+, UAS-RNAi/+, etc); this only needs to be done for those genotypes that produced an arrhythmic egg-laying rhythm.

      (2) Reliance on a single genetic tool to generate targeted disruption of clock function leaves the study vulnerable to associated false positive and false negative effects: a) The per RNAi transgene used may only cause partial knockdown of gene function, as suggested by the persistent rhythmicity observed when per RNAi was targeted to all clock neurons. This could indicate that the results in Fig 2C-H underestimate the phenotypes of targeted disruption of clock function. b) Use of a single per RNAi transgene makes it difficult to rule out that off-target effects contributed significantly to the observed phenotypes. We suggest that the authors repeat the critical experiments using a separate UAS-RNAi line (for period or for a different clock gene), or, better yet, use the dominant negative UAS-cycle transgene produced by the Hardin lab (https://doi.org/10.1038/22566).

      We have followed the referee advice,repeating the experiments with the dominant negative UAS-cyc<sup>DN</sup>. They nicely confirm our conclusions: the abolition of the cellular clock in LNd neurons rule out the rhythmicity of oviposition. The results are presented in Fig. 3 of the new manuscript, panels H to N. We thank the reviewer for this suggestion that has definitely improved our paper, since it allows us to confirm our result using both a different driver and a different UAS sequence. In addition, we included the required GAL4 controls, which can be found in Panels E, L of the figure as well as average egglaying profiles for all genotypes involved (Panels B, D, F, I, K and M). Regarding the MB122Bsplit-Gal4>UAS-per<sup>RNAi</sup> experiment, we moved it to a supplementary figure (Figure 3S1). The paragraph where the new Figure 3 is discussed has been modified accordingly.

      (3) The egg-laying profiles obtained show clear damping/decaying trends which necessitates careful trend removal from the data to make any sense of the rhythm. Further, the detrending approach used by the authors is not tested for artifacts introduced by the 24h moving average used.

      The method used for the assessment of rhythmicity is now more fully explained and tested in the supplementary material. In particular, the issue of trend removal is treated in the second section of the SM, and the absence of "artifacts" (interpreted as the possibility of deciding that a signal is rhythmic when it is not, or vice versa) shown in figs. S3 to S5.

      (4) According to the authors the oviposition device cannot sample at a resolution finer than 4 hours, which will compel any experimenter to record egg laying for longer durations to have a suitably long time series which could be useful for circadian analyses.

      The choice of sampling every 4 hours is not due to a limitation imposed by the device used. In fact the device can be programmed to move at whatever times are desired. As mentioned in the Material and Methods section, "more frequent sampling gives rise to less consistent rhythmic patterns", because the number of eggs sampled at each time slot become too small. In particular, we have tested sampling at intervals of 2 hours, and we have observed that this doubles the work performed by the experimenter but does not lead to an improvement in the assessment of rhythmicity.

      (5) Despite reducing the interference caused by manually measuring egg-laying, the rhythm does not improve the signal quality such that enough individual rhythmic flies could be included in the analysis methods used. The authors devise a workaround by combining both strongly and weakly rhythmic (LSpower > 0.2 but less than LSpower at p < 0.05) data series into an averaged time series, which is then tested for the presence of a 16-32h "circadian" rhythm. This approach loses valuable information about the phase and period present in the individual mated females, and instead assumes that all flies have a similar period and phase in their "signal" component while the distribution of the "noise" component varies amongst them. This assumption has not yet been tested rigorously and the evidence suggests a lot more variability in the inter-fly period for the egg-laying rhythm.

      As stressed in the paper, and in the new Supplementary Material, the individual egg records are very noisy, which in general precludes the extraction of any information about the underlying period and phase. The workaround we (and others, e.g. Howlader et al. 2006) have used is analyzing average egg records for each genotype. Even though this implies assuming the same period and phase for all individuals, we have observed, using experiments with synthetic data, that small variations in individual periods (of the same amount as those present in real experiments where the period of some flies can be assessed individually) still allow us to use our method to decide if the genotype is rhythmic or not. This issue is discussed at length in the new Supplementary Material. There we also discuss an experiment with real flies, showing the individual records, and the corresponding periodograms, for each fly, for a rhythmic (Fig. S14) and an arrhythmic genotype (Fig. S17).

      (6) This variability could also depend on the genotype being tested, as the authors themselves observe between their Canton-S and YW wild-type controls for which their egg-laying profiles show clearly different dynamics. Interestingly, the averaged records for these genotypes are not distinguishable but are reflected in the different proportions of rhythmic flies observed. Unfortunately, the authors also do not provide further data on these averaged profiles, as they did for the wild-type controls in Figure 1, when they discuss their clock circuit manipulations using perRNAi. These profiles could have been included in Supplementary figures, where they would have helped the reader decide for themselves what might have been the reason for the loss of power in the LS periodogram for some of these experimental lines.

      We have added the individual periodograms of the arrhythmic lines to the Supplementary material (Figs. 3S2, 3S5 and panel G of Fig. 3S1), where they can be compared with their respective controls (Figs 3S3, 3S4, 3S6, 3S7 and panel F of Fig. 3S1).

      (7) By selecting 'the best egg layers' for inclusion in the oviposition analyses an inadvertent bias may be introduced and the results of the assays may not be representative of the whole population.

      We agree that the results may be biased for 'the best egg layers'. We remark however, that the flies that have been left out lay very few eggs, some of them even laying no eggs on a whole day. For these flies it is difficult to understand how one can even speak of egg laying rhythmicity (let alone how one can experimentally assess it). Thus, we think it might be misleading to speak of results as "representative of the whole population". Furthermore, it is even possible that the very concept of egg laying rhythmicity makes little sense if flies do not lay enough eggs.

      (8) An approach that measures rhythmicity for groups of individual records rather than separate individual records is vulnerable to outliers in the data, such as the inclusion of a single anomalous individual record. Additionally, the number of individual records that are included in a group may become a somewhat arbitrary determinant for the observed level of rhythmicity. Therefore, the experimental data used to map the clock neurons responsible for oviposition rhythms would be more convincing if presented alongside individual fly statistics, in the same format as used for Figure 1.

      In general, we have checked that there are no "outliers", in the sense of flies that lay many more eggs than the others in the experiment. But maybe the reviewer is referring to the possibility that a few rhythmic flies make the average rhythmic. This issue is addressed in the supplementary material, at the end of section "Example of rhythmicity assessment for a synthetic experiment". In short, we found that eliminating some of the most rhythmic flies from a rhythmic population makes the average a bit less rhythmic, but still significantly so. Conversely, if these flies are transferred to an arrhythmic population, the average is still non rhythmic.

      Regarding "the number of individual records that are included in a group may become a somewhat arbitrary determinant for the observed level of rhythmicity", we stress that we have not performed a selection of flies for the averages. All of the flies tested are included in the average, independently of their individual rhythmicity, provided only that they lay enough eggs.

      (9) The features in the experimental periodogram data in Figures 3B and D are consistent with weakened complex rhythmicity rather than arrhythmicity. The inclusion of more individual records in the groups might have provided the added statistical power to demonstrate this. Graphs similar to those in 1G and 1I, might have better illustrated qualitative and quantitative aspects of the oviposition rhythms upon per knockdown via MB122B and Mai179; Pdf-Gal80.

      We are aware that in the studies of the rhythmicity of locomotor activity the presence of two significant peaks is usually interpreted as a “complex rhythm”, i.e. as evidence of the existence of two different mechanisms producing two different rhythms in the same individual. In our case, since the periodograms we show assess the rhythmicity of the average time series of several individuals, the two non-significant peaks could also correspond to the periods of two different subpopulations of individuals. However, a close examination of the individual periodograms, now provided as Supplementary Figures 3S2 to 3S9, does not show any convincing evidence of any of these two possibilities.

      Another possibility could be that such peaks are simply an artifact of the method in the analysis of time series that consist of very few cycles and also few points per cycle. In the supplemenatry material we show that this can indeed happen. Consider, for example, periodograms 2 and 4 in Fig. S12 of the SM. Even though both of them display two non significant peaks, these periodograms correspond to two synthetic time series that are completely arrhythmic.

      We have added to the manuscript a paragraph discussing the issue of possible bimodality (next to last paragraph in subsection "The molecular clock in Cry+ LNd neurons is necessary for rhythmic egg-laying").

      Wider context:

      The study of the neural basis of oviposition rhythms in Drosophila melanogaster can serve as a model for the analogous mechanisms in other animals. In particular, research in this area can have wider implications for the management of insects with societal impact such as pests, disease vectors, and pollinators. One key aspect of D. melanogaster oviposition that is not addressed here is its strong social modulation (see Bailly et al.. Curr Biol 33:2865-2877.e4. doi:10.1016/j.cub.2023.05.074). It is plausible that most natural oviposition events do not involve isolated individuals, but rather groups of flies. As oviposition is encouraged by aggregation pheromones (e.g., Dumenil et al., J Chem Ecol 2016 https://link.springer.com/article/10.1007/s10886-016-0681-3) its propensity changes upon the pre-conditioning of the oviposition substrates, which is a complication in assays of oviposition rhythms that periodically move the flies to fresh substrate.

      We agree that social modulation can be important for oviposition, as has been shown in the paper cited by the reviewer. But we think that, in order to understand the contribution of social modulation to oviposition, it is important to know, as a reference for comparisons, what the flies do when they are isolated. Our aim in this work has been to provide such a reference.

      Recommendations for the authors:

      (1) The weaknesses identified in the Public review could be addressed as follows: etc.

      We have followed the suggestions of the editor and addressed each of the weaknesses mentioned (see details above).

      (2) Could the authors comment on their choice of using individual flies for their assay rather than (small) groups of flies? Is it possible that their assay would produce less noisy results with the latter?

      First we want to emphasize that our aim here was to assess the presence of individual rhythmicity, free from any external influences, whether arising from environmental external cues (such as light or temperature changes) or by social interactions (with other females or males). However, we were also curious about the behavior when males were put in the same chamber with each female. We performed a few tests and the results were very similar to what we obtained with single females.

      (3) Minor points:

      (a) Line 57-58 - "around 24 h and a peak near night onset (Manjunatha et al., 2008). Egglaying rhythmicity is temperature-compensated and remains invariant despite the nutritional state": Rephrase to something simpler like temperature and nutrition compensated.

      Corrected.

      (b) Line 56-57 - "The circadian nature of this behavior was revealed by its persistence under DD with a period around 24 h and a peak near night onset (Manjunatha et al., 2008)." A better reference here would be to Sheeba et al, 2001 for preliminary investigations into the egg-laying rhythms of individual flies and McCabe and Birley, 1998 for groups of flies under LD12:12 and DD.

      Suggestion accepted.

      (c) Line 65-67 - "We determined..... molecular clock in the entire clock network reduced the LNv did not." This suggests that it was unknown until now that LNv does not have a role, whereas Howlader et al 2006 already suggested that. The reader becomes aware of this at a later part of the manuscript. Please revise.

      This has been revised, and the citation to Howlader et al 2006 added to the new sentence.

      (d) Line 67 - "impairing the molecular clock in the entire clock network reduced the circadian rhythm of.."; saying "Reduced the power of the circadian rhythm" might be better phrasing."

      Suggestion accepted.

      (e) Line 72 - using the Janelia hemibrain dataset.

      Corrected

      (f) Line 72 typo "ussing", should be 'using'.

      Corrected.

      (g) Line 94: why is the periodic signal the same for all on the first day of DD?

      It is well known that in LD conditions activity is driven by the environmental light-dark cycle, which entrains the endogenous circadian clock of all flies. Even after the transition to DD, the effects of this entrainment persist for a few days, allowing the individual rhythmic patterns set by the light-dark cycle to remain synchronized for at least a few cycles. We are assuming that the same happens with oviposition. A sentence has been added explaining this (beginning of third paragraph of subsection "Egg-laying is rhythmic when registered with a semiautomated egg collection device").

      (h) Figure 1A-D, Were all flies included or only rhythmic flies? Please make this clear. How do you distinguish rhythmic and arrhythmic flies in Figure 1E? Their representative individual plots of egg number graphs are required. Why was the number of flies under DD decreased from 20 to 18?

      Throughout the paper, the analysis of average rhythmicity has been performed including all flies, since we postulate that even flies that individually can be classified as non rhythmic have a rhythm that is corrupted by noise, and that this noise can be partially subtracted by performing an average. The explanation of the characterization of rhythmic and arrhythmic individuals is in the Methods section, under the Data Analysis subsection. This is now fully developed in the Supplementary material, where the individual plots for some of the genotypes are included.

      Regarding the question of the number of flies having "decreased from 20 to 18?", there is a misunderstanding here. The results depicted in Figure 1, and in particular in panel E, correspond to two different experiments: one performed only in LD (7 days, n=20), and a second one performed for 5 days in DD, with one previous day in LD (n=18).

      (i) Figure E and K, Are n=20, 18, and n=30, 22 the total numbers of flies including both rhythmic and nonrhythmic? If so, it would be better to put them in the column, not in the rhythmic column.

      The figure has been corrected.

      (j) Line 107-108, please provide a citation for this statement.

      We have added two references: Shindey et al. 2016, and Deppisch et al. 2022.

      (k) Figure 1, 2, etc., please write a peak value inside the periodogram graph. This makes comparison easier.

      The peak values have been added in all Figures.

      (l) Line 184-185, Figure 2F, tau appears shorter in Clk4.1>perRNAi flies than in control, which suggests that DNp1 may play a role?

      As explained in the Supplementary Material, the particularities of oviposition records (discrete values, noise, few samples per period, etc.) preclude an accurate determination of the period if the record is considered as rhythmic. In particular, Fig. S4 shows that differences of 1 hour between the real and the estimated periods are not unusual.

      (m) Figure 4. Why are 2 controls shown? Please explain. Are they the same strains?

      The two controls shown are the UAS control and the GAL4 control. This information has now been added to the figure.

      (n) Line 314 'that' should be 'than'?

      Corrected.

      (o) Line 73-74 - Phrasing is not clear in: "LNds and oviposition neurons, consisting with, the essential role of LNds neurons in the control of this behavior.""

      Corrected.

      (p) Line 81-84 - "the experiments particularly demanding and labor-intensive. In this approach, eggs are typically collected every 4 hours (sometimes also every 2 hours), which usually implies transferring the fly to a new vial or extracting the food with the eggs and replacing it with fresh food in the same vial (McCabe and Birley, 1998; Menon et al., 2014)." McCabe and Birley had an automated egg collection device designed for groups of flies, which sampled eggs laid every hour for 6 days. Please remove this reference in this context

      Reference removed.

      (q) Line 91-92 - "The assessment of oviposition rhythmicity is challenging because the decision of laying an egg relies on many different internal and external factors making this behavior very noisy." This sentence makes it appear that 'assessment' is the limitation. Even locomotor activity is governed by many internal and external factors, yet we can obtain very robust rhythms. The sentence that follows is also not easy to digest. Can the authors frame the idea better?

      We have rewritten the corresponding paragraph in order to make it more clear (second paragraph of the Results section). Additionally, the Supplementary Material contains now a more detailed explanation and analysis of the method used.

      (r) Line 104-107 - rhythmic (with a period close to 24 h, Figure 1F) although the average egg record is strongly rhythmic with a period around 24 h (Figure 1B). Under DD condition, individual rhythmicity percentages are the same as in LD (Figure 1E) and their average record is also very rhythmic with a period of 24 h (Figure 1D). 'Strongly rhythmic' and 'very rhythmic' are less indicative of what is happening with the oviposition rhythm and can be phrased as robust instead, with a focus on their power measured.

      We have accepted the suggestion.

      (s) Line 108-110 - "Thus, egg-laying displays a much larger variability than locomotor activity, compounding the difficulty of observing the influence of the circadian clock on this behavior." The section discussed here does not illustrate the variability in egg-laying as much as the lack of robustness of the rhythm. The variation in rhythmicity going from CS flies (~70% rhythmic) to yw flies (~50% rhythmic) showcases the variability in this rhythm and how it is difficult to observe when compared to locomotor rhythms, which are usually consistently >90% rhythmic across multiple genotypes. These lines can be placed after the discussion about yw and perS flies. Moreover, previous studies using individual flies have reported that egg-laying rhythm is more variable than others Figure 1, Sheeba et al 2001.

      We have accepted the suggestion, replacing "Thus, egg-laying displays a much larger variability than locomotor activity..." by "This shows that, at the individual level, egg-laying is much less robust than locomotor activity ..."

      (t) Figure 1. Genotype notation within the figure panels is not consistent with the accepted / conventional notation or with the main text or legend notations throughout the manuscript.

      We are sorry for this mistake. We have corrected the genotype names in Figures and text in order to make notation consistent across the paper.

      (u) Supplementary Figure 1 Legend. Error in upper right corner? Not left corner? The photo does not clearly show the apparatus. The authors may wish to consider clearer images and more details about the apparatus including details of the 3D printing of the device and perhaps even include a short video where the motor moves the flies to a new chamber (This is only a suggestion to advertise the apparatus, not related to the review of the manuscript). They could also provide information about what fraction of females survived till the end of each trial when 21 flies were examined with 4-hour sampling across 4-5 cycles.

      In general, more than 80% of the females are alive at the end of a one week oviposition experiment. We have added this information in the Methods section at the end of the corresponding subsection ("Automated egg collection device"). Regarding the eggcollection device, we have replaced the photographs in what is now Supplementary Figure 1S1, and a short supplementary movie showing its operation.

      (v) The results depicted in Figure 2B are that of averaged time series. Hence the reader does not know 'the fact' that knocked-down animals are not completely rhythmic. Is the "not completely arrhythmic" in reference to flies with a power > 0.2 (weakly rhythmic) in their egg-laying rhythm or to the presence of ~40% of male flies (Supplementary Table 1) with a locomotor rhythm after perRNAi silencing of most of their clock neurons? This is confusing because no intermediate category of flies is discussed in Figure 2. Please edit for clarity.

      We were referring to the rhythmicity of the genotype, not of the individuals. We have rewritten the corresponding paragraph in order to make it clearer (last paragraph of the first subsection of the Results section).

      (w) Line 173 - ablation or electrically silencing all PDF+ neurons (Howlader et al., 2006). There were no experiments carried out using electrical silencing of PDF+ neurons in the referenced paper.

      We are sorry for this mistake. This has been corrected (we have deleted the mention to electrical silencing).

      (x) Line 173 - Shortening of period by nearly 3 hours cannot be considered minor.

      We agree, and we have deleted the word "minor".

      (y) Line 332-333 - "We also disrupted the molecular clock (or electrically silenced) in PDFexpressing neurons as well as in the DN1p group with no apparent effect on egg-laying rhythms". There was period shortening observed for pdf GAL4 > perRNAi manipulation so there was an effect on the egg-laying rhythm. Additionally, perRNAi based silencing does not electrically silence PDF neurons as the kir 2.1 was expressed only using Clk4.1 GAL4 in the Dn1ps. This line should be rewritten.

      We have rewritten the paragraph mentioned (third paragraph of the Discussion) in order to make it more accurate.

      (4) Page 22 - Data Analysis

      Since the number of eggs laid by a mated female tend to show a downward trend, we proceeded as follows, in order to detrend the data (see the Supplementary Material for further details). First, a moving average of the data is performed, with a 6 point window, and a new time series T is obtained. In principle, T is a good approximation to the trend of the data. Then, a new, detrended, time series D is generated by pointwise dividing the two series (i.e. D(i)=E(i)/T(i), where i indexes the points of each series)." Can the authors provide a reference for this method of detrending? Smoothing can frequently introduce artifacts in the data and give incorrect period estimates. Additionally, the trend visible in the data, especially in Figure 1, suggests a linear decay that can be easily subtracted. Also, there is no discussion of detrending in the Supplementary material attached.

      We are sorry for the confusion with the Supplementary materials. The method used for subtracting both noise and trend from the data is now fully explained in the new Supplementary Material. All the issues raised by the reviewer in this comment have been addressed there.

      (5) Figure by figure

      Page - Type (Figure or text) - Comment

      (a) Page 6 Figure 1C There is remarkable phase coherence seen in the average egg laying time series for CS flies 5 days into DD and as the authors note in Lines 94-95 in the text "Under light-dark (LD) conditions, or in the first days of DD, it can be that the periodic signal is the same for all flies". Since this observation is crucial to constructing the figures seen later in the paper, a note should be made about why this rhythm could persist across flies, so deep into DD.

      As mentioned above, we have added a couple of lines explaining why we think that the assumption of a synchronized periodic signal is reasonable, at least during the first cycles (second paragraph of the first subsection of section Results).

      (b) Figure 1 G The effect of period/phase decoherence seems to be showing up here in the average profile for yw flies as they seem to completely dampen out after 2 days in DD and yet have a 24-hour rhythm in the averaged periodogram. The authors should make a note here if the LS periodogram is over-representing the periodicity of the first few days in DD or if comparing the first 3 vs. the last 3 days in DD gives different results.

      The dampening observed in average oviposition records is a product of the dampening of the oviposition records, which is well known phenomenon, probably caused by the depletion of sperm in the female spermatheque. One of the aims of the method used in the paper was to avoid the bias introduced by this dampening, by means of a detrending procedure. This is explained in the Materials an Methods, and now full details are given in the new Supplementary Materials.

      (c) Figure 1E, K Is this data pooled across 2-3 experiments, as discussed in lines 500-01 under 'Statistical Analysis'? Also, what test is being performed to check for differences between proportions here, seeing as there are no error bars to denote error around a mean value and no other viable tests mentioned in Statistical Analysis?

      We are sorry for this omission. For the comparison of proportions we used the 'N-1' Chisquared test. We have added a sentence detailing this at the end of the Statistical analysis section.

      (d) Figure 1 F, L Can the total number of weakly and strongly rhythmic values be indicated in the scatter plot?

      Corrected.

      (e) Figure 1F, L (legend) Is the Chi-squared test being performed on the proportion values of Figure 1(E, K) or for Figure 1(F, L)?"

      The chi-squared test mentioned was used for Fig1 F-L. As explained above, for the comparison of proportions we used 'N-1' Chi-squared test. This has now been added to the legend of the figure

      (f) Page 8 Figure 2B Seeing as individual flies with a LS periodogram power < 0.2 are considered weakly rhythmic in Figure 1 F, L can Clk856 > perRNAi flies on average also be considered weakly rhythmic, as the peak in the periodogram is above 0.3?

      We prefer to use the weakly rhythmic class only for individual flies. Nevertheless, we agree that this periodogram shows that the genotype analyzed is not completely arrhythmic, and that this might be due to some remaining individual rhythmicity. As mentioned above, we have rewritten the last paragraph of the first subsection of section Results in order to discuss this.

      (g) Figure 2D Can the authors comment on why there is a shorter period rhythm when PDF neurons have a dysfunctional clock, whereas previous evidence (Howlader et al., 2004) suggested that these neurons play no role in egg-laying rhythm? They should also refer to McCabe and Birley, 1998 to see if their results (where they observed a shorter period of ~19h with groups of per0 flies), might be of interest in their interpretations.

      We have added a line commenting this in the corresponding subsection ("LNv and DN1 neurons are not necessary for egg-laying rhythmicity") of the Results, as well as a discussion of this in the third paragraph of the Discussion. In a nutshell, even though Howlader et al did not find a shortening when PDF neurons are ablated, they did find it in pdf01 flies.

      (h) Figure 2 F, H As the authors mention in their Discussion on Page 16, lines 340-45, the manipulation of DN1p neurons might abolish the circadian rhythm in oogenesis as reported by Zhang et al, which is why they looked at this circuit driven by Clk4.1 neurons and comment that "The persistence of the rhythm of oviposition implies that it is not based on the availability of eggs but is instead an intrinsic property of the motor program". However, no change in fecundity is reported for either kir2.1 or perRNAi-based manipulations of these neurons, to help the reader understand if egg availability (at the level of egg formation) is playing any role in the downstream (and seemingly independent) act of egg laying. The authors should report if they see any change in total fecundity for either set of flies w.r.t their respective controls. Also, is the reduction in power seen with electrical silencing vs perRNAi expression of any relevance? Does the percentage of rhythmic flies change between these two manipulations?

      In the line mentioned by the reviewer what we meant is that our results show that the rhythm of oviposition does not seem to be based in the rhythmic production of oocytes, which is not necessarily connected with the total number of eggs produced. We have modified the corresponding line in the paper, in order to avoid this misunderstanding. Regarding the "reduction in power" mentioned, it must be stressed that, in general, the height of the peak is correlated with the fraction of rhythmic individuals. The problem is that this fraction is a much more noisy output, and that is the reason why we have chosen to work with periodograms of averages.

      (i) Figure 2 E and G, a loss of rhythmicity could also be due to a decrease in fecundity in the experimental lines. Since the number of eggs laid for each genotype is already known, can the authors show statistically relevant comparisons between the experimental lines and their respective controls? In this vein, can the averaged time series profiles also be provided for all the genotypes tested (as seen previously in Figure 1 A, C, G, I), perhaps in the supplementary?

      We did not focus on fecundity in the present work. However, our observations do not seem to show any definite relationship with rhythmicity. We plan to address the issue of fecundity more systematically in a future work. The averaged time series profiles have now been added to the figure.

      (j) Scatter plots showing the average period and SEM as seen in Figure 1 (F, L) would help in understanding if these manipulations have any effect on variation in the period of the egg-laying rhythm across flies. Particularly for pdf GAL4 > perRNAi flies which have a net shorter period, (but this might vary across the 34 flies tested).

      We have added a Supplementary Figure (2S1) that shows that the shortening of oviposition period can be also observed at the individual level. We have also added a line commenting this in the corresponding subsection ("LNv and DN1 neurons are not necessary for egg-laying rhythmicity") of the Results, as well as a discussion of this in the third paragraph of the Discussion.

      (k) Page 11 Figure 3B Does the presence of two peaks in the LS periodogram at a power > 0.2 indicate the presence of weakly rhythmic flies with both a short(20h) and a long(~27h) period component or either one? The short-period peak is nearly at p < 0.05 level of significance. So then, do most of the flies in MB122B GAL4 > perRNAi line show a weakly rhythmic shorter period?

      (l) Figure 3D A similar peak is observed again at 20h (LS power > 0.2 and nearly at p < 0.05 significance level again) and a different longer one at (~30h) though this one is almost near 0.2 on the power scale. Given the consistency of this feature in both LNd manipulations, the authors should comment on whether this is driven by variation in periods detected or the presence of complex rhythms (splitting or change in period) in the oviposition time series for these lines.

      (m) Figure 3 General scatter plots showing average period {plus minus} SEM could help explain the bimodality seen in the periodograms. Additionally indicating just how many flies are weakly rhythmic vs. strongly rhythmic can also help to illustrate how important the CRY+ LnDs are to the oviposition rhythm's stability.

      For these three comments (k, l and m), we note that the issue of bimodality has been addressed above, in our response to Weakness 9.

      (o) Figure 4B Same as comments under Figure 1, what is the statistical test done to compare the proportions for these three genotypes?

      As mentioned above, for the comparison of proportions we used the 'N-1' Chi-squared test. We have added a sentence detailing this at the end of the Statistical analysis section.

      (p) Figure 4C Are all flies significantly rhythmic? The authors should also provide an averaged LS periodogram measure for each genotype, to help illustrate the difference in power between activity-rest and egg-laying rhythms.

      Yes, the points represent periods of (significantly) rhythmic flies. This has been added to the caption, to avoid misunderstandings. The differences that arise when assessing rhythmicity in activity records vs. egg-laying records is addressed at length in the Supplementary Material (see e.g. Fig S1).

      (q) Page 15 Figure 5 - general As the authors discuss the possible contribution of DN1ps to evening activity and control over oogenesis rhythm, investigating the connections of the few that are characterized in the connectome (or lack thereof) with the Oviposition neurons, can help illustrate the distinct role they play in the female Drosophila's reproductive rhythm.

      This information was in the text and the Supplementary Tables. Lines 273-275 of the old manuscript read: "The full results are displayed in Supplementary Tables 2 and Table 3, but in short, we found that whereas there are no connections between LNv or DN1 neurons and oviposition neurons..."

      (r) Minor: The dark shading of the circles depicting some of the clusters makes it difficult to read. Consider changing the colors or moving the names outside the circles.

      Figure corrected.

      (s) Line 38: The estimated number of clock neurons has been revised recently (https://www.biorxiv.org/content/10.1101/2023.09.11.557222v2.article-info).

      Thank you for the reference. We have corrected the number of clock neurons in the Introduction of the new manuscript.

    1. First Musician. Faith, we may put up our pipes, and be gone. Nurse. Honest goodfellows, ah, put up, put up; For, well you know, this is a pitiful case. [Exit] First Musician. Ay, by my troth, the case may be amended. 2760 [Enter PETER] Peter. Musicians, O, musicians, 'Heart's ease, Heart's ease:' O, an you will have me live, play 'Heart's ease.' First Musician. Why 'Heart's ease?' Peter. O, musicians, because my heart itself plays 'My 2765heart is full of woe:' O, play me some merry dump, to comfort me. First Musician. Not a dump we; 'tis no time to play now. Peter. You will not, then? First Musician. No. 2770 Peter. I will then give it you soundly. First Musician. What will you give us? Peter. No money, on my faith, but the gleek; I will give you the minstrel. First Musician. Then I will give you the serving-creature. 2775 Peter. Then will I lay the serving-creature's dagger on your pate. I will carry no crotchets: I'll re you, I'll fa you; do you note me? First Musician. An you re us and fa us, you note us. Second Musician. Pray you, put up your dagger, and put out your wit. 2780 Peter. Then have at you with my wit! I will dry-beat you with an iron wit, and put up my iron dagger. Answer me like men: 'When griping grief the heart doth wound, And doleful dumps the mind oppress, 2785Then music with her silver sound'— why 'silver sound'? why 'music with her silver sound'? What say you, Simon Catling? First Musician. Marry, sir, because silver hath a sweet sound. Peter. Pretty! What say you, Hugh Rebeck? 2790 Second Musician. I say 'silver sound,' because musicians sound for silver. Peter. Pretty too! What say you, James Soundpost? Third Musician. Faith, I know not what to say. Peter. O, I cry you mercy; you are the singer: I will say for you. It is 'music with her silver sound,' 2795because musicians have no gold for sounding: 'Then music with her silver sound With speedy help doth lend redress.' [Exit] First Musician. What a pestilent knave is this same! 2800 Second Musician. Hang him, Jack! Come, we'll in here; tarry for the mourners, and stay dinner.

      as the musician prepare to leave peter comes in jokingly ask them to play something to cheer everyone up

    2. Friar Laurence. Come, is the bride ready to go to church? Capulet. Ready to go, but never to return. O son! the night before thy wedding-day Hath Death lain with thy wife. There she lies, 2695Flower as she was, deflowered by him. Death is my son-in-law, Death is my heir; My daughter he hath wedded: I will die, And leave him all; life, living, all is Death's. Paris. Have I thought long to see this morning's face, 2700And doth it give me such a sight as this? Lady Capulet. Accursed, unhappy, wretched, hateful day! Most miserable hour that e'er time saw In lasting labour of his pilgrimage! But one, poor one, one poor and loving child, 2705But one thing to rejoice and solace in, And cruel death hath catch'd it from my sight! Nurse. O woe! O woful, woful, woful day! Most lamentable day, most woful day, That ever, ever, I did yet behold! 2710O day! O day! O day! O hateful day! Never was seen so black a day as this: O woful day, O woful day! Paris. Beguiled, divorced, wronged, spited, slain! Most detestable death, by thee beguil'd, 2715By cruel cruel thee quite overthrown! O love! O life! not life, but love in death! Capulet. Despised, distressed, hated, martyr'd, kill'd! Uncomfortable time, why camest thou now To murder, murder our solemnity? 2720O child! O child! my soul, and not my child! Dead art thou! Alack! my child is dead; And with my child my joys are buried. Friar Laurence. Peace, ho, for shame! confusion's cure lives not In these confusions. Heaven and yourself 2725Had part in this fair maid; now heaven hath all, And all the better is it for the maid: Your part in her you could not keep from death, But heaven keeps his part in eternal life. The most you sought was her promotion; 2730For 'twas your heaven she should be advanced: And weep ye now, seeing she is advanced Above the clouds, as high as heaven itself? O, in this love, you love your child so ill, That you run mad, seeing that she is well: 2735She's not well married that lives married long; But she's best married that dies married young. Dry up your tears, and stick your rosemary On this fair corse; and, as the custom is, In all her best array bear her to church: 2740For though fond nature bids us an lament, Yet nature's tears are reason's merriment. Capulet. All things that we ordained festival, Turn from their office to black funeral; Our instruments to melancholy bells, 2745Our wedding cheer to a sad burial feast, Our solemn hymns to sullen dirges change, Our bridal flowers serve for a buried corse, And all things change them to the contrary. Friar Laurence. Sir, go you in; and, madam, go with him; 2750And go, Sir Paris; every one prepare To follow this fair corse unto her grave: The heavens do lour upon you for some ill; Move them no more by crossing their high will.

      when friar arrives he is told that juliet is dead and the family is overcome with grief again and friar shows up and tells them that juliet is in a better place now providing comfort the wedding turns into a funeral as everyone prepare to bring juliet to the family tomb

    3. Nurse. Mistress! what, mistress! Juliet! fast, I warrant her, she: Why, lamb! why, lady! fie, you slug-a-bed! Why, love, I say! madam! sweet-heart! why, bride! 2655What, not a word? you take your pennyworths now; Sleep for a week; for the next night, I warrant, The County Paris hath set up his rest, That you shall rest but little. God forgive me, Marry, and amen, how sound is she asleep! 2660I must needs wake her. Madam, madam, madam! Ay, let the county take you in your bed; He'll fright you up, i' faith. Will it not be? [Undraws the curtains] What, dress'd! and in your clothes! and down again! 2665I must needs wake you; Lady! lady! lady! Alas, alas! Help, help! my lady's dead! O, well-a-day, that ever I was born! Some aqua vitae, ho! My lord! my lady! [Enter LADY CAPULET] Lady Capulet. What noise is here? Nurse. O lamentable day! Lady Capulet. What is the matter? Nurse. Look, look! O heavy day! Lady Capulet. O me, O me! My child, my only life, 2675Revive, look up, or I will die with thee! Help, help! Call help. [Enter CAPULET] Capulet. For shame, bring Juliet forth; her lord is come. Nurse. She's dead, deceased, she's dead; alack the day! 2680 Lady Capulet. Alack the day, she's dead, she's dead, she's dead! Capulet. Ha! let me see her: out, alas! she's cold: Her blood is settled, and her joints are stiff; Life and these lips have long been separated: Death lies on her like an untimely frost 2685Upon the sweetest flower of all the field. Nurse. O lamentable day! Lady Capulet. O woful time! Capulet. Death, that hath ta'en her hence to make me wail, Ties up my tongue, and will not let me speak.

      the nurse goes to wake juliet up despite trying her hardest she is unable to and believes she is dead she cries out and the capulet runs in and is overcome with grief what they dont know is that juliet have taken the sleeping poison

    4. Juliet. O shut the door! and when thou hast done so, 2410Come weep with me; past hope, past cure, past help! Friar Laurence. Ah, Juliet, I already know thy grief; It strains me past the compass of my wits: I hear thou must, and nothing may prorogue it, On Thursday next be married to this county. 2415 Juliet. Tell me not, friar, that thou hear'st of this, Unless thou tell me how I may prevent it: If, in thy wisdom, thou canst give no help, Do thou but call my resolution wise, And with this knife I'll help it presently. 2420God join'd my heart and Romeo's, thou our hands; And ere this hand, by thee to Romeo seal'd, Shall be the label to another deed, Or my true heart with treacherous revolt Turn to another, this shall slay them both: 2425Therefore, out of thy long-experienced time, Give me some present counsel, or, behold, 'Twixt my extremes and me this bloody knife Shall play the umpire, arbitrating that Which the commission of thy years and art 2430Could to no issue of true honour bring. Be not so long to speak; I long to die, If what thou speak'st speak not of remedy. Friar Laurence. Hold, daughter: I do spy a kind of hope, Which craves as desperate an execution. 2435As that is desperate which we would prevent. If, rather than to marry County Paris, Thou hast the strength of will to slay thyself, Then is it likely thou wilt undertake A thing like death to chide away this shame, 2440That copest with death himself to scape from it: And, if thou darest, I'll give thee remedy. Juliet. O, bid me leap, rather than marry Paris, From off the battlements of yonder tower; Or walk in thievish ways; or bid me lurk 2445Where serpents are; chain me with roaring bears; Or shut me nightly in a charnel-house, O'er-cover'd quite with dead men's rattling bones, With reeky shanks and yellow chapless skulls; Or bid me go into a new-made grave 2450And hide me with a dead man in his shroud; Things that, to hear them told, have made me tremble; And I will do it without fear or doubt, To live an unstain'd wife to my sweet love. Friar Laurence. Hold, then; go home, be merry, give consent 2455To marry Paris: Wednesday is to-morrow: To-morrow night look that thou lie alone; Let not thy nurse lie with thee in thy chamber: Take thou this vial, being then in bed, And this distilled liquor drink thou off; 2460When presently through all thy veins shall run A cold and drowsy humour, for no pulse Shall keep his native progress, but surcease: No warmth, no breath, shall testify thou livest; The roses in thy lips and cheeks shall fade 2465To paly ashes, thy eyes' windows fall, Like death, when he shuts up the day of life; Each part, deprived of supple government, Shall, stiff and stark and cold, appear like death: And in this borrow'd likeness of shrunk death 2470Thou shalt continue two and forty hours, And then awake as from a pleasant sleep. Now, when the bridegroom in the morning comes To rouse thee from thy bed, there art thou dead: Then, as the manner of our country is, 2475In thy best robes uncover'd on the bier Thou shalt be borne to that same ancient vault Where all the kindred of the Capulets lie. In the mean time, against thou shalt awake, Shall Romeo by my letters know our drift, 2480And hither shall he come: and he and I Will watch thy waking, and that very night Shall Romeo bear thee hence to Mantua. And this shall free thee from this present shame; If no inconstant toy, nor womanish fear, 2485Abate thy valour in the acting it. Juliet. Give me, give me! O, tell not me of fear! Friar Laurence. Hold; get you gone, be strong and prosperous In this resolve: I'll send a friar with speed To Mantua, with my letters to thy lord.

      juliet starts threatening to kill herself if friar doesnt help her she says that she would rather face danger then betray romeo friar propose a plan for juliet to drink poison that makes her look dead for 48 hrs and deliver a letter to romeo so that romeo can come back and escape with her

    1. Some analysts express concern that inflation will result from a massive influx of disposable income increasing demand forgoods and services.

      rhetoric: this is an appeal to macro econ theory (logos), citing 'expert analysts' that warn of the mathematical consequences of extra 'unearned' capital (without being tied to production) in the market.

      inference: this is how I feel about the concept -- receiving money without earning it could lead to major issues down the road, especially if a large majority of the people decide to stop working in jobs that help to add value to society. Printing $$$ w/o corresponding human production (because the machine is doing the work) is a trap that dangerously increases the risk if price inflation (hyperinflation) and income stagnation, because it removes the motivation to continue adding value, and increases the incentive to essentially do nothing ('eat, drink, be merry'). This is one of the core arguments for my thesis, that humans are abdicating their agency, or at least at a very real danger of it, which leads to an infinite loop of "Workslop" ("Work slop" Medici)

    1. Author response:

      The following is the authors’ response to the current reviews.

      Both reviewers indicated broad approval of the revised work, for which we are grateful.

      Reviewer #1 requested no further changes.

      Reviewer #2’s Public review states:

      The authors indicate that the adaptors of inflammatory signalosomes act as energy reservoirs for signal amplification. This is not demonstrated, but it is assumed that the energy stored in the supersaturated state is released upon polymerization.

      The “assumed” link between supersaturation and energy release is in fact a thermodynamic necessity. Supersaturation is, by definition, a high free energy state. Our data shows that triggering nucleation via optogenetics results in an immediate avalanche of polymerization and cell death. This is not an assumption; it is a direct observation of work performed by the system when the kinetic barrier is removed.

      Reviewer #2 recommended:

      Ideally, signal amplification could be tested by determining the levels of the final product, e.g., cytokines, activated caspases...

      We did measure CASP3/7 activation, demonstrating a correlation with supersaturation of upstream adaptors. We do agree however that measuring the levels of other signaling products, including for each of the supersaturated pathways, would strengthen our claims. This will be the subject of future work.

      The authors indicate a significant anticorrelation between the saturating concentrations and the transcript abundances (Figure 2B), reporting an R = -0.285.

      This is correct… no change appears to be requested or warranted.


      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      This is a high-quality and extensive study that reveals differences in the self-assembly properties of the full set of 109 human death fold domains (DFDs). Distributed amphifluoric FRET (DAmFRET) is a powerful tool that reveals the self-assembly behaviour of the DFDs, in non-seeded and seeded contexts, and allows comparison of the nature and extent of self-assembly. The nature of the barriers to nucleation is revealed in the transition from low to high AmFRET. Alongside analysis of the saturation concentration and protein concentration in the absence of seed, the subset of proteins that exhibited discontinuous transitions to higher-order assemblies was observed to have higher concentrations than DFDs that exhibited continuous transitions. The experiments probing the ~20% of DFDs that exhibit discontinuous transition to polymeric form suggest that they populate a metastable, supersaturated form in the absence of cognate signal. This is suggestive of a high intrinsic barrier to nucleation.

      Strengths:

      The differences in self-assembly behaviour are significant and likely identify mechanistic differences across this large family of signalling adapter domains. The work is of high quality, and the evidence for a range of behaviours is strong. This is an important and useful starting point since the different assembly mechanisms point towards specific cellular roles. However, understanding the molecular basis for these differences will require further analysis.

      An impressive optogenetic approach was engineered and applied to initiate self-assembly of CASP1 and CASP9 DFDs, as a model for apoptosome initiation in these two DFDs with differing continuous or discontinuous assembly properties. This comparison revealed clear differences in the stability and reversibility of the assemblies, supporting the hypothesis that supersaturation-mediated DFD assembly underlies signal amplification in at least some of the DFDs.

      The study reveals interesting correlations between supersaturation of DFD adapters in short- and long-lived cells, suggestive of a relationship between the mechanism of assembly and cellular context. Additionally, the comprehensive nature of the study provides strong evidence that the interactions are almost all homomeric or limited to members of the same DFD subfamily or interaction network. Similar approaches with bacterial proteins from innate immunity operons suggest that their polymerisation may be driven by similar mechanisms.

      Weaknesses:

      Only a limited investigation of assembly morphology was conducted by microscopy. There was a tendency for discontinuous structures to form fibrillar structures and continuous to populate diffuse or punctate structures, but there was overlap across all categories, which is not fully explored.

      We agree that an in-depth exploration of aggregate morphology would be interesting, but we feel it has limited relevance to the central findings of the manuscript. Our analysis established a relationship between discontinuous transitions and ordering based on the assumption that ordered assembly by DFDs involves polymerization, for which there is much precedent in the literature. Nevertheless, polymers of similar structure can form with different kinetics and hence, polymerization does not by itself imply an ability to supersaturate. We see this empirically in the “fibrillar” column in Fig. 1B. We have now elaborated this important point more fully in the relevant results section and in the discussion. Only five of the 108 DFDs in Fig. 1B warrant additional explanation. CASP4<sup>CARD</sup> and IFIH1<sup>tCARD</sup> lacked AmFRET but formed puncta; this could result from interactions with endogenous structures or condensates. DAPK1<sup>DD</sup> and UNC5A<sup>DD</sup> were classified as continuous (low) and fibrillar, but their AmFRET values are in fact higher than monomer control revealing that the fibrils simply comprise a small fraction of the protein. The puncta of UNC5A<sup>DD</sup> additionally do not resemble the fibrillar puncta of other DFDs; we suspect it may be a false-positive resulting from localization to mitochondrial or other intracellular membranes. Finally, CASP2<sup>CARD</sup> was inadvertently classified as punctate; this turns out to have been a technical artifact that has now been corrected (the fibrils wrapped around the cell perimeter to form ring-like puncta with anomalously low aspect ratios). We have now updated the methods section describing manual validation of our automated classification procedure, including which samples required reclassification. We have also now included all microscopy data in the public repository accompanying this manuscript.

      The methodology used to probe oligomeric assembly and stability (SDD-AGE) does not justify the conclusions drawn regarding stability and native structure within the assemblies.

      The reviewer is correct that SDD-AGE does not provide evidence against non-amyloid misfolding. It merely provides evidence that the DFDs are not forming amyloid (which are characteristically sarkosyl resistant). We have revised the sentence and further clarified that the distinction with amyloid specifically is important because amyloid is the only known form of ordered assembly (other than DFD polymers) with a nucleation barrier large enough to support deep supersaturation. Together with the series of interfacial mutants tested (and shown to impede assembly in all cases), the lack of sarkosyl-resistance provides evidence that the discontinuous DFDs are assembling through canonical DFD subunit interfaces.

      The work identifies important differences between DFDs and clearly different patterns of association. However, most of the detailed analysis is of the DFDs that exhibit a discontinuous transition, and important questions remain about the majority of other DFDs and why some assemblies should be reversible and others not, and about the nature of signalling arising from a continuous transition to polymeric form.

      We focused on discontinuous DFDs because this property allows for executive control over their respective pathways. They make signaling switch-like, which we argue is essential for innate immune responses. By contrast, and as illustrated in Figure 6D, supersaturation is required for a DFD to drive its own polymerization -- hence activation for a continuous DFD must be stoichiometrically coupled either with D/PAMP binding or positive feedback from downstream or orthogonal processes. We consider the principles underlying such regulation of signaling to be better established and understood than supersaturation, and hence built our narrative for this manuscript around the latter. Our original text addresses the fact that only a small fraction of DFDs are discontinuous. Specifically, this is expected in light of the fact that a) only one supersaturated DFD is needed to make a signaling pathway switch-like, and b) every supersaturated DFD renders the cell susceptible to spontaneous death. Evolution should therefore limit supersaturation to only the highly connected DFDs (i.e. adaptors), which is what is seen. In this view, the many nonsupersaturable DFDs have evolved to accessorize the central supersaturable DFDs with various sensor and effector modules. Our revised text attempts to further clarify this perspective.

      Some key examples of well-studied DFDs, such as MyD88 and RIPK,1 deserve more discussion, since they display somewhat surprising results. More detailed exploration of these candidates, where much is known about their structures and the nature of the assemblies from other work, could substantiate the conclusions here and transform some of the conclusions from speculative to convincing.

      We were likewise initially surprised about the inability of MyD88 and RIPK1 to supersaturate. We have now elaborated in the Discussion how our findings can be rationalized by the apparent supersaturability of other adaptors in MyD88 and RIPK1 signaling pathways. We additionally discuss prior evidence that MyD88 may indeed be supersaturable, and how our experimental system could have led to a false positive in the unique case of MyD88.

      The study concludes with general statements about the relationship between stochastic nucleation and mortality, which provide food for thought and discussion but which, as they concede, are highly speculative. The analogies that are drawn with batteries and privatisation will likely not be clearly understood by all readers. The authors do not discuss limitations of the study or elaborate on further experiments that could interrogate the model.

      We have now added to the discussion a section on the limitations of our study. We appreciate that our use of “privatisation” was confusing and have omitted it. However, we consider the battery analogy to accurately convey the newfound function of DFDs and anticipate that this analogy will ultimately prove valuable for biologists. To facilitate comprehension, we have now broadened our description of phase change batteries in the introduction.

      Reviewer #2 (Public review):

      Summary:

      The manuscript from Rodriguez Gama et al. proposes several interesting conclusions based on different oligomerization properties of Death-Fold Domains (DFDs) in cells, their natural abundance, and supersaturation properties. These ideas are:

      (1) DFDs broadly store the cell's energy by remaining in a supersaturated state;

      (2) Cells are constantly in a vulnerable state that could lead to cell death;

      (3) The cell's lifespan depends on the supersaturation levels of certain DFDs.

      Overall, the evidence supporting these claims is not completely solid. Some concerns were noted.

      Strengths:

      Systematic analysis of DFD self-assembly and its relationship with protein abundance, supersaturation, cell longevity, and evolution.

      Weaknesses:

      (1) On page 2, it is stated, "Nucleation barriers increase with the entropic cost of assembly. Assemblies with large barriers, therefore, tend to be more ordered than those without. Ordered assembly often manifests as long filaments in cells," as a way to explain the observed results that DFDs assemblies that transitioned discontinuously form fibrils, whereas those that transitioned continuously (low-to-high) formed spherical or amorphous puncta. It is unlikely to be able to differentiate between amorphous and structured puncta by conventional confocal microscopy. Some DFDs self-assemble into structured puncta formed by intertwined fibrils. Such fibril nets are more structured and thus should be associated with a higher entropic cost. Therefore, the results in Figure 1B do not seem to agree with the reasoning described.

      The formation of microscopically visible elongated structures necessitates ordering on the length scale of 100s of nanometers. Otherwise surface tension would favor rounded aggregates. Conventional confocal microscopy is in fact well-suited and widely used to distinguish ordered from disordered assemblies in cells based on this principle.1,2 We are unaware of any examples of isolated DFDs forming regular polymers that manifest as round puncta or nets. The reviewer may be referring to full-length ASC, which forms a roughly spherical mesh of filaments because it has two DFDs joined by a flexible linker. This is not applicable to our analysis with single DFDs. Single DFDs polymerize in effectively one dimension; hence a spherical punctum formed by a single DFD can only happen through noncanonical interactions or clustering of small filaments, both of which reduce order relative to long filaments.

      (2) Errors for the data shown in Figure 1B would have been very useful to determine whether the population differences between diffuse, punctate, and fibrillar for the continuous (low-to-high) transition are meaningful.

      We have now performed two statistical analyses to address this. First, using Fisher’s exact test, we observe a highly significant association between the DAmFRET and morphology classifications (p-value: 0.0001). Second, to specifically address whether the continuous (low to high) category has a preferred morphology, we applied an Exact Multinomial Test using the total frequencies of each morphology. This test revealed that all categories are significantly enriched for particular morphologies, as now indicated in the figure and legend.

      (3) A main concern in the data shown in Figure 1B and F is that the number of counts for discontinuous compared to continuous is small. Thus, the significance of the results is difficult to evaluate in the context of the broad function of DFDs as batteries, as stated at the beginning of the manuscript.

      Fig. 1B simply reports the numerical intersections between fluorescence distribution classifications and DAmFRET classifications. In Fig. 1F, our use of the chi-square test is justified by a sufficiently large sample size. Nevertheless, we obtain similar results with Fisher's exact test that accounts for smaller sample size (Odds Ratio: 75.0, P-value: < 0.0001). See also our response to the related critique by Reviewer 1 regarding the small number of discontinuous DFDs.

      (4) The proteins or domains that are self-seeded (Figure 1F) should be listed such that the reader has a better understanding of whether domains or full-length proteins are considered, whether other domains have an effect on self-seeding (which is not discussed), and whether there is repetition.

      We define and consistently use “DFDs” to refer to domains, and “FL” or “DFD-containing protein” to refer to FL proteins. The Figure 1 title and corresponding section title both indicate the data refer to “DFDs”. The text callout for Figure 1F also directs readers to Table S1 where we believe the self-seeding results and details of constructs are clearly presented. There is no repetition. We have modified the legend to clarify that “Each DFD was co-expressed with an orthogonally fluorescent μNS-fused version of the same DFD.” We did not systematically evaluate seeding of FL proteins. We did however previously test self-seeding on seven representative FL proteins, and have now included those data in a new supplemental figure (S5). In short, only FL proteins with discontinuous distributions are self-seedable. These are limited to adaptors that had discontinuous seedable DFDs, revealing no adverse effect of FL protein context on seedability of adaptors (unlike receptors and effectors).

      (5) The authors indicate an anticorrelation between transcript abundance and Csat based on the data shown in Figure 2B; however, the data are scattered. It is not clear why an anticorrelation is inferred.

      An anticorrelation is indicated by the clearly placed negative R value at the top of the graph and the figure legend describing the statistical analysis.

      (6) It would be useful to indicate the expected range of degree centrality. The differences observed are very small. This is specifically the case for the BC values. The lack of context and the small differences cast doubts on their significance. It would be beneficial to describe these data in the context of the centrality values of other proteins.

      The possible range of centrality scores is 0 - 1, where 1 represents a protein interacting with every other protein in the network (degree centrality) or is on the shortest path between every other pair of proteins in the network (betweenness centrality). The expected range is difficult to address, as centrality values strongly depend on the size and function of the network. We considered that the SAM domain network could provide the most relevant comparison to the DFD network, as SAM domains resemble DFDs in size and structure, function heavily in signaling, are comparably numerous (76 in humans), and many of them form homopolymers (but importantly of a geometry that does not support nucleation barriers). We found that SAM domains have much lower betweenness centrality in their physical interaction network as compared to discontinuous DFDs (p = 0. 0003) while their degree centrality is not significantly different (Figure S3F). Nevertheless, we stress that what matters for our conclusion is that the continuous and discontinuous values are significantly different among DFDs. Since there is a large overlap in the distributions of centrality scores between the two classes of DFDs, we performed a more robust permutation test with the Mann Whitney U statistic and n = 10000. These tests reiterated that continuous and discontinuous DFDs have significantly different centrality scores (Degree centrality p = 0.008; Betweenness centrality p = 0.028) (Figure S3E).

      (7) Page 3 section title: "Nucleation barriers are a characteristic feature of inflammatory signalosome adaptors." This title seems to contradict the results shown in Figure 2D, where full-length CARD9 and CARD11 are classified as sensors, but it has been reported that they are adaptor proteins with key roles in the inflammatory response. Please see the following references as examples: The adaptor protein CARD9 is essential for the activation of myeloid cells through ITAM-associated and Toll-like receptors. Nat Immunol 8, 619-629 (2007), and Mechanisms of Regulated and Dysregulated CARD11 Signaling in Adaptive Immunity and Disease. Front Immunol. 2018 Sep 19;9:2105. However, both CARD9 and CARD11 show discontinuous to continuous behavior for the individual DFDs versus full-length proteins, respectively, in contrast to the results obtained for ASC, FADD, etc.

      We rigorously counter the inconsistent usage of the term “adaptor” in the signalosome literature by quantifying the centrality of each protein in the physical interaction network of DFD proteins. Such analysis shows that BCL10, which is also described as an adaptor, is the more central member of the CARD9 and CARD11 (CBM signalosome) pathways, and is therefore more “adaptor-like”. We have now elaborated this view in the text.

      FADD plays a key role in apoptosis but shows the same behavior as BCL10 and ASC. However, the manuscript indicates that this behavior is characteristic of inflammatory signalosomes. What is the explanation for adaptor proteins behaving in different ways? This casts doubts about the possibility of deriving general conclusions on the significance of these observations, or the subtitles in the results section seem to be oversimplifications.

      We agree that our initial presentation of these results and brief description of each protein’s function was insufficient to fully justify our conclusions. We have now elaborated that while FADD was historically considered an adaptor of extrinsic apoptosis, it is now appreciated as a pleiotropic molecule with both anti- and pro-inflammatory signaling functions. FADD’s pro-inflammatory roles include inflammasome activation and activating NF-kB through the FADDosome. We have now revised our section headings to avoid oversimplification.

      (8) IFI16-PYD displays discontinuous behavior according to Figure S1H; however, it is not included in Figure 2D, but AIM 2 is.

      We only tested a subset of FL proteins spanning different functions within diverse signalosomes. IFI16 was not included. Hence it could not be meaningfully included in Fig. 2D.

      (9) To demonstrate that "Nucleation barriers facilitate signal amplification in human cells," constructs using APAF1 CARD, NLRC4 CARD, caspase-9 CARD, and a chimera of the latter are used to create what the authors refer to as apoptsomes. Even though puncta are observed, referring to these assemblies as apoptosomes seems somewhat misleading. In addition, it is not clear why the activity of caspase-9 was not measured directly, instead of that of capsae-3 and 7, which could be activated by other means.

      We agree that describing our chimeric assemblies as “apoptosomes” could be misleading, and have now refrained from doing so. We measured caspase-3/7 instead of caspase-9 for purely technical reasons -- we were unable to find any reliable caspase-9 activity assays that were also compatible with our optogenetic and imaging wavelengths. In any case, our data with the widely used caspase3/7 reporter dyes confirm comparably effective signal propagation from the CASP9 versions to their relevant endogenous substrate for apoptotic signaling (pro-caspase-3/7). The subsequent differences in cell death efficiency between the two versions of CASP9 (Fig. 3E) cannot be attributed to indirect effects of blue light stimulation, because both versions received the same treatment. Note our stated justification for using these DFDs in the HEK293T background is that these cells lack NLCR4 and CASP1 proteins and therefore the activity we measure is due to the direct optogenetic activation.

      The polymerization of caspase-1 CARD with NLRC4 CARD, leading to irreversible puncta, could just mean that the polymers are more stable. In fact, not all DFDs form equally stable or identical complexes, which does not necessarily imply that a nucleation barrier facilitates signal amplification. Could this conclusion be an overstatement?

      Figure 3C shows that the polymers don’t simply persist following the transient stimulus -- they continue to grow. That is, the soluble protein continues to join the polymers for a net increase even though there is no longer a stimulus directing them to do so. This means the drive to polymerize is independent of the stimulus, i.e. the protein is supersaturated. In the absence of supersaturation, a difference in stability would simply change the rates at which the polymers shrink. That we see continued growth instead of shrinkage therefore cannot be explained just by a difference in stability. Nevertheless, the reviewer’s critique caused us to realize that increased persistence of the CASP1CARD polymers could contribute to signal amplification independently of supersaturation if they act catalytically (i.e. where each polymerized CASP9 subunit sequentially activates multiple CASP3/7 molecules), and we had not adequately considered this. Unfortunately, the relevant experimentalist has now moved on from the lab leaving us unable to conduct the necessary experiments to resolve these two effects in a timely fashion. Consequently, we have now tempered our interpretation of these data. 

      (10) To demonstrate that "Innate immune adaptors are endogenously supersaturated," it is stated on page 5 that ASC clusters continue to grow for the full duration of the time course and that AIM2-PYD stops growing after 5 min. The data shown in Figure 4F indicate that AIM2-PYD grows after 5 mins, although slowly, and ASC starts to slow down at ~ 13 min. Because ASC has two DFDs, assemblies can grow faster and become bigger. How is this related to supersaturation?

      That AIM2-PYD assemblies appear to grow somewhat (although not significantly statistically) would be consistent with AIM2-PYD’s sequestration into the growing ASC clusters. All that matters for our conclusion regarding ASC is that ASC assemblies grow following cessation of the stimulus, which we now describe quantitatively. Supersaturation is defined as the ratio of total concentration to saturating concentration, which is an equilibrium property. For a given protein concentration, the presence of two DFDs, each contributing their own interactions to overall stability of the assembly, will increase supersaturation relative to the individual DFDs. Importantly, growth will not occur if the protein concentration lies below its C<sub>sat</sub>, no matter how many DFDs it has.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      It isn't clear what is implied by the final sentence of the Abstract. Some of the conclusions have a speculative tone and would be better described in less certain terms. The final sentence of the abstract should be omitted.

      We have revised the abstract to add appropriate nuance but consider the final sentence to be both justified by our data and important to convey our findings to a broad audience.

      How does the size and nature of the seed influence the outcome of these DFD interactions? Although some non-seeded experiments are described, the majority of the results are derived from seeded experiments. Further details about the seeds should be included. How is the size of the nucleus controlled, and will seeds of smaller or larger size generate the same pattern of results?

      This is a very important question! The seeds comprised genetic fusions of each DFD to a condensate-forming domain, as described. While this system is insufficient to explore the size-dependence of nucleation, we are developing tools to do exactly that, for example our recently published multivalent nanobody against mEos3,[3] wherein we piloted its use to compare the size-dependence of ASC versus amyloid nucleation. Much further work will be needed to fully utilize this approach for the question of interest, and that is the subject of ongoing but open-ended work in the lab.

      What is the implication of the observation that only ~20% of the DFDs exhibited a discontinuous transition from no to high AmFRET signal? Further discussion of the DFDs that exhibit a continuous transition would enrich the manuscript.

      We consider the relationship to mortality important for understanding this observation. In the discussion we now explain that each supersaturated protein in a death-inducing pathway imposes a risk of unintentional death. We speculate that evolution therefore minimizes the number of supersaturated DFDs by restricting them to central nodes in the network. That way, a small number of supersaturable DFDs can be continuously “repurposed” with new receptor proteins for each D/PAMP. Additionally, as stated in our response to the related critique, we felt it was important to focus this manuscript on the novel concept of functional supersaturation necessarily at the expense of signaling regulation through better understood mechanisms.

      Were the initial experiments with DFDs unseeded (Figure S1, F-G)? Clarify this in the text. The morphologies of all the subcellular assemblies appear similar. It is not possible to distinguish between long filaments and spherical or amorphous puncta (Figure S1F-G). Higher magnification images that allow evaluation and comparison of morphology should be provided.

      The initial experiments were unseeded, as now clarified in the legend. We believe there was a misinterpretation resulting from both panels (S1F and G) showing fibrillar examples. To clarify, we have now added panel S1H showing representative DFDs classified as “punctate”, which we hope the reviewer agrees are clearly distinct from fibrillar.

      The ASC and CARD14 assemblies in Figure S1G show very distinct fibrillar structures emerging from the mNS-DFD seeds. Please provide further explanation of the nature of these. Do these resemble ASC and CARD assemblies generated as a result of native stimuli rather than mNS-DFD seeds?

      The μNS-DFD puncta contain numerous seeding competent sites, which presumably causes multiple fibrils to initiate and emanate from them. This and potential bundling of these fibrils produces the star-like shape. We have no reason to believe the internal structure of these fibers differs from native signalosome assemblies. For example, point mutations at native subunit interfaces that were previously shown to disrupt fibrilization and signaling likewise disrupt assembly in our DAmFRET experiments (Figure S2A). To our knowledge there exist no examples of high-resolution DFD fibril structures that were induced by native stimuli. However, recent work using super-resolution imaging confirmed that nigericin-triggered endogenous ASC specks comprise a network of filaments that superficially resembles our star-like assemblies.[4]

      Figure S2B is presented as evidence that assembly is mediated by native-like interfaces rather than amyloid-like misfolding. These SDD-Age gels cannot be used to infer a native-like structure for the protein within the assemblies, only that the assemblies are (mostly) solubilised by incubation with sarkosyl. Many misfolding but non-amyloid-structure assemblies could be consistent with these results. Additionally, several of the samples appear to show insoluble aggregates within the wells, which could also be consistent with amyloid-type structures. What is the nature of these aggregates? Why is the NLRP3PYD sample so much more intense than the others? Why was FL-ZBP1 included when it does not contain a DFD? Why were no sarkosyl-resistant assemblies observed with RIPK3-RHIM when this is known to be highly amyloidogenic?

      ZBP1 and RIPK3<sup>RHIM</sup> were one of multiple proteins inadvertently included on the complete gel shown in the original figure that is not relevant to the manuscript; we have now spliced out these unnecessary lanes (indicated with dashed lines) to avoid confusion. We have found that the specific fragment of RIPK3<sup>RHIM</sup> used in this experiment -- residues 446-464 -- does not allow for robust amyloid formation. We believe this is a steric artifact due to its small size (19 residues) relative to the fused mEos3, because a longer fragment (446-518) forms amyloid robustly. However the latter construct was not available at the time this experiment was done. Nevertheless, another known amyloid protein, RIPK1<sup>RHIM</sup>, does show the expected smears on this gel and suffices for the positive control for amyloid. We do not understand why the NLRP3<sup>PYD</sup> sample is more intense than the others. However, this anomaly does not impact our conclusion that DFDs do not form sarkosyl-resistant smears that would be indicative of amyloid.

      Expand on the concept of autoinhibited oligomerisation. Is this due to structural features? What might be the advantage of autoinhibited oligomerisation for these DFDs?

      We have elaborated on this section in the results.

      End of page 3, which "former set of adaptors" are referred to here? This is ambiguous.

      We have replaced “former” with “innate immune”.

      Page 5, the authors state that a kinetic barrier governs the activity of inflammatory signalosomes. While under the circumstances generated in this particular system, there is a kinetic barrier to the formation of large fibrillar complexes, can the same be said to be true in cells that respond to signals? They experience a specific triggering event. This should be redrafted to distinguish between the specific trigger in cells (downstream of a binding-driven event) and the kinetic barrier to self-association observed in this model system.

      Yes, our findings establish that a kinetic barrier governs signalosome activation. By engineering a triggering event that is more specific than natural triggering events (see Figure 3), we exclude the possibility that the cell first responds to the signal to create conditions that stabilize inflammasome formation. This means that regardless of what may happen with a natural trigger, the driving force for assembly clearly pre-exists and is therefore held in check by a kinetic barrier.

      On page 6, the statement "...lifespan may be limited by the thermodynamic drive for inflammatory signal amplification" is not clear. While this is strictly true following the initial triggering event, isn't lifespan limited by the stochastic activation? These very general statements stray beyond what can be substantiated on the basis of the data presented here.

      We believe the source of confusion here was our misuse of the term “lifespan”. We have now replaced it with “life expectancy”, which we believe is substantiated by our statements as written.

      Overall, the work presents a compelling, comprehensive analysis of the seeded self-assembly of DFDs. It identifies distinct properties for assembly of these domains that may underlie their particular physiological roles. However, some of the statements are quite general and not substantiated.

      Page 6. Is "end cell fate" the intended phrase?

      We have revised the phrase.

      The data regarding conservation of DFD-like modules and activity is interesting and probably deserves inclusion. However, without substantial evidence of expression levels (i.e., results) and a more complete understanding of these other systems, the statement "These results suggest that the function of DFDs as energy reservoirs preceded the evolution of animals" appears as an over-reach.

      We demonstrated that sequence-encoded nucleation barriers of DFDs are shared across animal signalosomes (human, zebrafish, sponge). This is not trivial as such nucleation barriers are uncommon even among targeted screens of prion-like proteins.5 Therefore, they appear to have existed in the basal animal. We have now omitted the data concerning bacterial DFDs as these systems are indeed much less understood, and the concerned pathways lack the tripartite architecture of animal signalosomes. We therefore revised the sentence in question by replacing “evolution” with “radiation”.

      Only a small number of DFDs exhibit this behaviour, so why is the conclusion drawn that energy storage for on-demand signalling may be the principal ancestral function of DFDs?

      The totality of the data supports this conclusion. Briefly (but elaborated in the text), 1) intrinsic nucleation barriers are unusual even among self-associating proteins, the vast majority of which (e.g. condensates) would suffice for the only other major function ascribed to DFDs -- bringing effectors close enough for proximity-dependent activation (which has been repeatedly demonstrated in DFD-replacement experiments), 2) nucleation barriers are nevertheless conserved in innate immune signaling pathway, 3) that they are limited to approximately one DFD in each pathway is consistent with evolutionary selection to minimize accidental death.

      Are there any other adapters like MyD88 that are inconsistent with this hypothesis? Are any others known to be controlled by oligomer formation? How strong is the evidence for hexameric oligomers? If there is a threshold size for oligomers, how does this differ from a stable seed/nucleus that triggers assembly, as in the discontinuous transition?

      These are all good questions related to critiques that we have now addressed.

      The use of the term "privatisation" is likely not consistently understood across the community and should be explained. Is it simply meant to imply independent operation? How is it actually different from other forms of deployment of DFDs that exhibit continuous assembly? Are they not also independent? What is implied by the opposite of privatisation here? The term may introduce ambiguity in this context.

      We have now omitted this term.

      Is there strong evidence that well-validated physiologically relevant LLPS systems exhibit supersaturation at concentrations that are very different from those of the DFDs examined in this study?

      No, and this is a major point. As discussed in the text (with references), LLPS is incompatible with cell-wide supersaturation to a comparable magnitude as crystalline transitions, which precludes them from driving signal amplification. This helps to explain why the active state of DFD assemblies is ordered, when it has been repeatedly demonstrated that signal propagation itself does not require ordering.

      The paragraph discussing TIR domains and functional amyloids would be enhanced with a comparison of amyloid systems where seeded nucleation results in assembly of a polymer with significant conformational change in the constituent monomers.

      We do not yet understand how DFDs (and TIR domains) in some cases exhibit amyloid-like nucleation barriers without overt conformational differences between monomers and polymers. Work is underway in the lab to test specific hypotheses, but such discussion would be too speculative for the present paper.

      The statement "High specificity also insulates pathways from each other" should be elaborated to discuss the issue of highly similar monomers that apparently assemble into filamentous forms with minimal structural rearrangement. How is the specificity generated?

      We have elaborated the paragraph.

      The final paragraph is speculative and utilises language that detracts from the quality and rigour of the study. While important principles have been revealed, more discussion of the limitations of the work would allow readers to evaluate the significance of the study and could be used to effectively stimulate further efforts to study the multiple different mechanisms that underpin critical signalling pathways in innate immunity and control cell fate.

      We have now revised the final paragraph and included an extensive discussion of the limitations of the work.

      Reviewer #2 (Recommendations for the authors):

      (1) For clarity, it would be useful to include the names of the proteins in the bottom table of STable1, and such information at the top and bottom tables can be connected.

      We are unable to determine what is meant by this suggestion. Table S1 does not have a “top” and “bottom table”. Every entry in Table S1 and S2 contains the protein name, its most frequently used alias in the literature (when not the official name), and the corresponding Uniprot protein ID.

      (2) The language used in the abstract makes analogies between scientific and mundane terms, which compromises clarity. For example, what is meant by the terms shown below?

      (a) "......specifically templated by other DFDs....."

      We have revised this phrase.

      (b) "...function like batteries, storing and converting energy for life-or-death decisions."

      Batteries convert chemical energy into electrical energy or thermal energy. What is the electrical energy produced by DFDs? Is there any evidence that DFDs change the temperature of the cells or transfer heat?

      We have now included a familiar example of a thermal battery that operates analogously to the manner we show for DFDs. As now elaborated extensively, such batteries operate via a physical rather than chemical process -- a change in the state of matter (solute to crystalline) of a supersaturated “phase change material” (this is an established term). This is exactly what we show is happening for DFDs. While it would be illustrative to measure the heat released upon DFD polymerization in cells, the much faster rate of heat transfer relative to molecular diffusion makes that impossible with present methods. Nevertheless, such measurements are unnecessary because disorder-to-order phase transitions are fundamentally exothermic.

      (c) "....privatizing..."

      We now avoid this term.

      Using appropriate scientific terms to explain the scientific results presented in this manuscript will increase clarity. Analogously, it is difficult to understand what the title of the manuscript means, "Protein phase change batteries..."

      We appreciate this critique and have removed “batteries” from the title to make the work more accessible to biologists. However, we reject the implication that such terminology is inappropriate. We presume the reviewer meant “unfamiliar” instead of “inappropriate”. The well-reasoned application of terms from other fields is standard practice and arguably essential to convey new concepts in biology. The modern biology lexicon is built on this. For example, Robert Hooke co-opted “cell” from the architecture of monasteries. More recently cell biologists appropriated “condensates” from soft matter physics. In both cases, the term while initially foreign to biologists usefully introduced a concept that lacked recognized precedent in biology. Similarly, “phase change battery” provides an accurate analogy for the central finding of our work, and we have now elaborated this analogy in the text.

      Bibliography

      (1) Garcia-Seisdedos, H., Empereur-Mot, C., Elad, N. & Levy, E. D. Proteins evolve on the edge of supramolecular self-assembly. Nature 548, 244–247 (2017).

      (2) Alberti, S., Halfmann, R., King, O., Kapila, A. & Lindquist, S. A systematic survey identifies prions and illuminates sequence features of prionogenic proteins. Cell 137, 146–158 (2009).

      (3) Kimbrough, H. et al. A tool to dissect heterotypic determinants of homotypic protein phase behavior. Protein Sci. 34, e70194 (2025).

      (4) Glück, I. M. et al. Nanoscale organization of the endogenous ASC speck. iScience 26, 108382 (2023).

      (5) Posey, A. E. et al. Mechanistic inferences from analysis of measurements of protein phase transitions in live cells. J. Mol. Biol. 433, 166848 (2021).

    1. social seller

      En el declarativo hay algo interesante también que es que Instagram y Whatsapp como medio superan ampliamente a cualquier otro medio/competidor (de los que declaran vender, y si quitamos los que no responden o responden N/A, el 35.65% vende en IG y el 37.43%en WA. Luego le sigue Woocommerce con 11.12%).

    1. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      Here the authors attempted to test whether the function of Mettl5 in sleep regulation was conserved in drosophila, and if so, by which molecular mechanisms. To do so they performed sleep analysis, as well as RNA-seq and ribo-seq in order to identify the downstream targets. They found that the loss of one copy of Mettl5 affects sleep and that its catalytic activity is important for this function. Transcriptional and proteomic analyses show that multiple pathways were altered, including the clock signaling pathway and the proteasome. Based on these changes the authors propose that Mettl5 modulate sleep through regulation of the clock genes, both at the level of their production and degradation.

      Strengths:

      The phenotypical consequence of the loss of one copy of Mettl5 on sleep function is clear and well-documented.

      Weaknesses:

      The imaging and molecular parts are less convincing.

      - The colocalization of Mettl5 with glial and neuronal cells is not very clear

      We truly appreciate your suggestion. We repeated the staining experiments. To ensure better results, we tried another antibody of ELAV (mouse) and optimized the experimental conditions. This result has been included in the Figure S1 of the revised version.

      - The section on gene ontology analysis is long and confusing

      The session is revised for clarity. To get a better flow of logic, we deleted the paragraph which describing the details of Figure S6.

      - Among all the pathways affected the focus on proteosome sounds like cherry picking. And there is no experiment demonstrating its impact in the Mettl5 phenotype

      Thank you for the comments. The changes of period oppositely at transcriptional versus translational levels puzzled us a while until we found the ubiquitin pathway components changes. The regulation of Period protein degradation by ubiquitin-proteasome pathway has been well documented (Grima et al., 2002; Ko et al., 2002; Chiu et al., 2008). In addition, previous reports indicated that N6 methyladenosine (m6A) regulates ubiquitin proteasome pathway in skeletal muscle physiology (Sun et al., 2023). This information has been included in the revised manuscript in the last paragraph under the title: Mettl5 regulates the clock gene regulatory loop.

      Indeed, we haven’t found a proper way to manipulate proteasome levels in genetic tests. Proteasome is a large protein complex which is composed of many subunits. Enhancing the its activity by overexpressing its components was not applicable. Moreover, proteasome has important function during many biological processed. Disrupting its function by simply MG132 treatment which we tried results in lots of side effects.

      In this study, we also noticed the codon usage alteration caused by mettl5 mutant. Please refer to the answers to the following question for details. Previous reports also found the regulation of mettl5 on translation in other systems (Rong et al, 2020; Peng et al., 2022). Based on these analyses, it is possible that both the regulation on translation and protein degradation contributed the period protein upregulation found in mettl5 mutant. This idea has been included in the Discussion session of the revised manuscript.

      References

      Sun J, Zhou H, Chen Z, et al. Altered m6A RNA methylation governs denervation-induced muscle atrophy by regulating ubiquitin proteasome pathway. J Transl Med. 2023;21(1):845. Published 2023 Nov 23. doi:10.1186/s12967-023-04694-3

      Grima, B. et al. The F-box protein slimb controls the levels of clock proteins period and timeless. Nature 420, 178–182 (2002).

      Ko, H. W., Jiang, J. & Edery, I. Role for Slimb in the degradation of Drosophila period protein phosphorylated by doubletime. Nature 420, 673–678 (2002).

      Chiu, J. C., Vanselow, J. T., Kramer, A. & Edery, I. The phosphooccupancy of an atypical SLIMB-binding site on PERIOD that is phosphorylated by DOUBLETIME controls the pace of the clock. Genes Dev. 22, 1758–1772 (2008).

      - The ribo seq shows some changes at the level of translation efficiency but there is no connection with the Mettl5 phenotypes. In other words, how the increased usage of some codons impact clock signalling. Are the genes enriched for these codons?

      Thank you for raising this point. In our analysis, we observed an increased usage of the codons for Asp in the Mettl5 mutant. Prior work has reported a possible connection between codon usage and per protein activity. In the report, a per version with optimized codon cannot rescue circadian rhythmicity caused by per mutant, in contrast to WT version (Fu J et al. 2016). Further study indicated that dPER protein levels were also elevated in the mutant flies, suggesting a role for codon optimization in enhancing dPER expression (Figure 2B in Fu J et al. 2016). Consistent with this, we analyzed the region of codon optimization in Fu J et al. 2016. The result indicated that that GAC has a relatively high usage rate in these regions (indicated in the following two Author response image charts by the red arrow), suggesting that the Mettl5 mutation may influence per protein accumulation through altered GAC usage. Further experiments are needed to confirm this possibility. We included these details in the second last paragraph of the Discussion session.

      Author response image 1.

      15-21

      SDSAYSN

      Author response image 2.

      43-316

      SSGSSGYGGKPSTQASSSDMIIKRNKEKSRKKKKPKCIALATATTVSLEGTEESPLPANGGCEKVLQELQDTQQLGEPLVVTETQLSEQLLETEQNEDQNKSEQLAQFPLPTPIVTTLSPGIGPGHDCVGGASGGAVAGGCSVVGAGTDKTSELIPGKLESAGTKPSQERPKEESFCCVISMHDGIVLYTTPSISDVLGFPRDMWLGRSFIDFVHHKDRATFASQITTGIPIAESRGCMPKDARSTFCVMLRRYRGLNSGGFGVIGRAVNYEPF

      Fu J, Murphy KA, Zhou M, Li YH, Lam VH, Tabuloc CA, Chiu JC, Liu Y. Codon usage affects the structure and function of the Drosophila circadian clock protein PERIOD. Genes Dev. 2016 Aug 1;30(15):1761-75.

      - A few papers already demonstrated the role of Mettl5 in translation, even at the structural level (Rong et al, Cell reports 2020) and this was not commented by the authors. In Peng et al, 2022 the authors show that the m6A bridges the 18S rRNA with RPL24. Is this conserved in Drosophila?

      Thanks for the reminder. We discussed and cited these papers in the revised version.

      Rong B, Zhang Q, Wan J, et al. Ribosome 18S m<sup>6</sup>A Methyltransferase METTL5 Promotes Translation Initiation and Breast Cancer Cell Growth. Cell Rep. 2020;33(12):108544. doi:10.1016/j.celrep.2020.108544

      Peng H, Chen B, Wei W, et al. N<sup>6</sup>-methyladenosine (m<sup>6</sup>A) in 18S rRNA promotes fatty acid metabolism and oncogenic transformation. Nat Metab. 2022;4(8):1041-1054. doi:10.1038/s42255-022-00622-9

      - The text will require strong editing and the authors should check and review extensively for improvements to the use of English.

      Thanks. The text of the paper are thoroughly revised.

      Conclusion

      Despite the effort to identify the underlying molecular defects following the loss of Mettl5 the authors felt short in doing so. Some of the results are over-interpreted and more experiments will be needed to understand how Mettl5 controls the translation of its targets. References to previous works was poorly commented.

      Thanks for your suggestion. We have incorporated the references mentioned above. However, our efforts have thus far fallen short of elucidating a precise picture of METTL5's functional mechanism. To address this, the limitations of the current study have been discussed more thoroughly in the revised main text.

      Reviewer #2 (Public review):

      Summary:

      The authors define the m6A methyltransferase Mettl5 as a novel sleep-regulatory gene that contributes to specific aspects of Drosophila sleep behaviors (i.e., sleep drive and arousal at early night; sleep homeostasis) and propose the possible implication of Mettl5-dependent clocks in this process. The model was primarily based on the assessment of sleep changes upon genetic/transgenic manipulations of Mettl5 expression (including CRISPR-deletion allele); differentially expressed genes between wild-type vs. Mettl5 mutant; and interaction effects of Mettl5 and clock genes on sleep. These findings exemplify how a subclass of m6A modifications (i.e., Mettl5-dependent m6A) and possible epi-transcriptomic control of gene expression could impact animal behaviors.

      Strengths:

      Comprehensive DEG analyses between control and Mettl5 mutant flies reveal the landscape of Mettl5-dependent gene regulation at both transcriptome and translatome levels. The molecular/genetic features underlying Mettl5-dependent gene expression may provide important clues to molecular substrates for circadian clocks, sleep, and other physiology relevant to Mettl5 function in Drosophila.

      Weaknesses:

      While these findings indicate the potential implication of Mettl5-dependent gene regulation in circadian clocks and sleep, several key data require substantial improvement and rigor of experimental design and data interpretation for fair conclusions. Weaknesses of this study and possible complications in the original observations include but are not limited to:

      (1) Genetic backgrounds in Mettl5 mutants: the heterozygosity of Mettl5 deletion causes sleep suppression at early night and long-period rhythms in circadian behaviors. The transgenic rescue using Gal4/UAS may support the specificity of the Mettl5 effects on sleep. However, it does not necessarily exclude the possibility that the Mettl5 deletion stocks somehow acquired long-period mutation allelic to other clock genes. Additional genetic/transgenic models of Mettl5 (e.g., homozygous or trans-heterozygous mutants of independent Mettl5 alleles; Mettl5 RNAi etc.) can address the background issue and determine 1) whether sleep suppression tightly correlates with long-period rhythms in Mettl5 mutants; and 2) whether Mettl5 effects are actually mapped to circadian pacemaker neurons (e.g., PDF- or tim-positive neurons) to affect circadian behaviors, clock gene expression, and synaptic plasticity in a cell-autonomous manner and thereby regulate sleep. Unfortunately, most experiments in the current study rely on a single genetic model (i.e., Mettl5 heterozygous mutant).

      We believe that the multiple rescue experiments presented in Figure 1H-L and Figure 2H-L have effectively addressed the background concern. To further confirm this, we have subsequently repeated sleep and circadian rhythm assays using RNAi lines, aiming to further eliminate any remaining concerns in this regard. It appears to replicate the reduced sleep phenotype seen at night. This result has been included in the Figure S1. It is true that we have not specifically addressed whether the effects of Mettl5 are mapped to circadian pacemaker neurons in this study. We acknowledge this as a limitation and appreciate the importance of this question. Further investigations focusing on circadian pacemaker neurons, such as PDF- or tim-positive neurons, would be necessary to clarify the precise role of Mettl5 in regulating circadian behaviors and related molecular mechanisms.

      (2) Gene expression and synaptic plasticity: gene expression profiles and the synaptic plasticity should be assessed by multiple time-point analyses since 1) they display high-amplitude oscillations over the 24-h window and 2) any phase-delaying mutation (e.g., Mettl5 deletion) could significantly affect their circadian changes. The current study performed a single time-point assessment of circadian clock/synaptic gene expression, misleading the conclusion for Mettl5 effects. Considering long-period rhythms in Mettl5 mutant clocks, transcriptome/translatome profiles in Mettl5 cannot distinguish between direct vs. indirect targets of Mettl5 (i.e., gene regulation by the loss of Mettl5-dependent m6A vs. by the delayed circadian phase in Mettl5 mutants).

      In the revised version, we provided data collected at multiple time points. Specifically, we reexamined the per expression at both transcriptional and translational levels at different timepoints. The corresponding results were incorporated in Figure 4 D-F. We also dissected fly brains from UAS-DenMark, UAS-syt.eGFP/+; pdf-GAL4/+ and UAS-DenMark, UAS-syt.eGFP/+; pdf-GAL4/Mettl5<sup>1bp</sup> at these four time points to quantify the synaptic structures of PDF neurons. The result has been included in revised Figure 6.

      (3) The text description for gene expression profiling and Mettl5-dependent gene regulation was very detailed, yet there is a huge gap between gene expression profiling and sleep/behavioral analyses. The model in Figure 5 should be better addressed and validated.

      Thank you for your suggestion. We added data to better confirm the expression changes of PER protein at different time points. Indeed, what you mention is the weak point of this paper. We did analysis thoroughly during the revision process.

      The opposing changes in Period at the transcriptional versus translational levels puzzled us for some time until we identified alterations in the ubiquitin pathway components. The regulation of Period protein degradation by the ubiquitin-proteasome pathway is well-documented (Grima et al., 2002; Ko et al., 2002; Chiu et al., 2008). Additionally, previous studies have shown that N6-methyladenosine (m6A) modulates the ubiquitin-proteasome pathway in skeletal muscle physiology (Sun et al., 2023). We have incorporated this information into the revised manuscript in the last paragraph under the section titled: Clock gene regulatory loop regulating circadian rhythm was affected by Mettl5<sup>1bp</sup>

      Indeed, we have not yet identified an effective method to manipulate proteasome levels in genetic tests. The proteasome is a large protein complex composed of numerous subunits, making it impractical to enhance its activity simply by overexpressing individual components. Furthermore, the proteasome plays a critical role in many biological processes. Disrupting its function—such as through MG132 treatment, which we attempted—leads to significant off-target effects.

      Sun J, Zhou H, Chen Z, et al. Altered m6A RNA methylation governs denervation-induced muscle atrophy by regulating ubiquitin proteasome pathway. J Transl Med. 2023;21(1):845. Published 2023 Nov 23. doi:10.1186/s12967-023-04694-3

      Grima, B. et al. The F-box protein slimb controls the levels of clock proteins period and timeless. Nature 420, 178–182 (2002).

      Ko, H. W., Jiang, J. & Edery, I. Role for Slimb in the degradation of Drosophila period protein phosphorylated by doubletime. Nature 420, 673–678 (2002).

      Chiu, J. C., Vanselow, J. T., Kramer, A. & Edery, I. The phosphooccupancy of an atypical SLIMB-binding site on PERIOD that is phosphorylated by DOUBLETIME controls the pace of the clock. Genes Dev. 22, 1758–1772 (2008).

      Reviewer #3 (Public review):

      Xiaoyu Wu and colleagues examined the potential role in sleep of a Drosophila ribosomal RNA methyltransferase, mettl5. Based on sleep defects reported in CRISPR generated mutants, the authors performed both RNA-seq and Ribo-seq analyses of head tissue from mutants and compared to control animals collected at the same time point. While these data were subjected to a thorough analysis, it was difficult to understand the relative direction of differential expression between the two genotypes. In any case, a major conclusion was that the mutant showed altered expression of circadian clock genes, and that the altered expression of the period gene in particular accounted for the sleep defect reported in the mettl5 mutant. As noted above, a strength of this work is its relevance to a human developmental disorder as well as the transcriptomic and ribosomal profiling of the mutant. However, there are numerous weaknesses in the manuscript, most of which stem from misinterpretation of the findings, some methodological approaches, and also a lack of method detail provided. The authors seemed to have missed a major phenotype associated with the mettl5 mutant, which is that it caused a significant increase in period length, which was apparent even in a light: dark cycle. Thus the effect of the mutant on clock gene expression more likely contributed to this phenotype than any associated with changes in sleep behavior.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      Some of the questions that the authors should address are the following ones:

      How does Mettl5 control the translation of the clock genes ? Why the level of some genes are specifically increased or decreased? What is the relation with the effect on uORF and dORF, overlapping and non overlapping ones? The observation of these defects is interesting but how they occurs and how they impact clock signaling is missing.

      Thank you for your suggestion. This is the weak point of this paper. We did analysis thoroughly during the revision process.

      The opposing changes in Period at the transcriptional versus translational levels puzzled us for some time until we identified alterations in the ubiquitin pathway components. The regulation of Period protein degradation by the ubiquitin-proteasome pathway is well-documented (Grima et al., 2002; Ko et al., 2002; Chiu et al., 2008). Additionally, previous studies have shown that N6-methyladenosine (m6A) modulates the ubiquitin-proteasome pathway in skeletal muscle physiology (Sun et al., 2023). We have incorporated this information into the revised manuscript in the last paragraph under the section titled: Clock gene regulatory loop regulating circadian rhythm was affected by Mettl5<sup>1bp</sup>.

      Indeed, we have not yet identified an effective method to manipulate proteasome levels in genetic tests. The proteasome is a large protein complex composed of numerous subunits, making it impractical to enhance its activity simply by overexpressing individual components. Furthermore, the proteasome plays a critical role in many biological processes. Disrupting its function—such as through MG132 treatment, which we attempted—leads to significant off-target effects.

      In this study, we also observed codon usage alterations caused by the mettl5 mutant. For details, please refer to our responses to 4th question of the weakness session above. Previous studies have reported mettl5's role in translational regulation in other systems (Rong et al., 2020; Peng et al., 2022). Based on these findings, we propose that both translational regulation and protein degradation may contribute to the upregulation of Period protein in the mettl5 mutant. This hypothesis has been included in the Discussion section of the revised manuscript.

      “The mechanism by which METTL5 regulates translation warrants further investigation. Previous studies have demonstrated that METTL5 influences translation (Rong et al., 2020; Peng et al., 2022), but whether the mechanisms identified here are conserved across other systems remains an intriguing question. In our analysis, we observed increased usage of aspartate (Asp) codons in Mettl5 mutants. Notably, prior work has linked codon usage to PER protein function—specifically, a codon-optimized version of PER failed to rescue circadian rhythmicity in per mutant flies, unlike the wild-type version (Fu et al., 2016). Further analysis revealed that PER protein levels were elevated in these mutants, suggesting that codon optimization enhances PER expression (Figure 2B in Fu et al., 2016). Strikingly, when we examined the codon-optimized region from Fu et al. (2016), we found that GAC (Asp) was highly enriched, raising the possibility that Mettl5 mutation affects PER protein accumulation by altering GAC codon usage. Additional experiments will be needed to validate this hypothesis. Furthermore, we detected changes in upstream open reading frames (uORFs) in Mettl5 mutants, but their relationship to translational regulation requires further exploration.”

      References

      Sun J, Zhou H, Chen Z, et al. Altered m6A RNA methylation governs denervation-induced muscle atrophy by regulating ubiquitin proteasome pathway. J Transl Med. 2023;21(1):845. Published 2023 Nov 23. doi:10.1186/s12967-023-04694-3

      Grima, B. et al. The F-box protein slimb controls the levels of clock proteins period and timeless. Nature 420, 178–182 (2002).

      Ko, H. W., Jiang, J. & Edery, I. Role for Slimb in the degradation of Drosophila period protein phosphorylated by doubletime. Nature 420, 673–678 (2002).

      Chiu, J. C., Vanselow, J. T., Kramer, A. & Edery, I. The phosphooccupancy of an atypical SLIMB-binding site on PERIOD that is phosphorylated by DOUBLETIME controls the pace of the clock. Genes Dev. 22, 1758–1772 (2008).

      Rong B, Zhang Q, Wan J, et al. Ribosome 18S m<sup>6</sup>A Methyltransferase METTL5 Promotes Translation Initiation and Breast Cancer Cell Growth. Cell Rep. 2020;33(12):108544. doi:10.1016/j.celrep.2020.108544

      Peng H, Chen B, Wei W, et al. N<sup>6</sup>-methyladenosine (m<sup>6</sup>A) in 18S rRNA promotes fatty acid metabolism and oncogenic transformation. Nat Metab. 2022;4(8):1041-1054. doi:10.1038/s42255-022-00622-9

      Fu J, Murphy KA, Zhou M, Li YH, Lam VH, Tabuloc CA, Chiu JC, Liu Y. Codon usage affects the structure and function of the Drosophila circadian clock protein PERIOD. Genes Dev. 2016 Aug 1;30(15):1761-75.

      Reviewer #2 (Recommendations for the authors):

      Please find my comments to improve the quality of your manuscript.

      Major comments

      (1) The quality of text writing in English needs to be at publishable levels. It is not a trivial problem, but it literally impairs the readability of your work. So please have professionals edit your manuscript text appropriately.

      We have carefully revised the language throughout the manuscript during the revision process.

      (2) Fig 1O: please include the total sleep profile and other analyses for rebound sleep phenotypes in control vs. Mettl5 to better validate that both genotypes were comparably sleep-deprived, but the latter shows less sleep rebound.

      Thank you for your suggestion, The other reviewer also suggested to reanalyze the sleep rebound data. We did the analysis according to the following reference. We included data sleep profiles of both genotypes in original Fig 1O. Total sleep profile and other analyses for rebound sleep phenotypes are included in the revised panel. As shown in this revised panel (now Figure 1K, L), both genotypes were comparably sleep-deprived.

      Cirelli C, Bushey D, Hill S, Huber R, Kreber R, Ganetzky B, Tononi G. 2005. Reduced sleep in Drosophila Shaker mutants. Nature 434:1087-92.

      (3) Line 90: the authors did not actually address this critical question. Additional Gal4 mapping (e.g., Mettl5 rescue or Mettl5 RNAi) will determine which cells/neural circuits are important for Mettl5-dependent sleep.

      This sentence has been revised into “The observed expression pattern of Mettl5 further supports its sleep regulatory function.”

      (4) Fig 1H-L; Fig 2H-L: the authors should check if overexpression of wild-type or mutant Mettl5 in control backgrounds could affect nighttime sleep to better define the transgenic effects among overexpression, rescue, and dominant-negative.

      Thank you for the comment. We added the overexpression phenotypes in the revised version.

      (5) Lines 225-226. Fig S11: The neural projections from PDF-expressing neurons should be better imaged and quantified. Current images can visualize PDF projections onto the optic lobe but not others (e.g., dorsal, POT), so the conclusion is not validated.

      Thank you for the suggestion. We acknowledge the limitation in the current images of PDF-expressing neuronal projections. We included new, higher-resolution images to better visualize and quantify the neural projections, including the dorsal and POT regions, to ensure the conclusion is well-supported.

      (6) Lines 230-232: per RNA/PER protein expression oscillates daily, so the authors should perform time-point experiments to conclude Mettl5 effects on clock gene expression, including per.

      Thank you for the insightful comment. We performed experiments in the Mettl5 mutant background at four time points to analyze PER protein expression using both RT-PCR and Western blot (anti-PER). The updated results have been included in Figure 4D-F.

      (7) Lines 235-238: the authors should note that Mettl5 effects on sleep in Clk or per mutant backgrounds are actually opposite to those in w1118/control one. Mettl5 deletion promotes daytime or nighttime sleep in Clk or per mutants, respectively. Any explanation? 

      We are trying to use epistasis analysis to determine which gene is upstream here. Epistasis (or epistatic effect) in genetics refers to the interaction between different genes where the expression of one gene (the epistatic gene) masks or modifies the expression of another gene (the hypostatic gene). The epistatic gene (masking gene) usually functions downstream in the pathway because its effect overrides the output of the hypostatic gene. The double mutant showed the similar phenotype as downstream genes. Thus, Clk or per functions downstream of Mettl5.

      (8) Fig 6: The dorsal PDF projections actually show time-dependent plasticity. Results from the single time-point are not conclusive.

      Thank you for the insightful comment. we further dissected fly brains from UAS-DenMark, UAS-syt.eGFP/+; pdf-GAL4/+ and UAS-DenMark, UAS-syt.eGFP/+; pdf-GAL4/Mettl5<sup>1bp</sup> at these four time points to analyze the morphology of PDF neurons. The results have been included in figure 6.

      Minor comments

      (1) Please avoid simple bar graphs in the data presentation-include individual data points or use a different graph showing the distribution of raw data (e.g., violin plot, box plot, etc.).

      Thank you for the suggestion. In the revised version of the manuscript, we have included individual data points, violin plots, and box plots to present the data, effectively showing both the distribution and differences in the raw data.

      (2) Line 19: "Clock" indicates the gene name or general terminology such as "circadian clock". Please clarify it and revise the font accordingly.

      This has been revised into“clock”

      (3) The overall flow in the Abstract/Summary is somewhat challenging for a general audience to follow.

      We have revised the text, especially the overall flow in the Abstract/Summary.

      (4) Fonts for the names of genes and gene products (i.e., mRNA, protein) should be appropriately corrected throughout the manuscript.

      We have checked the text and made changes where necessary.

      (5) Methods: the authors should provide detailed information on the methods. For instance, there is little description of how they generate Mettl5 deletions (e.g., sgRNA/target sequence). Also, they should clarify whether they test heterozygous vs. homozygous mutants of Mettl5 deletions in each experiment since the genotype description in the figure appears mixed-up (e.g., Fig 1B vs. Fig 1I-L).

      Thank you for pointing this out. In the updated version, we provided detailed information about the strains used, including the sgRNA/target sequences for generating Mettl5 deletions. Regarding the genotypes, Figure 1B represents homozygous mutants, while Figures 1I-L represent heterozygous mutants. This distinction has been clarified in the figure legends, and the genotype notation for Figures 1I-L will be revised for consistency and clarity.

      (6) Fig 1: the figure panels should be re-arranged based on the order of their text description (i.e., Fig 1H-L should go after Fig 1M-O).

      Thank you for the suggestion. In the revised version, we rearranged the figure panels so that Figures 1H-L appear after Figures 1M-O, following the order of their description in the text.

      (7) Sleep education in Trmt112 RNAi looks different from that in Mettl5 mutant het. Any explanation?

      The functional divergence between Trmt112 and Mettl5 may also contribute to the observed sleep phenotype. While Trmt112 and Mettl5 share some downstream targets, they each regulate many unique genes, some of which could influence sleep. Sleep is a highly sensitive trait that can be modulated by numerous genetic factors. Previous studies have also suggested that sleep behaves more like a quantitative trait, reflecting the combined effects of multiple genes (Mackay and Huang, 2018).

      Mackay TFC, Huang W. Charting the genotype-phenotype map: lessons from the Drosophila melanogaster Genetic Reference Panel. Wiley Interdiscip Rev Dev Biol. 2018;7(1):10.1002/wdev.289. doi:10.1002/wdev.289

      Reviewer #3 (Recommendations for the authors):

      A detailed critique is provided below. Generally, the authors can greatly improve this manuscript if they focus more rigorously on the circadian phenotype associated with the Mettl5 mutant, which could be the basis for the apparent sleep phenotype.

      (1) Please provide more information as to how each of the mettl5 mutants were generated. This information should include, specifically, the gRNA sequences, plasmids generated for the 5' and 3' arms, and anything related to the CRISPR approach for generating the mutants. Was any sequencing done to verify the CRISPR alleles, or was this limited to the analysis of mettl5 expression and behavior? Please indicate where the qPCR primers (used in Fig 1B) are located relative to the mutant loci. The figure legend is also incomplete in that there is no reference to the boxed area in Fig 1A.

      In the updated version, we have provided detailed information about the how each of the mettl5 mutants were generated. The sequence was verified by sequencing following PCR. The following references to the boxed area were added in the revised version.

      Reference

      Iyer LM, Zhang D, Aravind L. Adenine methylation in eukaryotes: Apprehending the complex evolutionary history and functional potential of an epigenetic modification. Bioessays. 2016 Jan;38(1):27-40. doi: 10.1002/bies.201500104.

      (2) As noted, I am not in agreement with the interpretation of findings for the sleep defect reported in the mettl5[1b]/+ mutants. There is a clear increase in morning sleep in the mutants that may not have reached significance by lumping the data in 12h increments (Fig1C-E). Were the overall 24h sleep values between the mutants and controls the same? The sleep profile appears to be shifted, such that nighttime sleep onset in the mutants occurs much later than wild type, and daytime waking is also much later, all pointing to a long period phenotype, which is very strongly supported by the data in Table 1, as well as the RNA- and ribo-seq data. The implications for this leading to sleep disturbances in humans is very exciting. An additional suggestion to the authors here is to report the nighttime sleep latency values (time to onset of the first sleep bout after lights off).

      We appreciate your insightful observation. As shown in Table 1, the Mettl51bp/+ mutant exhibits a robust long-period phenotype, with circadian rhythms significantly extended to 28.3 ± 0.4 hours compared to the wild-type's 23.9 ± 0.05 hours. This prolonged period perfectly aligns with the observed behavioral phenotypes, including delayed nighttime sleep onset, later daytime waking, and the overall shift in sleep profile. This is indeed quite similar to previous report on Period3 variant (Zhang et al., 2016). We agree that the prolonged circadian period contributes to the observed sleep phenotype. However, since total sleep time was significantly reduced in the mutant, we cannot attribute the phenotype solely to period lengthening. Furthermore, our 24-hour PER expression analysis in mettl5 mutants revealed elevated PER protein levels at ZT1 and ZT18, while ZT6 and ZT12 showed no significant changes, with no apparent phase shift. These findings collectively suggest that the phenotype primarily results from PER protein stabilization and accumulation.

      Importantly, genetic rescue experiments restoring wild-type Mettl5 function (UAS-Mettl5/Mettl5-Gal4; Figure 1 and Table 1) completely normalized the circadian period to 24 ± 0.02 hours, providing compelling evidence that these phenotypes specifically result from loss of Mettl5 function. Together with the sleep architecture data, these findings establish Mettl5 as a crucial regulator of circadian rhythms, with important implications for understanding human sleep disorders. To further substantiate these observations, we have now included quantitative nighttime sleep latency measurements in the revised manuscript to better document the delayed sleep onset in mutants (Figure S1G).

      We have discussed this in the third paragraph of the Discussion session and included the reference in the revised manuscript.

      Zhang L, Hirano A, Hsu PK, et al. A PERIOD3 variant causes a circadian phenotype and is associated with a seasonal mood trait. Proc Natl Acad Sci U S A. 2016;113(11):E1536-E1544. doi:10.1073/pnas.1600039113.

      (3) The description for how circadian behavior was measured and analyzed (Table 1) is missing from the methods section.

      We have included a detailed description of the methods used to measure and analyze circadian behavior, as presented in Table 1, in the revised methods “Sleep behavior assays” section.

      (4) Please explain what the "awake %" values reported in Figs 1G, 1L, Fig 2G, and 2L, Fig 4G and 4M are. Is this simply the number of flies that are awake at a given time point? This does not provide useful information beyond what is already reported for the sleep profiling in other parts of these figures. If it is an arousal threshold assay, as shown in supplementary Fig 1H, please indicate this. The description for "sleep arousal" in the methods (lines 368-371) is also concerning. If most of the mutant flies are already awake at ZT 14, then I would expect that this assay would not work at this time of day. A more suitable time point would be ZT 19, or later, when the mutants are falling asleep. Moreover, calculating the number of flies awakened as long as 5 minutes after a stimulus pulse cannot be distinguished from a spontaneous awakening, and so is not really a metric of arousal threshold. The number of sleeping flies awakened by the stimulus should be calculated within, at most, one minute afterward.

      Thank you for your suggestion. Regarding the 'awake %' metric, it indicates that at specific time points (e.g., ZT14), the percentage of awake fruit fly population at that moment. In the revised version, we further clarify the definition and significance of 'awake %'. Additionally, we have reevaluated the time points for the arousal threshold assay, selecting a more appropriate time (e.g., ZT19) to better reflect the sleep state of the mutants. Based on your suggestion, we calculate the number of flies awakened within one minute after the stimulus to ensure a more accurate measurement of arousal threshold. This has been included in the revised Figure 1M.

      (5) Fig1M-O is problematic. First, is it possible that expression of Mettl5 mRNA fluctuates with time-of-day and is not affected by sleep loss? There are no undisturbed controls collected at equivalent time points. The method used for quantifying sleep rebound in Fig 1O (lines 365-367) does not make sense, as negative values would be expected. Moreover, since the Mettl5 mutants show high sleep amounts in the morning and very low sleep amounts from ZT 12-18, this analysis would be severely confounded. Also, the sleep deprivation applied would not produce equivalent amounts of sleep loss as compared to wild type controls, so this also needs to be corrected. The authors should consider consulting Cirelli et al (2005, DOI: 10.1038/nature03486 ) as an approach for quantifying sleep homeostasis in a short-sleeping mutant. Please also show the sleep profiling in the mutants for these experiments.

      Thank you for your valuable suggestions. Regarding the possibility that Mettl5 mRNA expression fluctuates with circadian rhythms rather than being affected by sleep deprivation, we acknowledge that collecting undisturbed control samples at equivalent time points would provide critical insights. In the revised version, we included undisturbed controls to distinguish between circadian-driven fluctuations and the effects of sleep deprivation on Mettl5 expression.

      For the quantification of sleep rebound in Figure 1O, we agree that the current method may not fully capture the dynamics of sleep recovery, especially in Mettl5 mutants, where sleep patterns differ significantly from wild-type. We have referred to the method proposed by Cirelli et al. paper for quantifying sleep homeostasis in short-sleeping mutants, ensuring a more accurate evaluation of sleep rebound. The results have been included in Figure 1K-L of the revised version.

      (6) Fig 3B and C (minor) - while the volcano plots are clear, it is not clear whether "down" or "up" means for the mutant relative to wild type or the other way around? Please clarify. In Fig 3P, the legend indicates a depiction of the "top 5 pathway associated genes", but it seems there are 10 pathways depicted. Which of these are the "top 5"?

      In the volcano plots (Fig. 3B and 3C), “up” and “down” refer to genes that the mutant relative to the wild-type strain. In Fig. 3P, the legend was mislabeled as “top 5” pathway-associated genes. In fact, we displayed the top 10 pathway-associated genes. We apologize for the confusion and will correct both the figure legend and the corresponding text in our revised manuscript.

      (7) Fig 4 D-E, and F,G do not have sufficient information to draw the conclusion that Per mRNA/protein expression is increased in the Mettl5 mutant. Since both mRNA protein of this gene oscillates significantly throughout the day, it is still possible that the single time point shown in this figure might indicate a disruption in cycling rather than overall expression level. Please first indicate what time of day the tissue was collected, second, consider adding more time points to both assays. For the first part of this figure, A and B, per and Clock gene expression are expected to be in different phases, and so this aspect is not unexpected. However, it is notable that it is reversed in the mutant vs wild type. Again, an alternate interpretation of this finding that the authors have not considered is a change in period duration of gene cycling.

      Thank you for your suggestion. For the PER WB experiments, we have included multiple time points in the revised version to more comprehensively evaluate PER expression in the Mettl5 mutant and better understand its circadian rhythm changes. We appreciate your observation regarding the potential changes in the period duration of gene cycling. This has been discussed in the 3<sup>rd</sup> paragraph of the Discussion session of the revised version.

      (8) The data shown in Figs 4H-M does not support the conclusion that "Clock and Per genes were downstream of Mettl5" (line 236-237). The daytime sleep phenotype, in particular, appears additive between both circadian genes and mutant because the morning sleep of the double mutant is much higher than either mutant by itself. Statistical comparisons between the double mutant and each clock mutant are also noticeably missing. These data are difficult to interpret. One potential explanation is that Mettl5 alters gene expression of non-circadian genes, and that the phenotypes become additive when both clock and Mettl5 genes are missing. A full molecular analysis of clock gene cycling in the Mettl5 mutant may help improve understanding of the relationship between the circadian clock Mettl5 gene expression. It may also be worthwhile checking whether Mettl5 gene expression itself shows a daily oscillation.

      Thank you for your suggestion. In the revised version, we have included four additional time points to analyze the oscillatory expression of Per and Clock in the Mettl5 mutant, providing a more comprehensive understanding of their circadian rhythm changes. In Figs 4H-M, we are trying to use epistasis analysis to determine which gene is upstream here. Epistasis (or epistatic effect) in genetics refers to the interaction between different genes where the expression of one gene (the epistatic gene) masks or modifies the expression of another gene (the hypostatic gene). The epistatic gene (masking gene) usually functions downstream in the pathway because its effect overrides the output of the hypostatic gene. The double mutant showed the similar phenotype as downstream genes. Thus, Clk or per functions downstream of Mettl5. Statistical comparisons between the double mutant and each clock mutant are added.

      (9) In Fig 6, what time of day were the flies collected? PDF terminal morphology is known to change throughout the day; this is another piece of data that could indicate a defect in circadian function rather than a chronic change in synaptic morphology.

      The flies were collected around ZT14. We included additional dissection time points in future experiments. Differences between the control and Mettl5 mutants are observed consistently across multiple time points, suggesting that Mettl5 has an impact on synaptic plasticity.

      Minor:

      There are letter indicators, presumably for statistical comparisons, depicted in Figs 1 and 2 (panels I-L), but no explanation as to what these mean in the figure legends.

      We have added notes in the revised version.

      What is the purpose of the boxed regions shown in Fig S1A-F? There is no explanation of these in the figure legend nor in the text.

      The boxed regions highlight the significant co-localization of two proteins. We have included this explanation in the figure legend in the revised version.

      The statement (lines 310-311) that per and clock genes "exhibit more pronounced sleep rebound after sleep deprivation" is inaccurate. The article cited for this (Shaw et al 2002) showed that it was female mutants of the cycle gene which showed prolonged sleep rebound; other clock mutants were normal.

      Thank you for pointing out this. We revised the statement accordingly.

      Overall, the manuscript may benefit from editing or writing assistance to improve the language. There were many incomplete sentences, grammatical errors, etc.

      We have carefully refined the language throughout the manuscript during the revision process.

    1. Once a new policy is put into place, institutions must act to implement the change. For the civil rights movement, this work included integrating schools, which we will talk about more in Chapter 5. It included registering Black and Brown people to vote. It included ending the legal segregation of public spaces, even though de facto segregation still exists today. Step Six: Policy O

      This passage explains that after a policy is created, it still needs to be put into action. In the civil rights movement, this meant actually integrating schools, registering people to vote, and ending legal segregation. Even though laws changed, inequality still exists in everyday life.

    1. Incluye HTML o CSS personalizados que alteren el estilo base de Quarto

      De esto no estoy seguro. El uso de CSS (o SCSS) puede ser útil para darle identidad al tablero.

    2. figuras

      En mi opinión si podrían poner figuras o imágenes para completar su historia (por ejemplo los logos de los ODS que están abordando). Entonces, en vez de la palabra figuras, pondría gráficas, pues estas deben generarse con los datos y con Plotly.

    1. Note: This response was posted by the corresponding author to Review Commons. The content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We appreciate the time and effort the reviewers have invested in providing constructive feedback on our manuscript. Below, we’ve detailed additional work, corrections, and improvements that we will complete during the revision process.


      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      Summary

      Folding is a major morphogenetic process that shapes tissues and organs in three dimensions. The mechanisms underlying tissue folding have been extensively explored and are often driven by actomyosin-based apical constriction. Here, the authors describe changes in cell geometry and mechanics during mouse neural tube formation. They build on quantitative fixed imaging and live junction ablation to extract cell geometry and junctional tension. These analyses are performed at different developmental stages and in both male and female embryos to propose a mechanical mechanism for neural tube elevation in the brain.

      Major comments

      The authors report quantitative data on cell geometry and junctional tension inferred from laser ablation. Overall, there are numerous statements that require stronger support from the experimental data. To substantiate several of their claims, the authors need to provide a larger number of data points-or at least comparable numbers across experimental conditions-for the tension measurements. Additional statistical analyses are required throughout to support the conclusions.

      Figure 1

      1. Does the projection algorithm account for tissue curvature when computing cell geometrical parameters such as area and anisotropy? At present, our projection algorithm does not correct for tissue curvature. Curvature in the tissue can make larger cells appear smaller in projections, skew the angle of cell orientations, and change aspect ratios. The largest curvature in the midbrain neural tube samples that we analyze is found in the transition region from the midline and lateral regions (~10-30% of tissue width) of 5 ss and 8ss embryos. The regions at the midline and more laterally are relatively flat. Therefore, distortion from curvature will not dramatically alter our key conclusions. We will apply a curvature correction using existing tools (Herbert S., et al (2021) BMC Biology) to sample images and determine if there are substantial differences in curvature-sensitive cells shape metrics. These will be included in a supplement to Figure 1. If there is a significant difference, we will expand the correction to all images that we analyze and update our analysis.

      The authors should provide information on the accuracy and reliability of the cell segmentation.

      We can provide a supplement to Figure 1 to demonstrate the accuracy of the segmentation. We have used F-Actin to segment cells in our images, which is enriched along the cell junctions but can also form medial cables that cross the cell surface. Junctional actomyosin is notably brighter than medial cables, and segmentation with our trained CellPose model is consistently able to distinguish the junctions. We also checked segmentation and performed manual corrections to ensure accuracy. To demonstrate this for our readers, we will prepare samples stained with both F-actin and ZO-1, a tight junction component that is localized to cell junctions. We will then segment the image twice in CellPose, once using the F-actin signal and once using the ZO-1 signal. The resulting cell outlines will then be digitally superimposed to show how much the signals overlap, and we will plot out the cell frequency as a function of area to determine if F-actin segmentations can segment with the same fidelity as ZO-1. Recent work by a co-author has shown excellent corroboration of neuroepithelial apical cell areas segmented using F-Actin and ZO-1 (Ampartzidis I., et al. eLife 2026). We are confident that our data will show a similar result.

      The authors indicate that the rate of apical constriction differs between male and female embryos. However, apical sizes differ only at specific positions along the ML axis (Fig. 2H, I).

      In Figure 2H, we show that at 5 ss males have larger apical areas than females at the midline, adjacent lateral cells, and at the surface ectoderm-neural epithelium border. By 8ss (Figure 2I), cells at the midline are smaller in males than females, while cells in more lateral regions are now equivalent between sexes. This change in apical area over time suggests that males have faster rates of constriction than females at the midline and adjacent lateral region where male cells become smaller or equivalent in size to female cells, respectively. We will perform statistical analysis (see comment #4) to determine if there are regions with significant differences in rate and amend our language to clarify that these differences are region specific as appropriate.

      The authors should provide statistical analyses for the rates shown in Fig. 2J. Are these rates significantly different between males and females, and between medial and lateral regions?

      Currently we calculate our rates using the difference in population averages of apical area at each stage shown in Figure 2H and 2I for each sex, and dividing by the number of somite stages, 3. As a result, there is only one rate value at each midline-lateral bin for each sex which is not amenable to statistical analysis. To correct this, we will calculate rates by subtracting the average apical area of each embryo at 8 ss from the population average of embryos at 5 ss. This will create 5 rates for both females and males at each 10% midline-lateral bin. We plan to perform a two-way ANOVA to determine if there are statistical differences in rates between males and females at each bin position and between medial and lateral regions. We will also add a section describing these calculations to the “Statistical Analysis” portion of the methods.

      Please clearly state the main novelty of this study relative to the work published by Brooks et al.

      Our study builds on the work of Brooks ER, et al. (2020) eLife. Brooks demonstrates that cells in a region of the lateral neural folds undergo apical constriction (Figure 1) and that cells at the midline do not (Figure 2). We expand and improve upon this work in the following ways:

      1. A) As required by our funding sources at the NIH (NOT-OD-15-102) we have collected, analyzed, and reported on sex as a biological variable of interest. In doing so, we have shown that there are clear sex differences in apical area in the neural tube that were not previously shown. We also show that there is apical constriction within the neural tube midline in a sex dependent manner. Brooks et al do not address sex in their work.
      2. B) We have provided more complete and spatially precise information on midline-lateral patterns of apical area and apical constriction. To show changes in apical area of lateral cells, Brooks selects a 100 x 100 µm region of interest in the midbrain (Figure 1E-F, Figure 2A) but does not specify the midline-lateral or rostral-caudal location of this region of interest or standardize it between embryos of different ages and dimensions. In our study, we’ve standardized our measurements to a 100 µm wide band across the midbrain adjacent to the midbrain/hindbrain boundary (Figure 2A-C). We also standardize positions as a percent distance from midline to account for differences in width between embryos and ages. This allows us to consistently compare similar populations of cells along the midline-lateral axis and determine changes in apical area over time.
      3. C) We connect patterns of apical area and constriction to F-actin and Myosin-IIB density. Though Brooks et al report some analysis of F-actin in lateral cells (Figure 6), they do not analyze the midline cells or explore the relationship between cell shape and actomyosin.
      4. D) Finally, we tested the mechanical properties of the tissue through laser ablation in living mouse embryos. From these ablations we’ve found that tension at the midline is less than in more lateral regions. Work in the neural tubes of frog (Haigo S., et al. (2003) Current Biology, Baldwin AT., et al. (2022) eLife, Matsuda M., et al. (2023) Nature Communications) and chicken (Kinoshita N., (2008) * Cell, Nishimura T., et al. (2012) Cell) embryos has conclusively shown that enriched midline actomyosin promotes apical contractility and drives hinge formation. It was therefore largely believed that a similar contractile hinge was employed in mammals (Copp AJ. and Green NDE. (2010) J. Pathol, Nikolopoulo E., et al. (2017) Development). Collectively, our work is the first to demonstrate that such a contractile hinge is not present in the mammalian brain neural tube. Figure 3*

      The authors need to provide statistical support for the claim that large midline cells exhibit reduced F-actin and Myosin IIB levels.

      We will conduct a two-way ANOVA to determine if there are statistical differences in F-actin and Myosin IIB density at the midline and more lateral regions in both males and females. We will update our language in the text and plots as appropriate from these results.

      F-actin and Myosin IIB intensities should be plotted as a function of cell area to support the proposed anticorrelation between apical area and actomyosin levels.

      We will make plots of cell areas vs. F-actin or Myosin IIB density for cells in each embryo. We will then fit a line to determine the R value for each embryo to determine if there is a negative correlation between cell area and actomyosin intensity. We will also adjust our language in the text as appropriate based on the results of these tests.

      Statistical analyses are missing to substantiate the increase in F-actin levels between stages ss5 and ss8.

      We will perform an F-test to determine homogeneity of variance between F-actin at 5 ss and 8 ss followed by the appropriate t-test to determine if there is a statistical increase in F-actin over time. We will also amend our language in the text to reflect the results of this test.

      Figure S3 should be supported by plots showing Myosin II and F-actin intensity as a function of position along the ML axis, together with appropriate statistics.

      In Figure 3A-D, we show representative images of F-Actin and Myosin IIB density in female embryos. These are plotted as the purple lines in Figure 3 E-H. Figure 3 Supplement 1 shows representative images of F-actin and Myosin IIB density in male embryos. These are plotted as the green lines in Figure 3 E-H. We will add a line in the caption of Figure 3 Supplement 1 indicating that these samples are represented and plotted in Figure 3. We also noted a typo in the respective captions, incorrectly indicating male or females were shown in the figure. We will correct these typos as well. Additionally, we will perform the statistical tests indicated under comment #6.

      Figure 4

      The authors state that lateral tension in male embryos is not different from midline tension, yet the number of data points is much lower than in females. To support this claim, the number of ablations should be comparable across sexes.

      As part of this study we performed 270 ablations in the neural tubes of 83 mouse embryos: an exceptional scale of ablations that is the first of its kind in early embryos. We conducted our initial recoil velocity analysis blinded to information on sex. Male embryos were statistically underrepresented in our data set because male embryos develop faster than their female littermates (Seller MJ. and Perkins-Cole KJ. (1987) J. Reprod. Fert.). As such, the neural folds of male embryos were too elevated to ablate. At present we do not have the resources or justification to perform laser ablations on additional animals to obtain the number of male embryos needed to supplement the already exceptionally large data set. We will instead perform a power analysis to determine if: 1) we have a sample size large enough to detect a biologically-meaningful difference with suitable power, 2) the sample size required to detect the observed difference is so large that the difference would not be biologically meaningful, or 3) we do not have a sample size large enough to detect a difference confidently. With the results of this analysis, we will amend our language in the text to reflect the most accurate claims that can be made.

      Is lateral tension different between males and females?

      In Figure 4G we show that females have statistically different tension between the lateral and midline regions, while males do not. However, we do not test if the lateral or midline tension is different between females and males. We will perform an F-test and t-test to determine if there are statistical differences between males and females in this region.

      Similarly, the data in Fig. S4 used to claim no change in tension over time are not supported by sufficient data points.

      As discussed in comment #10, the scale of ablations is already substantial, and the initial recoil velocities were analyzed blinded to information on embryo age. We will calculate a best fit line for these plots to demonstrate if there is a trend in recoil velocity over time. We will then adjust our language in the text as appropriate with this added information.

      Would the medial and lateral tensions reported in Fig. 4G remain unchanged if the authors perform statistical analyses on 10-15 ablations per condition?

      We do not have a justification for removal or exclusion of any of the laser ablations analyzed in this study. We will instead perform a power analysis, as indicated in comment # 10, and adjust the language in the text as appropriate given the results of that analysis.

      Figure 5

      The number of data points in Fig. 5J and L is insufficient to support claims of no difference. The only detectable difference arises in the comparison with much higher sample size (Fig. 5L, ML vs RC).

      In Figure 5J we disaggregate ablations performed at the midline by directionality (midline-lateral or rostral-caudal). We were unable to detect a statistically significant difference based on the direction of initial recoil velocity in either sex, though N’s for all categories are comparable. As discussed in comments #10 and #12, the scale of ablations conducted in this study is uniquely substantial. We will perform a power analysis for our anisotropy measurements in the lateral region of the tissue to determine if we have a sample size large enough to have detect a biologically-relevant difference with high confidence or if the sample size required to detect the observed difference is so large that the difference would not be biologically meaningful. Given the results of this analysis, we will amend our language in the text to reflect the most accurate claims that can be made.

      The authors conclude that males have higher ML tension than RC tension, but given the limited data this conclusion should be amended to "no detectable difference."

      In Figure 5L, we disaggregate ablations performed in the lateral regions, by directionality (midline-lateral or rostral-caudal). We find a statistical difference in the directionality of initial recoil velocity in females. In males, though we can observe a difference in the initial recoil velocity means, we are unable to detect a statistical difference, likely due to the smaller male sample size. As discussed in comments #10 and #12, the scale of ablations conducted in this study is uniquely substantial and was conducted blinded to embryo sex. Given that males develop faster than their female littermates (Seller MJ. and Perkins-Cole KJ. (1987) J. Reprod. Fert.) we were unable to obtain more males in our data set. We will perform a power analysis for our anisotropy measurements in the lateral region of the tissue to determine if: 1) we have a sample size large enough to detect a biologically-meaningful difference with suitable power, 2) the sample size required to detect the observed difference is so large that the difference would not be biologically meaningful, or 3) we do not have a sample size large enough to detect a difference confidently. With the results of this analysis, we will amend our language in the text to reflect the most accurate claims that can be made.

      Code availability

      The authors should provide access to the code used to generate the projections.

      We are committed to ensuring open access to all code used as part of this study, including components of the projection workflow, data analysis, and figure creation. We are in the process of assembling a GitHub repository containing these files as well as documentation to allow for use by other members of the research community and public. We will publicly publish this documentary upon completion of the repository or at time of publication, whichever comes first.

      Reviewer #1 (Significance (Required)):

      The authors propose a mechanical model for neural tube elevation based on analyses of cell geometry and tension at two developmental stages. The reported differences in cell geometry or actomyosin levels do not appear to explain the differences in geometry or tension suggested between male and female embryos. This raises questions about the relationship between these measurements and their relevance for understanding the mechanisms of neural tube elevation.

      If the major concerns outlined above are rigorously addressed, the manuscript will offer a valuable descriptive characterization of neural tube cell geometry and mechanical stress during morphogenesis. Such datasets could form a foundation for future studies investigating the mechanisms driving neural tube elevation.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      The manuscript investigates the role of apical constriction and actomyosin organization in shaping the mouse brain neural epithelium during neural tube elevation, with particular emphasis on sex-specific differences. The authors develop an imaging and analysis pipeline to reconstruct the apical surface of the neural plate in three dimensions and perform quantitative measurements of apical cell area, actin, and myosin IIB distributions. Targeted laser ablation experiments are used to infer regional tissue tension.

      The main findings can be summarized as follows. First, the authors identify a mediolateral gradient in apical cell area, with larger cells at the midline and smaller cells on the lateral neural folds, which inversely correlates with actomyosin density. Laser ablation experiments suggest that apical tension is lower and isotropic at the midline, whereas it is higher and anisotropic on the lateral folds, particularly in females. Second, sex-dependent differences in apical cell area, constriction rates, and actomyosin levels are reported at early somite stages, preceding previously described sex biases in neural tube defects.

      The experimental work is technically solid, and the imaging and quantification pipeline represents a useful advance for analyzing large, curved epithelial surfaces. However, the study feels incomplete in its current form. Despite addressing neural tube elevation, the manuscript does not provide a comprehensive analysis of the folding process itself. Key aspects such as three-dimensional tissue morphology, curvature evolution, or global shape changes of the neural folds are not quantified. In addition, other potentially relevant cellular behaviors, such as proliferation, cell rearrangements, or contributions from neighboring tissues, are not examined, nor are they compared systematically between sexes.

      Conceptually, the study focuses narrowly on correlations between apical cell area, actomyosin density, and inferred tension. While these measurements are carefully performed, the relationship between differential actomyosin contractility and three-dimensional tissue folding remains largely descriptive. No mechanical model or simulation framework is provided to link changes in actomyosin organization and cell shape to the emergence of neural folds and hinge formation. As a result, it is difficult to assess whether the measured differences in tension (on the order of ~40%) are sufficient to account for the proposed mechanical behavior of the tissue.

      The central hypothesis advanced by the authors is that a relatively "soft" midline, flanked by stiffer, tension-bearing lateral folds, facilitates hinge formation during brain neurulation. However, this hypothesis is not directly tested by perturbation. For example, experimentally increasing contractility or stiffness at the midline (e.g., via optogenetic activation of apical constriction machinery) would provide a more direct test of causality. As it stands, the data demonstrate correlation rather than necessity or sufficiency.

      Relatedly, alternative interpretations are not fully addressed. Large apical cell areas and low actomyosin levels at the midline could arise as a consequence of tissue geometry, contact with underlying structures such as the notochord, or extrinsic mechanical constraints, rather than being the primary cause of hinge formation. Similarly, anisotropic stresses generated at the tissue or embryo scale could align cells and actomyosin cables, producing the observed patterns without requiring locally specified apical tension differences as the initiating mechanism. The manuscript does not clearly distinguish whether apical tension asymmetries are a driver of folding or an emergent outcome of folding dynamics.

      Finally, while the identification of sex differences is intriguing, it remains unclear what mechanistic insight is gained beyond establishing that such differences exist. The functional consequences of these differences for neural tube closure, robustness, or failure are not explored, nor is it clear how they integrate into the proposed lateral tension model.

      In summary, this study provides high-quality measurements of apical cell geometry, actomyosin organization, and inferred tension in the mouse neural epithelium. However, the lack of direct perturbations, mechanical modeling, and quantitative analysis of three-dimensional tissue deformation limits the strength of the mechanistic conclusions. Addressing these gaps would substantially strengthen the manuscript and clarify the causal role of apical tension patterns in neural fold formation.

      __ __The reviewer makes an excellent point, that direct perturbation of the system would enable us to test our hypothesis and inform whether the reduced contractility at the midline is essential for neural tube elevation. However, at present the technology needed to conduct an optogenetic experiment like that described by the reviewer does not exist. As with the laser ablations, an optogenetic experiment requires access to live and healthy embryos. Currently, mouse embryos can be cultured for several days in roller culture, where they are continuously rotated, or for several hours in static culture (Aguilera-Castrejon A. and Hanna JH. (2021) J. Vis. Exp.). Both techniques require that the yolk and amniotic sacs remain intact around the embryo. To access the apical surface of the brain neural tube for imaging, both sacs must be breached, after which the embryo has about 30 minutes before it begins to exhibit altered cellular morphology and tissue integrity and ultimate embryo death.

      The neural tube elevates over several hours and closes fully after more than a day (Jacobson AG. and Tam PPL. (1982) The Anatomical Record). Even if we did acquire mice expressing photoactivatable constructs, the support membranes of the embryos would need to be breached to activate protein interactions. The embryos would die before any meaningful progress in neural tube elevation could be evaluated. Conducting an experiment like this would greatly advance our understanding of the system, and we hope that the needed technologies are developed to enable future work of this nature. The Galea lab previously purchased a photo-activatable Cre line, but was unable to induce deletion of a protein of interest using this allele before closure of the neural tube was completed (and the blue light needed to activate the cre was photo-toxic).

      At present, there is some experimental evidence to suggest that lack of apical constriction at the midline if important for proper neural tube closure. Brooks ER, et al. (2020) eLife shows that a truncated Ift122 mutant, leads to abnormal constriction of the midline cells but does not disrupt lateral cell apical constriction, leading to a failure in brain neural tube closure in these embryos. Ift122 regulates trafficking and signaling proteins in cilia, which in turn regulates Sonic hedgehog signaling which Brooks ER, et al. also demonstrates regulates apical constriction. While this disruption is clearly multifaceted and nuanced, it provides some genetic support for the lack of apical constriction at the midline being important for neural tube closure.



      Major Comments

      Figure quality. Figure 1 contains very low-resolution images, which makes it difficult to evaluate the segmentation quality and tissue morphology. Higher-resolution versions should be provided.

      In Figure 1, we outline the conceptual strategy and approach used to create and analyze shell projections of the curved neural tube. As much of our analysis builds from segmentation of cells in the projections, being able to assess segmentation quality from high resolution images is critical to evaluating the quality of the data shown. As discussed in comment #2, we will create a supplement to Figure 1 to demonstrate the accuracy of the segmentation. This will include high resolution images of both the label used to segment and the resulting segmentation, with corresponding overlays.

      Cell segmentation strategy and validation. The authors segment cell areas using Myosin II and F-actin signals. This approach may introduce inaccuracies, as actomyosin cables can traverse the apical surface of individual cells and do not always coincide with cell boundaries. Segmentation based on junctional markers such as ZO-1 may be more appropriate. At minimum, the authors should provide a quantitative validation of segmentation accuracy, for example by overlaying segmentation results on raw images together with a nuclear marker (e.g., DAPI or H2B-GFP), to demonstrate that the number of segmented cells corresponds to the number of nuclei.

      We will provide a supplement to Figure 1 to demonstrate the accuracy of the segmentation. We have used F-Actin to segment cells in our images. F-actin is enriched along junctions but cells can also have medial pools and F-actin cables, which might lead to errors. Though we understand the reviewer’s logic in asking to align segmentations with marked nuclei, the morphology of the neural epithelium makes this approach infeasible. The neural epithelium is pseudostratified, and nuclear position varies along the apical-basal axis depending on the cell cycle phase of each cell. As a result, an apical shell projection of nuclei would not capture all nuclei and a maximum intensity projection in Z of all nuclei would be uninterpretable as there would be substantial XY overlap between nuclei. Instead, we will create a supplement to Figure 1 to demonstrate the accuracy of the segmentation as discussed in comment #2. We will segment samples stained for both F-Actin and junctional markers like ZO-1. We will then create overlays of the resulting cell outlines and a cell area frequency plot for both segmentations to evaluate if F-actin based segmentation deviates from tight junction-based segmentation.

      Lack of cross-sectional views of neural tube morphology. The manuscript would benefit from the inclusion of cross-sectional images of the neural tissue at different developmental stages. This would serve two purposes: (i) to demonstrate that the authors have a comprehensive understanding of the full three-dimensional folding process during neural tube closure, including medial and lateral hinge formation, and (ii) to allow readers to visualize the tissue geometry corresponding to the analyzed projection datasets (e.g., at 5 ss and 8 ss).

      A key component of our model states that the changes in cell-level morphology and features correspond to changes in tissue level morphology (Figure 6). Specifically, that lateral apical constriction coincides with the flattening and elevation of the dorsal bulges on the lateral neural folds. We agree that it is beneficial to include additional visuals of tissue morphology. We plan to add an additional figure at the start of manuscript that details both the dorsal and relevant cross-sectional views of the somite stages analyzed. These visuals will take the form of graphical illustrations along with 3D confocal microscopy images and optical reconstructions of samples.

      Sex-specific differences in overall neural plate morphology. The authors report that at 5 ss, males consistently have larger apical cell areas than females. It is unclear whether this difference reflects a global difference in neural plate morphology. Showing representative images of female and male neural plates would help readers directly assess whether there are overt morphological differences beyond those revealed by quantitative analysis.

      If one sex has larger cells than the other, it would be reasonable to expect that the neural folds may be wider as well. In Figure 2B-C, we show representative images of male embryos at 5 and 8 ss. As part of the additions we indicated in comment #19, we will also include dorsal and cross-sectional views of both male and female embryos at the stages analyzed. If there is a difference in tissue morphology between sexes, we will also quantify these differences in tissue size, curvature, etc.

      Cell number analysis. The authors state, based on prior literature, that cell numbers do not change between 5 and 8 ss. Given that the tissue is already segmented in the current study, this claim should be directly verified using the authors' own data. This analysis should be straightforward and would strengthen the conclusions.

      We agree and will determine the number of cells analyzed for each embryo to test if there are changes in cell numbers at different stages and between sexes, along with appropriate statistical tests.

      Relation between tissue curvature and cellular properties. It would be highly informative to extract the three-dimensional morphology of the neural plate, in particular its curvature, and examine how curvature correlates with two-dimensional cell anisotropy, apical area, and F-actin/Myosin intensity. For example, at 8 ss the authors report a U-shaped dependence of cell area along the mediolateral axis. How does this pattern relate to local tissue curvature?

      We agree with this assessment and will create optical reslices in the midbrain adjacent to but excluding the midbrain hindbrain boundary. We will then divide the apical surface into 10% bins and fit a circle to the apical surface of the neural epithelium in each to calculate the local radius of curvature, which is the reciprocal of curvature for the surface. We can then correlate these values with two-dimensional cell shape and actomyosin density metrics.

      Visualization of sex differences in medial actin levels (Figure 3). In Figure 3, the reported female-male difference in medial actin levels would benefit from visualization of the raw data. A zoomed-in inset of the midline region, shown separately for females and males, would help substantiate this claim.

      In Figure 3, we demonstrate patterns of the whole-cell apical F-actin (Fig. 3A, B) and Myosin IIB (Fig. 3C, D) density. We find that there is no difference in F-Actin density between males and females (Fig. 3E, F), but a significant difference in midline Myosin IIB density at 5 ss that is mostly absent by 8 ss (Fig. 3G, H). We currently provide representative images for female and male myosin IIB expression across the midline-lateral axis in Figure 3C, D, and Figure 3-Supplement 1C and D. We can provide a close-up image of Myosin IIB in the midline region for both sexes as part of Figure 3, with additional annotations on existing representative image to indicate their origin.

      Typographical error. Line 143: please correct "cell are" to "cell area".

      We thank the reviewer for pointing out this error and will correct this typo and perform additional editing to correct any other typos present in the manuscript.

      Quantitative correlation analysis between cell area and actomyosin. The authors qualitatively discuss the relationship between cell area dynamics and actomyosin levels. It would strengthen the analysis to directly compute and report correlations between these variables, and to explicitly test whether actin and myosin levels are anti-correlated with apical cell area.

      As discussed in comment #6, we will plot cell area vs. F-actin or Myosin IIB density for each embryo and fit a line to calculate their correlation coefficient. From there, we will determine if there is a negative correlation between cell area and actomyosin intensity.

      Interpretation of anti-correlation and contractile hinge mechanism. In lines 143-157, the authors state that the observed anti-correlation between actomyosin and cell area argues against a contractile hinge mechanism. However, this anti-correlation could also suggest that apical cell area is determined by local mechanical or geometric constraints rather than by local actomyosin contractility. The authors should clarify and discuss this alternative interpretation.

      Within the neural epithelium of mice and other vertebrates, F-actin and myosin-IIB are enriched on the apical surface relative to other regions of the cell (Sadler TW, et al. (1982) Science, Matsuda M., et al. (2023), Nat. Communication, Röper, K. (2013) BioArchitecture). This poises the actomyosin network to be able to selectively constrict the apical surface relative to the basal side of the cells. Apical constriction is observed to actively facilitate the formation of hinges in folding tissues (Chanet S, et al. (2017), Nature Communications, Nishimura T., et al. (2012) Cell, Chistrodoulou N., et al. (2015) Cell Reports) in what we term the contractile hinge model of tissue folding. Tissues that employ this model of folding are expected to have small apical areas and apical enrichment of contractile actomyosin at the hinge point during folding. We observe large apical areas, low apical actomyosin density, and low apical tension at the midline hinge of the mouse midbrain neural tube, which are all inconsistent with a contractile hinge mechanism being employed in this tissue folding process. We agree with the reviewer that “cell shape does not always match [acto]myosin contractility levels, because cell shape depends on extrinsic, as well as intrinsic forces” (Line 147-149). We also agree that anticorrelation of actomyosin density and apical cell area does not per se argue against the contractile hinge model and will amend our language to be clearer. We will also further elaborate on potential extrinsic factors that may lead to the observed cell behaviors at the midline in the discussion.

      Statistical robustness of laser ablation results (Figure 4). The differences in recoil velocity between regions appear small, with substantial overlap between the distributions. In addition, the sample sizes for lateral versus midline ablations appear unequal (with visibly more data points in the lateral condition). These factors raise concerns about the robustness and statistical significance of the reported differences, which should be addressed more carefully.

      In Figure 4E, we show initial recoil velocities binned only by region: lateral vs. midline and report a 3.03 μm/s vs. 2.40 μm/s, or 26% difference between the two regions. We then show in Figure 4G that by considering another relevant variable, sex, we find initial recoil to be 3.15 μm/s vs. 2.30 μm/s, or 37% difference in females and 2.68 μm/s vs. 2.57 μm/s, or 4% difference in males. We go on to show In Figure 5L that within the lateral region that recoils also vary by direction, with a 38% difference. Ultimately the final conclusions that we draw regarding tissue tension that we present in our model are derived from the most finely disaggregated data in Figure 5. Our goal in presenting a stepwise disaggregation of the data was to demonstrate which variables had the greatest impact on the variance within our data set. We agree with the reviewer that a more precise statistical analysis of this data set is warranted that accounts for the complexity and multitude of variables that can influence our conclusions. In addition to the power analysis described in comment #10, we plan to conduct a mixed-effect model analysis of our data that considers factors including sex, age, cut direction, cut region, cut number, and embryos to determine which factors explain the most variance in the population. We will add this analysis as a supplement to Figure 4 alongside a description of the tests performed in the Statistical Analysis section of the methods. We will also adjust our language in the text to clearly state the limitations of the data as presented and qualify conclusions as appropriate.

      Speculative statement regarding anisotropic tension in males. Line 278: "We believe that both sexes demonstrate anisotropic tension, given that males have cell aspect ratios and orientations in the lateral neural folds similar to females." This statement is speculative. Either anisotropic tension in males should be directly measured and reported, or this statement should be removed.

      As discussed in comment # 15, in Figure 5L, though we can observe a difference in the initial recoil velocity means, we are unable to detect a statistical difference. Ablations were conducted blinded to embryo sex, but fewer male embryos were suitable for ablation because males develop faster than their female littermates (Seller MJ. and Perkins-Cole KJ. (1987) J. Reprod. Fert.). We were therefore unable to obtain more males in our data set. At present we do not have the resources to perform additional laser ablations to supplement the existing data set. We will instead perform a power analysis for our anisotropy measurements in the lateral region of the tissue to determine if: 1) we have a sample size large enough to detect a biologically-meaningful difference with suitable power, 2) the sample size required to detect the observed difference is so large that the difference would not be biologically meaningful, or 3) we do not have a sample size large enough to detect a difference confidently. With the results of this analysis, we will amend our language in the text to reflect the most accurate claims that can be made.

      Reviewer #2 (Significance (Required)):

      This study provides high-quality measurements of apical cell geometry, actomyosin organization, and inferred tension in the mouse neural epithelium. However, the lack of direct perturbations, mechanical modeling, and quantitative analysis of three-dimensional tissue deformation limits the strength of the mechanistic conclusions. Addressing these gaps would substantially strengthen the manuscript and clarify the causal role of apical tension patterns in neural fold formation. At the end of the day, the authors suggest an hypothesis that is not well support by their data, which is of high quality.

      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      Summary

      This manuscript by De La O et al addresses a long-standing question of how actomyosin contributes mechanically to cranial neural tube elevation in the mouse, a system in which classical midline contractile hinge models appear insufficient. The authors develop an image-processing and analysis pipeline that enables reconstruction and quantitative analysis of the apical actomyosin network across the large, curved dorsal surface of the mouse brain neuroepithelium. Using this approach, combined with laser ablation-based tension measurements in live embryos, they report a medio-lateral gradient of apical cell area and an inverse gradient of actomyosin density. Contrary to contractile hinge models described in frog, chick and invertebrate systems, they find that the midline exhibits low, isotropic tension, while the lateral neural folds show higher anisotropic apical tension, consistent with their proposal of a "lateral tension" mechanism for neural tube elevation.

      The work provides an important reframing of actomyosin function in mammalian cranial neurulation, supported by extensive quantitative imaging and mechanical measurements. The finding that lateral, rather than midline, actomyosin networks dominate tissue tension is compelling and helps reconcile previous observations that midline hinge formation in mouse can proceed despite actomyosin perturbation. The study is technically sophisticated and addresses a biologically important process with clear relevance to neural tube defect etiology. However, several aspects of the statistical treatment, interpretation of laser ablation data, and mechanistic framing require clarification or tempering to fully support the authors' conclusions.

      Major comments

      Statistical unit and pseudo-replication in cell-based analyses (Figures 2-3)

      In Figures 2 and 3, it is unclear whether statistical comparisons were performed at the level of individual cells or embryos. Because cells are nested within embryos, treating cells as independent observations raises concerns about pseudo-replication and inflated statistical significance, particularly for sex-dependent effects. While the color-coded maps are visually compelling, they may overstate confidence in differences between conditions if embryo-to-embryo variability is not explicitly accounted for.

      Clarification is needed as to whether statistical testing was performed on embryo-level summary values (e.g., one value per embryo per positional bin), or whether hierarchical or mixed-effects models were used with embryo treated as a random effect. Providing embryo-level summary plots would also help readers assess inter-embryo variability. Addressing this point is important for confidence in both the reported medio-lateral gradients and the sex differences.

      We agree with the reviewer that it is inappropriate to calculate statistics based on measurements of individual cells. As indicated under the ‘Statistical Analysis and Figure Assembly’ section of our methods “For fixed images, cell shape and protein intensity analysis (Figure 2H-J, Figure 3E-H, Figure 5E-H), N = 5 embryos for all conditions and n, or the number of cells in each 10% bin, is ≥ 150 cells for each embryo” (Line 556 – 558). The average and SD between embryos are shown in these plots and is calculated at the embryo level, not the cell level. We chose to consolidate this information in the methods section as the same data set is used across the three figures. We will add a line to the figure captions that N values for all experiments can be found in this section of the methods. We will also provide supplementary plots showing the bin averages for each individual embryo, color coded by embryo to show the distribution of the data set.

      Interpretation of actomyosin density as a proxy for contractility (Figure 3)

      The descriptive correlation between apical cell area and actomyosin density is clear and consistent. However, actomyosin abundance alone does not necessarily equate to force generation, particularly in the absence of measurements of myosin activation state (e.g., pMLC), actomyosin dynamics, or direct perturbations linking actomyosin levels to mechanical output. Although the authors appropriately note that cell shape does not always reflect intrinsic contractility, actomyosin density is nevertheless used to argue against a contractile hinge mechanism.

      While the subsequent laser ablation experiments address tissue tension more directly, the mechanistic conclusions drawn from actomyosin density measurements alone would benefit from more careful qualification. Tempering language that equates actomyosin enrichment with contractile output, or explicitly acknowledging these limitations, would strengthen the interpretation.

      It is largely believed that apical pools of actomyosin are active and that apical localization of actomyosin is dependent on activation. Shroom3, an actin-binding protein, is localized to the apical adherens junctions in the neural tube (Haigo SL., et al. (2003) Curr. Biol., Hildebrand JD. and Soriano P. (1999) Cell), where it can recruit Rho kinases (ROCKs) that in turn phosphorylate and activate Myosin IIB (Nishimura T. and Takeichi M. (2008) Dev.). Mutations in Shroom3 lead to neural tube close defects and its overexpression in the neural tube can induce apical constriction and increased apical accumulation of Myosin II tube (Haigo SL., et al. (2003) Curr. Biol., Hildebrand JD. (2005) J. Cell Sci.). In the mouse neural tube, Myosin IIB intensity is greater in cells that can apically constrict than in those that cannot constrict (Galea GL., et al. (2021) Nat Commun). Additionally, inhibition of ROCK reduces apical tension, presumably by reduction of activated Myosin II (Butler MB., et al. (2019) J. Cell Sci.). We agree with the reviewer’s assessment that to definitively state that the apical pools of Myosin IIB and F-actin are promoting apical contractility, a demonstration of the phosphorylation state of the Myosin II regulatory light chain (pMLC) or observations/perturbations in live embryos is necessary. We will adjust our language to reflect this limitation. We will also provide information on the relationship between apically localized actomyosin and contractility.

      Statistical and biological independence of laser ablation measurements (Figures 4-5)

      The Methods indicate that 155 laser ablations were analyzed across 71 embryos, implying that multiple ablations were performed per embryo. It would be helpful to clarify how this hierarchical data structure was handled statistically. Specifically, were recoil velocities averaged per embryo, paired with embryos for ML vs. RC comparisons, or analyzed using hierarchical/mixed-effects models?

      Our laser ablation data set captures variables including embryo sex, age, cut location, cut direction, and cut number. Therefore, we did not feel it appropriate to average recoils within the same embryo as these cuts were intentionally in different regions (lateral vs midline) or in different orientations (i.e. a rostral-caudal cut and midline-lateral cut on opposite lateral folds), which our analysis has shown would lead to averaging out potential differences. Ablations were far apart from each other, and we had checked that ablation order did not predict changes in recoil. However, we agree with the reviewer that a more precise statistical analysis of this data set is warranted that accounts for the complexity of variables potentially influencing initial recoil velocities. As discussed in comment #27, we plan to conduct a mixed-effect model analysis of our data that considers the above and add this analysis as a supplement to figure 4. We will include a description of this in the methods and our language in the text to clearly state the limitations of the data as presented and qualify conclusions as appropriate.

      In addition, embryos were subjected up to 5 ablations within a short time window. Because laser ablation disrupts tissue integrity and can induce rapid cytoskeletal remodeling, it is unclear whether later ablations represent independent measurements of the native tension state. Clarification is needed regarding whether the authors tested for effects of ablation order (e.g., first vs. later cuts), ensured sufficient spatial separation between ablation sites, or verified that repeated ablations did not systematically alter recoil measurements. Demonstrating that initial recoil velocity is independent of cut number would substantially strengthen confidence in the mechanical conclusions.

      We agree with the reviewer that laser ablations cause disruptions to tissue, and these disruptions can impact the results of additional ablations performed near the site of prior ablations. The average embryo in our data set has three ablations: one on either neural fold and one at the midline, with hundreds of µm distances from each other. In embryos that had more than 3 ablations made far away from each other (additional ablations were performed in the hindbrain rhombomeres, rhombomere boundaries, at the neuroepithelium and surface ectoderm boundary, or at the zipper point, but n numbers of these are insufficient for analysis). We will supplement the methods text describing the laser ablations to clarify this for readers. Additionally, after an ablation, displacement is not detectable further than 3-5 cell lengths away from the cut even after several seconds post ablation. We will provide visual examples of these cuts after ablation to demonstrate this phenomenon. As discussed in comment #27 and #32, we will also perform mixed-effect modeling to determine if cut number impacts observed initial recoil velocities. We will also provide plots demonstrating relevant examples of these comparisons (e.g. sequential lateral cuts made in the same direction).

      Interpretation of sex-dependent tension differences (Figures 4-5)

      Figure 4 shows a clear lateral-greater-than-midline tension difference in females, whereas this pattern is not detected in males under initial analysis. Later, Figure 5 reveals directional anisotropy in the lateral neural folds of both sexes. As currently framed, this creates some ambiguity regarding whether the proposed lateral tension mechanism is sex-specific, sex-biased in magnitude, or sex-general but masked by directional averaging in males.

      Clarifying this distinction, both in figure presentation and in the text, would strengthen the mechanistic interpretation and prevent confusion. In particular, it would be helpful to more clearly explain how directional anisotropy reconciles the apparent absence of regional tension differences in males in Figure 4.

      We appreciate the reviewer taking the time to indicate this point of confusion. We ultimately conclude that the lateral tension model of neural tube elevation is agnostic of sex. Though there are nuanced differences in some of the details regarding Myosin IIB density, midline apical constriction and tension anisotropy, we do not believe these differences would fundamentally change the mechanical model used between sexes. With specific regards to masking of the lateral neural fold tension in males, we briefly address this in the discussion: “The averaging of [Rostra-Caudal] and [Midline-Lateral] [Initial Recoil Velocities] likely masked tension differences between the midline hinge and lateral neural folds, creating the false impression that males did not have high tension on the lateral neural folds” (Line 280-282). We will adjust the text in the results and discussion section to clearly indicate that are lateral tension model applies to both sexes, though some differences in specific details exist, and that averaging may have led to the result in Figure 4G.

      Causal overreach in mechanistic interpretation of anisotropic tension

      While the laser ablation data convincingly demonstrates spatial and directional differences in recoil consistent with patterned mechanical anisotropy, the manuscript frequently treats anisotropic apical tension as a mechanistic explanation for neural tube elevation. The presented experiments do not directly test whether anisotropic apical tension is necessary or sufficient for tissue bending, nor whether isotropic tension at the midline plays a causal role. Initial recoil velocity reflects not only pre-existing tension but also tissue geometry and viscoelastic properties, which may differ between midline and lateral regions.

      As such, statements suggesting that anisotropic lateral tension "explains" neural fold elevation should be tempered or reframed. The data strongly support spatial patterning of mechanical properties but do not yet establish causal primacy. Recasting the model as a mechanically consistent framework rather than a definitive mechanism would better align conclusions with the data.

      Our lateral tension model proposes that a regionalized difference in tension, with high tension in the lateral neural folds and low tension at the midline, is needed to enable neural tube elevation and ultimate closure. We agree with the reviewer, our work demonstrates that the results of our laser ablation experiments, along with measurements of cell shapes and protein density, are consistent with the lateral tension model that we propose. Our model is also supported by past work that shows that perturbations that disrupt actomyosin contractility leads to defects in brain neural tube elevation and closure but not midline hinge formation. For example, chemical perturbation of actin polymerization with Cytochalasin D (Ybot-Gonzalez P. and Copp AJ. (1999) Dev. Dyn), and genetic perturbations of Shroom 3, which apically localizes actomyosin (Hildebrand JD. And Soriano P. (1999) Cell) or Fhod3, which promotes actin polymerization (Sulistomo HW, et al. (2019) J. Biol. Chem.) all have brain neural tube closure defects but form a midline hinge. However, since we do not directly perturb tension, we have only demonstrated consistency rather than causality or sufficiency. We will adjust and temper our language accordingly in the relevant sections of the results and discussion.

      Minor comments

      Manuscript length and clarity

      The manuscript is longer and more complex than necessary for its central message. Several sections of the Results, particularly methodological validation and somite-stage stratification, could be streamlined.

      We agree with the reviewer and will continue editing the manuscript, prioritizing clarity, brevity, and precision of language so that readers are able to quickly understand the key points of the manuscript.

      Sex differences section

      The section on sex differences is interesting but somewhat tangential. Clarifying whether these findings are intended as mechanistic insight or observational motivation for future work could improve focus.

        We intended this section to offer up perspectives that inform and motivate future work to continue to track, analyze, and report on sex difference during development. We will edit this section of the discussion to improve clarity and brevity so that the reader can easily acquire this takeaway. Sex differences in the penetrance of exencephaly is an active area of research and our manuscript provides the first cell-level measurements which will guide the field in disaggregating future analyses by embryo sex.
      
    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary

      This manuscript by De La O et al addresses a long-standing question of how actomyosin contributes mechanically to cranial neural tube elevation in the mouse, a system in which classical midline contractile hinge models appear insufficient. The authors develop an image-processing and analysis pipeline that enables reconstruction and quantitative analysis of the apical actomyosin network across the large, curved dorsal surface of the mouse brain neuroepithelium. Using this approach, combined with laser ablation-based tension measurements in live embryos, they report a medio-lateral gradient of apical cell area and an inverse gradient of actomyosin density. Contrary to contractile hinge models described in frog, chick and invertebrate systems, they find that the midline exhibits low, isotropic tension, while the lateral neural folds show higher anisotropic apical tension, consistent with their proposal of a "lateral tension" mechanism for neural tube elevation.

      The work provides an important reframing of actomyosin function in mammalian cranial neurulation, supported by extensive quantitative imaging and mechanical measurements. The finding that lateral, rather than midline, actomyosin networks dominate tissue tension is compelling and helps reconcile previous observations that midline hinge formation in mouse can proceed despite actomyosin perturbation. The study is technically sophisticated and addresses a biologically important process with clear relevance to neural tube defect etiology. However, several aspects of the statistical treatment, interpretation of laser ablation data, and mechanistic framing require clarification or tempering to fully support the authors' conclusions.

      Major comments

      1. Statistical unit and pseudo-replication in cell-based analyses (Figures 2-3) In Figures 2 and 3, it is unclear whether statistical comparisons were performed at the level of individual cells or embryos. Because cells are nested within embryos, treating cells as independent observations raises concerns about pseudo-replication and inflated statistical significance, particularly for sex-dependent effects. While the color-coded maps are visually compelling, they may overstate confidence in differences between conditions if embryo-to-embryo variability is not explicitly accounted for.

      Clarification is needed as to whether statistical testing was performed on embryo-level summary values (e.g., one value per embryo per positional bin), or whether hierarchical or mixed-effects models were used with embryo treated as a random effect. Providing embryo-level summary plots would also help readers assess inter-embryo variability. Addressing this point is important for confidence in both the reported medio-lateral gradients and the sex differences. 2. Interpretation of actomyosin density as a proxy for contractility (Figure 3) The descriptive correlation between apical cell area and actomyosin density is clear and consistent. However, actomyosin abundance alone does not necessarily equate to force generation, particularly in the absence of measurements of myosin activation state (e.g., pMLC), actomyosin dynamics, or direct perturbations linking actomyosin levels to mechanical output. Although the authors appropriately note that cell shape does not always reflect intrinsic contractility, actomyosin density is nevertheless used to argue against a contractile hinge mechanism.

      While the subsequent laser ablation experiments address tissue tension more directly, the mechanistic conclusions drawn from actomyosin density measurements alone would benefit from more careful qualification. Tempering language that equates actomyosin enrichment with contractile output, or explicitly acknowledging these limitations, would strengthen the interpretation. 3. Statistical and biological independence of laser ablation measurements (Figures 4-5) The Methods indicate that 155 laser ablations were analyzed across 71 embryos, implying that multiple ablations were performed per embryo. It would be helpful to clarify how this hierarchical data structure was handled statistically. Specifically, were recoil velocities averaged per embryo, paired with embryos for ML vs. RC comparisons, or analyzed using hierarchical/mixed-effects models?

      In addition, embryos were subjected up to 5 ablations within a short time window. Because laser ablation disrupts tissue integrity and can induce rapid cytoskeletal remodeling, it is unclear whether later ablations represent independent measurements of the native tension state. Clarification is needed regarding whether the authors tested for effects of ablation order (e.g., first vs. later cuts), ensured sufficient spatial separation between ablation sites, or verified that repeated ablations did not systematically alter recoil measurements. Demonstrating that initial recoil velocity is independent of cut number would substantially strengthen confidence in the mechanical conclusions. 4. Interpretation of sex-dependent tension differences (Figures 4-5) Figure 4 shows a clear lateral-greater-than-midline tension difference in females, whereas this pattern is not detected in males under initial analysis. Later, Figure 5 reveals directional anisotropy in the lateral neural folds of both sexes. As currently framed, this creates some ambiguity regarding whether the proposed lateral tension mechanism is sex-specific, sex-biased in magnitude, or sex-general but masked by directional averaging in males.

      Clarifying this distinction, both in figure presentation and in the text, would strengthen the mechanistic interpretation and prevent confusion. In particular, it would be helpful to more clearly explain how directional anisotropy reconciles the apparent absence of regional tension differences in males in Figure 4. 5. Causal overreach in mechanistic interpretation of anisotropic tension While the laser ablation data convincingly demonstrates spatial and directional differences in recoil consistent with patterned mechanical anisotropy, the manuscript frequently treats anisotropic apical tension as a mechanistic explanation for neural tube elevation. The presented experiments do not directly test whether anisotropic apical tension is necessary or sufficient for tissue bending, nor whether isotropic tension at the midline plays a causal role. Initial recoil velocity reflects not only pre-existing tension but also tissue geometry and viscoelastic properties, which may differ between midline and lateral regions.

      As such, statements suggesting that anisotropic lateral tension "explains" neural fold elevation should be tempered or reframed. The data strongly support spatial patterning of mechanical properties but do not yet establish causal primacy. Recasting the model as a mechanically consistent framework rather than a definitive mechanism would better align conclusions with the data.

      Minor comments

      1. Manuscript length and clarity The manuscript is longer and more complex than necessary for its central message. Several sections of the Results, particularly methodological validation and somite-stage stratification, could be streamlined.
      2. Sex differences section The section on sex differences is interesting but somewhat tangential. Clarifying whether these findings are intended as mechanistic insight or observational motivation for future work could improve focus.

      Significance

      General assessment.

      This study provides a technically sophisticated and carefully executed analysis of the mechanical organization of the mouse cranial neural epithelium during neural tube elevation. Its principal strengths lie in the development of a large-scale apical imaging and reconstruction pipeline, the quantitative mapping of medio-lateral gradients in cell shape and actomyosin organization, and the use of laser ablation to directly probe regional and directional tissue tension in live embryos. Together, these approaches allow the authors to address a long-standing discrepancy between classical contractile hinge models and prior observations in mouse neurulation. The main limitations of the study relate not to data quality, but to interpretation: several conclusions rely on correlational relationships between actomyosin enrichment, cell shape anisotropy, and tissue tension, and the mechanistic language at times exceeds what is directly tested. Clarification of statistical structure and tempering of causal claims would substantially strengthen the work.

      Advance.

      Relative to prior studies of neural tube closure in frog, chick, and invertebrate systems, this work advances the field by providing direct, spatially resolved measurements of tissue tension in the mouse cranial neural tube. The identification of low, largely isotropic tension at the midline and higher, anisotropic tension in the lateral neural folds represents a conceptual advance that reframes how actomyosin contributes to mammalian neurulation. While the study does not establish causality between anisotropic apical tension and tissue bending, it offers a mechanically consistent alternative to contractile hinge models and provides a valuable framework for interpreting species-specific differences in neural tube morphogenesis. The advance is therefore primarily conceptual and technical, rather than mechanistic in the strict causal sense.

      Audience.

      This work will be of strong interest to a specialized but broad audience spanning developmental biology, epithelial mechanics, morphogenesis, and neural tube defect research. The imaging and analytical approaches are likely to be useful beyond neurulation, particularly for investigators studying force patterning in large, curved epithelial tissues. With appropriate framing, the study should also be of interest to researchers investigating the biomechanical basis of congenital defects, even if its immediate implications are primarily basic rather than translational.

      Field of expertise.

      My expertise lies in epithelial morphogenesis, tissue mechanics, actomyosin-based force generation, and quantitative imaging in developmental systems. I do not have specific expertise in clinical aspects of neural tube defect diagnosis or treatment.

    1. Art. 394.
      • Em síntese, o depósito judicial integral não afasta os efeitos da mora, a qual somente é sustada com o efetivo recebimento do numerário pelo credor. Não é responsabilidade do Judiciário ou do banco depositário arcar com os consectários legais decorrentes de título executivo

      Tema Repetitivo nº 677:

      na execução, o depósito efetuado a título de garantia do juízo ou decorrente da penhora de ativos financeiros não isenta o devedor do pagamento dos consectários de sua mora, conforme previstos no título executivo, devendo-se, quando da efetiva entrega do dinheiro ao credor, deduzir do montante final devido o saldo da conta judicial

      4. Nos termos dos arts. 394 e 395 do Código Civil, considera-se em mora o devedor que não efetuar o pagamento na forma e tempos devidos, hipótese em que deverá responder pelos prejuízos a que sua mora der causa, mais juros e atualização dos valores monetários, além de honorários de advogado. A mora persiste até que seja purgada pelo devedor, mediante o efetivo oferecimento ao credor da prestação devida, acrescida dos respectivos consectários (art. 401, I, do CC/02).

      5. A purga da mora, na obrigação de pagar quantia certa, assim como ocorre no adimplemento voluntário desse tipo de prestação, não se consuma com a simples perda da posse do valor pelo devedor; é necessário, deveras, que ocorra a entrega da soma de valor ao credor, ou, ao menos, a entrada da quantia na sua esfera de disponibilidade.

      6. No plano processual, o Código de Processo Civil de 2015, ao dispor sobre o cumprimento forçado da obrigação, é expresso no sentido de que a satisfação do crédito se dá pela entrega do dinheiro ao credor, ressalvada a possibilidade de adjudicação dos bens penhorados, nos termos do art. 904, I, do CPC.

      7. Ainda, o CPC expressamente vincula a declaração de quitação da quantia paga ao momento do recebimento do mandado de levantamento pela parte exequente, ou, alternativamente, pela transferência eletrônica dos valores (art. 906).

      8. Dessa maneira, considerando que o depósito judicial em garantia do Juízo - seja efetuado por iniciativa do devedor, seja decorrente de penhora de ativos financeiros - não implica imediata entrega do dinheiro ao credor, tampouco enseja quitação, não se opera a cessação da mora do devedor. Consequentemente, contra ele continuarão a correr os encargos previstos no título executivo, até que haja efetiva liberação em favor do credor.

      9. No momento imediatamente anterior à expedição do mandado ou à transferência eletrônica, o saldo da conta bancária judicial em que depositados os valores, já acrescidos da correção monetária e dos juros remuneratórios a cargo da instituição financeira depositária, deve ser deduzido do montante devido pelo devedor, como forma de evitar o enriquecimento sem causa do credor.

      10. Não caracteriza bis in idem o pagamento cumulativo dos juros remuneratórios, por parte do Banco depositário, e dos juros moratórios, a cargo do devedor, haja vista que são diversas a natureza e finalidade dessas duas espécies de juros.

    1. Author response:

      The following is the authors’ response to the original reviews.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      An interesting manuscript from the Carrington lab is presented investigating the behavior of single vs double GPI-anchored nutrient receptors in bloodstream form (BSF) T. brucei. These include the transferrin receptor (TfR), the HpHb receptor (HpHbR), and the factor H receptor (FHR). The central question is why these critical proteins are not targeted by host-acquired immunity. It has generally been thought that they are sequestered in the flagellar pocket (FP), where they are subject to rapid endocytosis - any Ab:receptor complexes would be rapidly removed from the cell surface. This manuscript challenges that assumption by showing that these receptors can be found all over the outer cell body and flagella surfaces, if one looks in an appropriate manner (rapid direct fixation in culture media).

      The main part of the manuscript focuses on TfR, typically a GPI1 heterodimer of very similar E6 (GPI anchored) and E7 (truncated, no GPI) subunits. These are expressed coordinately from 15 telomeric expression sites (BES), of which only one can be transcribed at a time. The authors identify a native E6:E7 pair in BES7 in which E7 is not truncated and therefore forms a GPI2 heterodimer. By in situ genetic manipulation, they generate two different sets of GPI1:GPI2 TfR combinations expressed from two different BESs (BES1 and BES7). Comparative analyses of these receptors form the bulk of the data.

      The main findings are:

      (1) Both GPI1 and GPI2 TfR can be found on the cell body/flagellar surface.

      (2) Both are functional for Tf binding and uptake.

      (3) GPI2 TfR is expressed at ~1.5x relative to GPI1 TfR

      (4) Ultimate TfR expression level (protein) is dependent on the BES from which it is expressed.

      Most of these results are quite reasonably explained in light of the hydrodynamic flow model of the Engstler lab and the GPI valence model of the Bangs lab. Additional experiments, again by rapid fixation, with HpHbR and FHR, show that these GPI1 receptors can also be seen on the cell surface, in contrast to published localizations.

      It is quite interesting that the authors have identified a native GPI2 TfR. However, essentially all of the data with GPI2 TfR are confirmatory for the prior, more detailed studies of Tiengwe et al. (2017). That said, the suggestion that GPI2 was the ancestral state makes good evolutionary sense, and begs the question of why trypanosomes prefer GPI1 TfR in 14 of 15 ESs (i.e., what is the selection pressure?)

      Strengths and weaknesses:

      (1) BES7 TfR subunit genes (BES7_Tb427v10): There are actually three (in order 5'3'): E7gpi, E6.1 and E6.2. E6.1 and E6.2 have a single nucleotide difference. This raises the issue of coordinate expression. If overall levels of E6 (2 genes) are not down-regulated to match E7 (1 gene), this will result in a 2x excess of E6 subunits. The most likely fate of these is the formation of non-functional GPI2 homodimers on the cell surface, as shown in Tiengwe et al. (2017), which will contribute to the elevated TfR expression seen in BES7.

      We would like to thank the reviewer for pointing out that there are two ESAG6 genes in BES7, we had relied on the publicly available annotation and should have known better.

      For transferrin expression levels, see the discussion in response to reviewer 1 point 3 below

      (2) Surface binding studies: This is the most puzzling aspect of the entire manuscript. That surface GPI2 TfR should be functional for Tf binding and uptake is not surprising, as this has already been shown by Tiengwe et al. (2017), but the methodology for this assay raises important questions. First, labeled Tf is added at 500 nM to live cells in complete media containing 2.5 uM unlabeled Tf - a 5x excess. It is difficult to see how significant binding of labeled TfR could occur in as little as 15 seconds under these conditions.

      The k<sub>on</sub> for transferrin is very rapid (BES1 TfR / bovine transferrin at pH7.4 = 4.5 x 10<sup>5</sup> M<sup>-1</sup>s<sup>-1</sup> (Trevor et al., 2019) and binding would occur to unoccupied receptors within 15 sec. The k<sub>off</sub> is also fast (BES1 TfR / bovine transferrin at pH7.4 = 3.6 x 10<sup>-2</sup> s<sup>-1</sup> (Trevor et al., 2019) and there would be exchange of transferrin within the time taken for endocytosis. These values are in vitro with purified proteins, the in vivo values may be affected by the VSG coat.

      The failure to bind canine transferrin (Supp. Figure 4B) acts as a control for specificity of the interaction.

      We have now performed a competition experiment as an additional control; cells in culture were supplemented with: A, 0.5 µM labelled transferrin; B, 0.5 µM labelled and 2.5 µM unlabelled transferrin; C, 0.5 µM labelled and 5 µM unlabelled transferrin, fixed after 60 s and visualised by fluorescence microscopy (Figure S4C). There was effective competition and greatly reduced binding of transferrin was seen in the presence of a 10-fold excess of unlabelled. We would like to thank the reviewer for suggesting this experiment.

      Second, Tiengwe et al. (2017) found that trypanosomes taken directly from culture could not bind labeled Tf in direct surface labelling experiments. To achieve binding, it was necessary to first culture cells in serum-free media for a sufficient time to allow new unligated TfR to be synthesized and transported to the surface. This result suggests that essentially all surface TfR is normally ligated and unavailable to the added probe.

      As part of the preliminary experiments for this paper we found that centrifugation followed by resuspension in either complete or serum free (but 1% BSA) medium resulted in a reduction is total cellular TfR and determined by western blotting. We have now included this experiment (Figure S4D). The inference from this experiment is that centrifugation and subsequently incubation will have an effect on receptor detection and endocytosis rates for a discreet time period.

      The amount of binding of labelled transferrin to cells in culture will depend on the specific activity of the labelled transferrin. This reasoning was behind the use of 0.5 µM labelled transferrin when roughly 1 in 6 molecules in the culture medium are labelled and there was only a small effect on the overall concentration of transferrin.

      Third, the authors have themselves argued previously, based on binding affinities, that all surface-exposed TfR is likely ligated in a natural setting (DOI:10.1002/bies.202400053). Could the observed binding actually be non-specific due to the high levels of fixative used?

      The absence of binding/uptake of canine transferrin argues against a non-specific interaction. In our previous publication, we did not pay enough attention to the on and off rates which allow for a degree of exchange and, here, TfR newly appearing on the cell surface has a 1 in 6 chance of binding a labelled transferrin.

      (3) Variable TfR expression in different BESs: It appears that native TfR is expressed at higher levels from BES7 compared to BES1, and even more so when compared to BES3. This raises the possibility that the anti-TfR used in these experiments has differential reactivity with the three sets of TfRs. The authors discount this possibility due to the overall high sequence similarities of E6s and E7s from the various ESs. However, their own analyses show that the BES1, BES3, and BES7 TfRs are relatively distal to each other in the phylogenetic trees, and this Reviewer strongly suspects that the apparent difference in expression is due to differential reactivity with the anti-TfR used in this work. In the grand scheme, this is a minor issue that does not impact the other major conclusions concerning TfR localization and function, nor the behavior of HpHbR and FHR. However, the authors make very strong conclusions about the role of BESs in TfR expression levels, even claiming that it is the 'dominant determinant' (line 189).

      This point is valid but exceptionally difficult to address at the protein level. As an orthogonal approach, we performed RNAseq analysis of the ‘wild type’ BES1, BES3, and BES7 cell lines to determine whether differences in receptor mRNA levels were consistent with the proposed difference in protein levels (Table S1). The analysis showed total ESAG6/7 mRNA levels to vary in a similar manner to the protein estimates with BES3 < BES1 < BES7 providing support for the differences in protein levels.

      The strongest evidence for the expression site determining the TfR level is the comparison of the cell lines in which the VSG were exchanged. This had no effect on TfR levels and so there is no evidence that the identity of the VSG alters TfR expression.

      (4) Surface immuno-localization of receptors: These experiments are compelling and useful to the field. To explain the difference with essentially all prior studies, the authors suggest that typical fixation procedures allow for clearance of receptor:ligand complexes by hydrodynamic flow due to extended manipulation prior to fixation (washing steps). Despite the fact that these protocols typically involve ice-cold physiological buffers that minimize membrane mobility, this is a reasonable possibility. Have the authors challenged their hypothesis by testing more typical protocols themselves? Other contributing factors that could play a role are the use of deconvolution, which tends to minimize weak signals, and also the fact that investigators tend to discount weak surface signals as background relative to stronger internal signals.

      We have added preliminary experiments that compared fixation protocols in two parts. First the effect on TfR levels of washing and resuspending cells discussed above (Figure S4D), and second how different fixation protocols alter apparent TfR immunolocalisation (Supp Figure S5A-B). The comparison shows that both the absence of glutaraldeyde and the use of washing alters the outcome.

      (5) Shedding: A central aspect of the GPI valence model (Schwartz et al., 2005, Tiengwe et al., 2017) is that GPI1 reporters that reach the cell body surface are shed into the media because a single dimyristoylglycerol-containing GPI anchor does not stably associate with biological membranes. As the authors point out, this is a major factor contributing to higher steady-state levels of cell-associated GPI2 TfR relative to GPI1 TfR. Those studies also found that the size/complexity of the attached protein correlated inversely with shedding, suggesting exit from the flagellar pocket as a restricting factor in cell body surface localization. The amount of newly synthesized TfR shed into the media was ~5%, indicating that very little actually exits the FP to the outer surface. In this regard, is it possible to know the overall ratio of cell surface:FP:endosomal localized receptors? Could these data not be 'harvested' from the 3D structural illumination imaging?

      A ratio could be determined but we did not do this as it would only be valid if the antibody has equal access to the internal TfR in a diluted VSG environment and the external VSG embedded in a densely packed and cross-linked VSG layer As such, we would have no confidence in the accuracy of any estimate.

      Reviewer #2 (Public review):

      The work has significant implications for understanding immune evasion and nutrient uptake mechanisms in trypanosomes.

      While the experimental rigor is commendable, revisions are needed to clarify methodological limitations and to broaden the discussion of functional consequences.

      The authors argue that prior studies missed surface-localized TfR due to harsh washing/fixation (e.g., methanol). While this is plausible, additional evidence would strengthen the claim.

      Preliminary experiments that compared fixation protocols are now included to show that method affects outcome.

      It remains unclear how centrifugation steps of various lengths (as in previous publications) can equally and quantitatively redistribute TfR into the flagellar pocket. If this were the case, it should be straightforward for the authors to test this experimentally.

      Not aware of previous studies that demonstrate equal and quantitative redistribution to the flagellar pocket. In previous reports, there is variation in cell surface/flagellar pocket localisation depending on expression levels, for example (Mussmann et al., 2003) (Mussmann et al., 2004), it’s worth noting that the increase in TfR expression in these papers is similar to the difference in the cell lines used here. In addition, most report the presence of TfR in endosomal compartments. In the experiments here, there are cells where the majority of signal from labelled transferrin is present in the flagellar pocket and the argument is that this is a stage of a continuous process in which the receptor picks up a transferrin on the cell surface and is swept towards the pocket.

      If TfR is distributed over the cell surface, live-cell imaging with fluorescent transferrin should be performed as a control. Modern detection limits now reach the singlemolecule level, and transient immobilization of live trypanosomes has been established, which would exclude hydrodynamic surface clearance as a confounding factor.

      This is non-trivial and is a longer-term aim. The immobilisation involves significant manipulation of the cells prior to restraining.

      In most images, TfR is not evenly distributed on the surface but rather appears punctate. Could this reflect localization to membrane domains? Immuno-EM with high-pressure frozen parasites could resolve this question and is relatively straightforward.

      There is a non-uniform appearance in the super-resolution images for both TfR and FHR. We cannot distinguish whether this represents random variation in receptor density over the cell surface or results from a biological phenomenon. Whatever the cause, the experiments showed unambiguous cell surface localisation.

      The authors might consider discussing whether differences in parasite life cycle stages (procyclic versus bloodstream forms) or culture conditions (e.g., cell density) affect localization. The developmentally regulated retention of GPI-anchored procyclin in the flagellar pocket might be worth mentioning.

      The aim of this paper was to determine the localisation of receptors in proliferating bloodstream form trypanosomes in culture. TfR and HpHbR are not expressed in insect stages in culture. FHR is expressed in insect stages and is present all over the cell surface (Macleod et al., 2020). A procyclin-based reporter was distributed over the whole cell surface in one report (Schwartz et al. 2005). In other reports, the retention of procyclin in the flagellar pocket of proliferating bloodstream forms is probably dependent on structure/sequence as other single GPI-anchored proteins, such as FHR (Macleod et al., 2020) and GPI-anchored sfGFP (Martos-Esteban et al., 2022) can access the surface.

      References:

      MacGregor, P., Gonzalez-Munoz, A. L., Jobe, F., Taylor, M. C., Rust, S., Sandercock, A. M., Macleod, O. J. S., Van Bocxlaer, K., Francisco, A. F., D’Hooge, F., Tiberghien, A., Barry, C. S., Howard, P., Higgins, M. K., Vaughan, T. J., Minter, R., & Carrington, M. (2019). A single dose of antibody-drug conjugate cures a stage 1 model of African trypanosomiasis. PLoS Neglected Tropical Diseases, 13(5), e0007373. https://doi.org/10.1371/journal.pntd.0007373

      Macleod, O. J. S., Bart, J.-M., MacGregor, P., Peacock, L., Savill, N. J., Hester, S., Ravel, S., Sunter, J. D., Trevor, C., Rust, S., Vaughan, T. J., Minter, R., Mohammed, S., Gibson, W., Taylor, M. C., Higgins, M. K., & Carrington, M. (2020). A receptor for the complement regulator factor H increases transmission of trypanosomes to tsetse flies. Nature Communications, 11(1), 1326. https://doi.org/10.1038/s41467-020-15125-y

      Martos-Esteban, A., Macleod, O. J. S., Maudlin, I., Kalogeropoulos, K., Jürgensen, J. A., Carrington, M., & Laustsen, A. H. (2022). Black-necked spitting cobra (Naja nigricollis) phospholipases A2 may cause Trypanosoma brucei death by blocking endocytosis through the flagellar pocket. Scientific Reports, 12(1), 6394. https://doi.org/10.1038/s41598-02210091-5

      Mussmann, R., Engstler, M., Gerrits, H., Kieft, R., Toaldo, C. B., Onderwater, J., Koerten, H., van Luenen, H. G. A. M., & Borst, P. (2004). Factors affecting the level and localization of the transferrin receptor in Trypanosoma brucei. The Journal of Biological Chemistry, 279(39), 40690–40698. https://doi.org/10.1074/jbc.M404697200

      Mussmann, R., Janssen, H., Calafat, J., Engstler, M., Ansorge, I., Clayton, C., & Borst, P. (2003). The expression level determines the surface distribution of the transferrin receptor in Trypanosoma brucei. Molecular Microbiology, 47(1), 23–35. https://doi.org/10.1046/j.13652958.2003.03245.x

      Schwartz, K. J., Peck, R. F., Tazeh, N. N., & Bangs, J. D. (2005). GPI valence and the fate of secretory membrane proteins in African trypanosomes. Journal of Cell Science, 118(Pt 23), 5499–5511. https://doi.org/10.1242/jcs.02667

      Trevor, C. E., Gonzalez-Munoz, A. L., Macleod, O. J. S., Woodcock, P. G., Rust, S., Vaughan, T. J., Garman, E. F., Minter, R., Carrington, M., & Higgins, M. K. (2019). Structure of the trypanosome transferrin receptor reveals mechanisms of ligand recognition and immune evasion. Nature Microbiology, 4(12), 2074–2081. https://doi.org/10.1038/s41564-019-0589-0

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      Major Recommendations:

      (1) 2 E6 gene in BES7s: This does not affect the overall conclusions, but the text should be modified to reflect the existence of the second gene, and to discuss the ramifications.

      This has been corrected

      (2) Surface binding studies: To clarify this issue, two experimental approaches are strongly recommended. First: additional excess unlabelled Tf should be added. If binding is truly receptor-mediated, it must by definition be saturable at some experimentally achievable level. Second: TfR expression should be abrogated by RNAi silencing to show that binding is TfR-dependent. Without some validation of specific binding by one or both of these approaches, these counter-intuitive results must be questioned.

      The excess unlabelled transferrin experiment is now included (we would like to thank the reviewer for this suggestion). The absence of binding of canine transferrin provides strong evidence for the specificity.

      (3) Variable TfR expression in different BESs: To make such claims, quantitative RTPCR should be performed with conserved primers to assess the actual relative expression at the transcriptional level. Absent this, the claims should be eliminated, or at the very least greatly tempered.

      This has been done using an RNAseq analysis.

      (4) Surface immuno-localization of receptors: An example of discounting weak signals as background can be seen in Figure 8 of Duncan et al. (2024). It has also been shown that at least one other GPI1 reporter (procyclin) is readily detected on the outer cell surface under ectopic expression in BSF trypanosomes (Schwartz et al., 2005) using typical fixation procedures. This could be cited, and the authors could discuss the fact that procyclin is not a receptor and may not be susceptible to hydrodynamic drag.

      Yes

      Minor issues:

      (1) Fully appreciating the data presented requires an understanding of the hydrodynamic flow and GPI valence models of the Engstler and Bangs labs, respectively. For the uninitiated,d it might perhaps be useful to include brief summaries of each in the Introduction.

      Added to the introduction

      (2) Lines 110-112: ISG65 and ISG75 both have strong localizations in endosomal compartments. This should be noted with citation of any of the work from the Field lab.

      Added

      (3) Lines 121-132: This passage presents the role of GPI anchors (1 vs 2) in a rather digital manner (in or out). Schwartz et al (2005) present a much more nuanced view of what is likely taking place. This is one reason summaries of hydrodynamic flow and GPI valence would be helpful.

      Modified

      (4) Lines 182-184: The increased size of GPI-anchored E7 is in part due to the presence of the GPI itself, as the authors state, but there are also 24 additional amino acid residues in this protein that contribute.

      Modified

      (5) Lines 212-214: Do p>0.95 and p>0.99 indicate statistical significance? This must be a typo.

      Thank you, corrected

      (6) Lines 218-219: The better references documenting GPI number in regard to turnover/shedding are Schwartz et al. 2005 and Tiengwe et al. 2017.

      Changed

      (7) Line 241 and Figures 3, 4, and 6: The transverse sections add little to the presentation. That there is signal variation in all dimensions is readily apparent from the images themselves, and similar profiles would be obtained regardless of the transect. Was there some process/rationale in the selection of the individual transects intended to make a broader point? If so, a description of the process should be provided.

      The point was to show that the signal had a pattern consistent with plasma membrane (two distal peaks) as opposed to cytoplasm (single central peak). As such, we think it is important.

      (8) Lines 582-596: Methodology for quantitation of cellular fluorescent signals should be provided.

      Has been expanded

      Reviewer #2 (Recommendations for the authors):

      (1) As a less critical but still useful control, antibody accessibility assays on live versus fixed parasites could test whether VSG coats limit detection.

      This could only be quantified by using a range of monoclonal antibodies which are not available.

      (2) The rapid transferrin uptake (15-60 seconds) could reflect fast endocytic recycling rather than stable surface residency. A pulse-chase experiment tracking receptor movement would clarify this (though I acknowledge that this is technically challenging).

      We agree that endocytic recycling is probably the main source of unoccupied TfR on the cell surface. It is hard to see how the pulse chase experiment could be performed without centrifugation which will affect the outcome – see above.

      (3) Statistical and quantitative reporting

      Added as Table S2- S4

      (4) Report confidence intervals (e.g., for fluorescence intensity comparisons in Figure 3B) to contextualize claims of "no significant difference."

      We do not claim ‘no significant difference’ and the SD overlap due to a high level of variation in the population

      (5) Specify the number of biological replicates and cells analyzed per condition in the figure legends.

      Added

      (6) The study notes that surface-exposed receptors avoid antibody detection, but does not explore how.

      We don’t claim that receptors avoid detection and have published evidence to the contrary. The cell has evolved mechanisms to reduce/minimise the effect of antibody binding.

      (7) Comparing antibody binding to TfR in VSG221 versus VSG224 coats.

      This is already present in Figure 3D

      (8) Testing whether receptor shedding or conformational masking contributes to immune evasion.

      A lifetime’s work

      (9) Evolutionary trade-offs: Discuss why T. brucei maintains ~15 TfR variants if the GPI-anchor number has minimal impact on function (Figure 3).

      The possible reason for the evolution of ~15 TfR variants was discussed in a previous publication.

      (10) How do their findings align with recent studies on ISG75 surface exposure?

      If this refers to the finding that ISG75 is an Ig Fc receptor, this has been included

      (11) Add scale bars to 3D reconstructions (Figure 5).

      Added

      (12) Include a schematic summarizing key findings in the main text.

      Chosen not to do

      (13) Explicitly state where raw microscopy images, flow cytometry data, and analysis scripts are deposited.

      Microscope Images have deposited in Bioimage Archive repository at EMBL/EBI No flow cytometry used

      (14) Correct inconsistent GPI-anchor terminology (e.g., "glycosylphosphoinositol" to "glycosylphosphatidylinositol").

      Our typo, corrected

      (15) Clarify ambiguous phrases (e.g., "subtle mechanisms" in the Discussion).

      Corrected

    1. Author response:

      The following is the authors’ response to the original reviews.

      We sincerely appreciate your constructive feedback. Based on the comments from the three reviewers, we were able to substantially improve the manuscript. Below, we provide our point-by-point responses.

      Public Reviews:

      Reviewer #1 (Public review):

      Summary:

      This study examined the functional organization of the mouse posterior parietal cortex (PPC) using meso-scale two-photon calcium imaging during visually-guided and history-guided tasks. The researchers found distinct functional modules within the medial PPC: area A, which integrates somatosensory and choice information, and area AM, which integrates visual and choice information. Area A also showed a robust representation of choice history and posture. The study further revealed distinct patterns of inter-area correlations for A and AM, suggesting different roles in cortical communication. These findings shed light on the functional architecture of the mouse PPC and its involvement in various sensorimotor and cognitive functions.

      Strengths:

      Overall, I find this manuscript excellent. It is very clearly written and built up logically. The subject is important, and the data supports the conclusions without overstating implications. Where the manuscript shines the most is the exceptionally thorough analysis of the data. The authors set a high bar for identifying the boundaries of the PPC subareas, where they combine both somatosensory and visual intrinsic imaging. There are many things to compliment the authors on, but one thing that should be applauded in particular is the analysis of the body movements of the mice in the tube. Anyone working with head-fixed mice knows that mice don't sit still but that almost invariable remains unanalyzed. Here the authors show that this indeed explained some of the variance in the data.

      Weaknesses:

      I see no major weaknesses and I only have minor comments.

      Reviewer #2 (Public review):

      Summary:

      The posterior parietal cortex (PPC) has been identified as an integrator of multiple sensory streams and guides decision-making. Hira et al observe that dissection of the functional specialization of PPC subregions requires simultaneous measurement of neuronal activity throughout these areas. To this end, they use wide-field calcium imaging to capture the activity of thousands of neurons across the PPC and surrounding areas. They begin by delineating the boundaries between the primary sensory and higher visual areas using intrinsic imaging and validate their mapping using calcium imaging. They then conduct imaging during a visually guided task to identify neurons that respond selectively to visual stimuli or choices. They find that vision and choice neurons intermingle primarily in the anterior medial (AM) area, and that AM uniquely encodes information regarding both the visual stimulus and the previous choice, positioning AM as the main site of integration of behavioral and visual information for this task.

      Strengths:

      There is an enormous amount of data and results reveal very interesting relationships between stimulus and choice coding across areas and how network dynamics relate to task coding.

      Weaknesses:

      The enormity of the data and the complexity of the analysis make the manuscript hard to follow. Sometimes it reads like a laundry list of results as opposed to a cohesive story.

      Reviewer #3 (Public review):

      Summary: This work from Hira et al leverages mesoscopic 2-photon imaging to study large neural populations in different higher visual areas, in particular areas A and AM of the parietal cortex. The focus of the study is to obtain a better understanding of the representation of different task-related parameters, such as choice formation and short-term history, as well as visual responses in large neural populations across different cortical regions to obtain a better understanding of the functional specialization of neural populations in each region as well as the interaction of neural populations across regions. The authors image a large number of neurons in animals that either perform visual discrimination or a history-dependent task to test how task demands affect neural responses and population dynamics. Furthermore, by including a behavioral perturbation of animal posture they aim to dissociate the neural representation of history signals from body posture. Lastly, they relate their functional findings to anatomical data from the Allen connectivity atlas and show a strong relation between functional correlations on anatomical connectivity patterns.

      Strengths:

      Overall, the study is very well done and tackles a problem that should be of high interest to the field by aiming to obtain a better understanding of the function and spatial structure of different regions in the parietal cortex. The experimental approach and analyses are sound and of high quality and the main conclusions are well supported by the results. Aside from the detailed analyses, a particular strength is the additional experimental perturbation of posture to isolate history-related activity which supports the conclusion that both posture and history signals are represented in different neurons within the same region. Weaknesses: The main point that I found hard to understand was the fairly strong language on functional clusters of neurons while also stating that neurons encoded combinations of different types of information and leveraging the encoding model to dissociate these contributions. Do the authors find mixed selectivity or rather functional segregation of neural tuning in their data? More details on this and some other points are below.

      We thank the three reviewers for their accurate and expert evaluations.

      Recommendations for the authors:

      Reviewer #1 (Recommendations for the authors):

      (1) It wasn't clear to me why the authors focused on areas A and AM, but not RL. After all, at the beginning of the results, the authors ask: "PPC has been reported to have functions including visually guided decision-making and working memory. Do these functions differ among RL, A, and AM?".

      Thank you for the comment. The manuscript first characterizes AM as a region involved in visually guided decision-making and A as a region related to history and/or working memory. Subsequently, when discussing correlation structure, we stated the following:

      “In particular, based on the critical functional differences between A and AM that we found, A and AM may belong to distinct cortical networks that consist of different sets of densely interacting cortical areas.”

      Thus, the logical flow of our analysis is to first reveal the functional contrast between A and AM through comparative functional analyses across RL, A, and AM, and then to focus on this contrast. We speculate that RL may exhibit more distinctive functional properties in tasks that rely on whisker-based processing or related modalities. We have therefore revised the text as described below to avoid the impression that the manuscript places disproportionate emphasis on RL.

      Line 137: “PPC has been reported to have functions including visually guided decisionmaking and working memory. Do these functions differ among A, AM, and RL?”

      (2) Figures 2 E, F, and Figure 3A, could the authors indicate the trial structure better on these plots?

      Thank you for the comment. We have added explanations of the bar meanings to the figure legends.

      Figure 2:

      “(E) Representative vision neurons (ROI 1-4 in I). The red bars indicate sampling periods during video presentation, and the brown bars indicate sampling periods without video stimulation. Vertical black lines mark the onset of the sampling period. F. Representative choice neuron (ROI 5-8 in I) and a non-selective neuron (ROI 9). Light blue lines indicate the response periods in trials with left choices, and purple lines indicate the response periods in trials with right choices. Vertical black lines mark the onset of the response period.”

      Figure 3:

      “(A) The representative history neurons. Numbers correspond to that of panel B and C. Light blue lines indicate rewards delivered from the left lick port, and purple lines indicate rewards delivered from the right lick port. Vertical white lines mark the onset of the sampling period.”

      (3) There are several typos that need correcting. Also, small and big capital letters to demark the panel names in the legends have been mixed.

      Thank you for the comment. We have corrected the panel labels as described below.

      Figure 2 legend:

      “Representative choice neuron (ROI 5-8 in I) and a non-selective neuron (ROI 9)”

      Figure 3 legend:

      “..than the next choice. I. The decoding accuracy of the next choice …”

      Figure 3 legend:

      “Error bars, mean ± s.e.m. in I, 95% confidence interval in G. M, and O.”

      Supplementary Figure 6:

      “…neurons with rt ≥ 0.3 (blue) were shown. B. Trial-to-trial activity fluctuation … (rt ≥ 0.3, panel B) was color coded…”

      We thoroughly checked the manuscript for typographical errors and corrected the issues.

      (4) Many in the field still use the Paxinos nomenclature for PPC subfields, could the authors write something short about how these two nomenclatures correspond?

      We have described the relationship between our area definitions and those of Paxinos in the main text as follows.

      Line 702: “In addition to our definition, previous studies have also defined posterior parietal cortex (PPC) to include the higher visual areas A, AM, and RL (Glickfeld and Olsen, 2017; Wang et al., 2011). These areas partially overlap with the parietal association regions defined in the Paxinos atlas, including MPtA, LPtA, PtPD, and PtPR. For a detailed discussion of the correspondence and variability among these regional definitions, see Lyamzin and Benucci (2019).”

      (5) Analyzing choice history may be affected by the long fluorescence Ca transients and will depend on excellent event deconvolution. Could the authors show some more zoomed-in examples of how well their deconvolution works?

      We provide enlarged, trial-by-trial activity traces of the four example neurons shown in Figure 3A in Supplementary Figure 3G. In all neurons, multiple small calcium transients occur repeatedly throughout the delay period, which lasts longer than 10 s. If the sustained activity during the delay were simply due to a long decay time constant, one would expect a large calcium transient in the preceding trial that slowly decays over the delay period. However, such a pattern is not observed in the actual data. Also, since the decay time constant of GCaMP6s is on the order of ~1 s, signals persisting for ~10 s cannot be explained by slow decay alone.

      (6) The authors write: "the history neurons exhibited properties of working memory." However, note that this is not a working memory task since the mice don't need to keep evidence in memory, the direction to lick can be made at the very beginning of a trial.

      Behaviorally, demonstrating that an animal maintains working memory requires showing that its behavior changes based on retained information when new information is introduced, as in delayed match-to-sample tasks. In the present task, however, the correct action for the next trial is determined at the moment the action in the previous trial is completed, such that animals can simply switch to motor preparation at that point. Thus, from a strictly behavioral perspective, working memory is not required.

      On the other hand, during the inter-trial interval (ITI), information from the previous trial dominates over information from the upcoming trial (Fig. 3H), which is more consistent with retention of past information than with motor preparation. Moreover, trials in which neural activity maintained information about the previous trial’s action were associated with a higher probability of correct performance in the subsequent trial. In other words, retaining past information contributes to guiding correct behavior in the next trial.

      Based on these neural analyses, we interpret that mice retain information about their previous trial’s action history in working memory and use it to determine behavior in the subsequent trial. Accordingly, we consider ITI activity in PPC to reflect working memory rather than motor preparation. Nevertheless, we acknowledge that your concern is valid, and we have therefore revised the text as follows:

      Line 234: “These results suggest that the history neurons exhibited properties of working memory.”

      (7) In the section about the Choice History Task, the authors write: "Since the visual stimuli were randomly presented during the sampling period, the mice had to ignore the visual stimuli." Why continue to present the visual stimuli?

      Thank you for the suggestion. By designing the vision task and the history task to have identical structures, we can apply the same encoding and decoding models to both tasks, which facilitates direct comparison between them. This design makes it easier to examine how neuronal activity patterns change depending on task demands.

      Reviewer #2 (Recommendations for the authors):

      (1) I don't understand the logic of Figure S7 and the neuropil analysis in general. Neuropil activity is purported to represent input, so it seems unsurprising that nearby neurons would exhibit similar dynamics.

      Thank you for your comment. Your argument is correct, and it is not at all surprising that neuropil signals correlate with the activity of surrounding neurons. Here, we quantitatively examined the relationship between neuropil activity and the average activity of nearby neurons. In addition, in a separate analysis, we clarified the relationship between connectome information and neuropil activity. Taken together, these analyses reveal the relationship between connectome information and the local average of neuronal activity. We describe this point as follows:

      “Indeed, the trial-to-trial variation of a neuropil activity could be approximated by the average of 1,000–10,000 neurons within several hundred micrometers from the center (Figure S7).”

      Although we analyzed this phenomenon in the cases of areas A and AM, this finding should not be considered specific to A and AM but instead has broader, general significance. Accordingly, we added a new Results subsection and revised the manuscript as follows.

      Line 448: “Constraints and limits of anatomical connectivity on neuronal population activity Although we have so far focused on the differences between A and AM, our data provide broader insights into the relationship between anatomical connectivity and neuronal population activity. First, based on Figure S7 and the considerations above, anatomical input correlations strongly constrain the correlations between local averages of activity across thousands of neurons. We then asked whether this anatomical constraint extends beyond mean activity, and how anatomical input correlations relate to relationships between neuronal population activities (population vectors).

      The correlation between CC<sub>t</sub> and r<sub>anatomy</sub> was moderate (r = 0.60, Figure 6L). This moderate correlation did not change when the coupling neurons were eliminated (r = 0.61). Interestingly, the largest canonical component was the most unpredictable from the anatomical data (Figure 6M). Thus, while inter-area correlations based on the mean activity of neuronal populations are largely determined by anatomical input correlations, correlations between population vectors contain additional structure that cannot be captured by anatomical input correlations alone.

      One possible source of this additional structure is globally shared activity, which may reflect behavior, brain state, or levels of neuromodulators. To evaluate the contribution of global activity on the canonical correlation between areas, we first compared the canonical coefficient vectors (CCV). We found that the first CCV had a similar orientation, regardless of the paired areas (Figure6N). This indicates that the largest components of correlated activity in the CCA analysis are globally shared fluctuations. We also directly evaluated the correlated activity components across all 8 areas with generalized canonical correlation analysis. The first CCV also had a similar orientation to the first generalized canonical coefficient vector (GCCV) (Figure 6O). These results indicate that the largest canonical component reflects a global correlation across all cortical areas imaged. Such global correlations may be driven by factors beyond cortico-cortical or thalamo-cortical inputs, such as the animal’s behavioral state as we recently characterized (H. Imamura et al., 2025; F. Imamura et al., 2025). We also confirmed the robustness of these results by repeating analyses using only the 40% highly active neurons after denoising with non-negative deconvolution (36828 out of 91397 neurons; Figure S9).”

      (2) Furthermore, the neuropil signal likely contains signals from out-of-focus neurons that are presumably functioning similarly to the in-focus cells. Wouldn't the interesting question be to what extent the local neuropil signal in, for example, area A resembled that of neuronal activity in S1t?

      Thank you very much for your comment. We agree with your point. Based on the evaluation in Figure S7, the neuropil signal likely contains the average activity of several thousand local neurons, including out-of-focus contributions. The neuropil signal in area A may also partially reflect neuronal activity from the neighboring S1t area. In particular, neurons that show little correlation with the local population average (i.e., the neuropil signal) within the same area are sometimes referred to as “soloists” (M. Okun et al., 2015). If such soloist neurons were found to exhibit strong correlations with the neuropil signal of an adjacent area, this would be a highly interesting result. However, such an analysis would go beyond the scope of the present manuscript and would require a new line of discussion; therefore, we plan to address this issue in future work.

      (3) I generally found the final Results section (Relationship between mesoscale functional correlation and anatomical connections) to be hard to follow. The motivation for this analysis should be better explained.

      We fully incorporated your suggestion and rewrote the final section of the Results accordingly. Please refer to our responses to the two comments above.

      (4) The question of brain state/neuromodulation as a driver of the globally shared activity may be addressable by considering its correlation with pupillometry data.

      We fully agree with your suggestion. In our experiments, visual stimuli change continuously, and thus pupil diameter changes are most likely driven primarily by changes in visual input. Although state-dependent fluctuations of brain activity may also be present, they are likely masked by the larger effects induced by visual stimulation. Therefore, analyzing pupil-linked signals as a factor of globally shared activity would be more appropriately addressed in experiments without visual stimulation. We plan to investigate this issue in future studies. Here, we have added the following description regarding pupil dynamics and their associated relationships.

      Line 292: “We found that the neurons related to the tail and forepaws were similarly distributed around the parietal cortex including S1 and A, while the pupil-size related neurons were mapped around visual areas (Figure 4C). Changes in pupil diameter may influence neuronal activity through multiple mechanisms, including behavioral state or noradrenergic level [REF], nonlinear interactions with visual stimulation, and changes in the amount of light reaching the retina.”

      Minor issues

      (1) The authors deploy sophisticated mathematical techniques with essentially no explanation outside the Methods section. A brief introduction of jPCA and CCA in the main text would help the reader understand the value of these analyses.

      Thank you for the comment. We added the following explanation.

      Line 238: “In this task, left and right selection are alternated, so the activity of the history neuron is a sequence that repeats in two consecutive trials. We used jPCA<sup>49</sup> to visualize and quantify this activity pattern (Figure 3K). jPCA identifies low-dimensional projections of population activity that maximize rotational dynamics across time.”

      Line 374: “Next, to investigate r<sub>t</sub> of the population activity (r<sub>t_population</sub>), we first reduced the dimension of population activity in each area into 10 by using PCA (principal component analysis) (Figure S6B,C). Then, “fluctuation activity” was recalculated for each dimension and trial type, analogous to the single-neuron analysis described above, but here representing noise in population-level activation patterns. We applied CCA (canonical correlation analysis) to each pair of areas and obtained an average of 10 canonical correlations (CC<sub>t</sub>) as r<sub>t_population</sub>. CCA identifies pairs of linear combinations of population activity from two areas that maximize their correlation across trials, thereby capturing shared population-level fluctuations. The CC<sub>t</sub> structure between areas was similar across task types (Figure 5H) indicating that this structure reflects the underlying functional connectivity independent of the task. The CC<sub>t</sub> between A and S1t was the largest among all the pairs (Figure 5H), whereas when the CC<sub>t</sub> was averaged across all connections for each area, A and AM had the largest and second largest C<sub>t</sub>, respectively (Figure 5I). The dominance in CC<sub>t</sub> in A and AM disappeared when the neurons with r<sub>t_single</sub> >0.3 were removed. Notably, the CC<sub>t</sub> of AM and the other areas was uniform regardless of the paired areas across all 10 canonical components (Figure 5J). Thus, area AM is an integration hub of interareal communication, whereas A simply coupled with S1t, and such correlation structure at the population level critically depends on this subset of neurons.”

      (2) The manuscript contains numerous typos ("hoice"), spelling errors ("parameters", "costom"), abbreviations that are not defined (ex: RL/rostrolateral), and minor grammatical issues that should be addressed by a round of copy editing.

      We thank the reviewer for pointing this out. We have thoroughly corrected these typographical and grammatical errors, and have described the revisions in detail in our response to Reviewer 1, comment (3). In addition, we have clarified the abbreviations in the manuscript as follows.

      Line 94: “rostrolateral area (RL)”

      Figure 1 legend: “Abbreviations: RL, rostrolateral HVA; PM, posteromedial HVA; RSC, retrosplenial cortex.“

      (3) Figure 3K unlabeled axes.

      Thank you for the comment. We have added the axis labels.

      (4) Figure 3K caption, first "(right)" should be "(left)".

      Thank you very much for your careful attention to detail. We have made the requested correction.

      (5) Figure 6 is hard to read. Panel A is too small, and the interpretation of G is difficult.

      - For panel A, we added an enlarged view with images from a larger number of trials in Figure S7A.

      - G represents the connectivity matrix. The sources correspond to the injection sites, and the targets correspond to voxels in the cerebral cortex. Because the latter may not be immediately clear, we explicitly indicated in the figure that the targets are cortical voxels.

      (6) Figure S4C has a double compass.

      Thank you for the comment. We have revised the manuscript accordingly.

      Reviewer #3 (Recommendations for the authors):

      While I have some questions and additional suggestions to further improve the clarity of the manuscript, I already found it to be highly interesting and well done in its current form.

      Major points:

      (1) The t-SNE comes up rather abruptly and is not well-explained in the main text or the figure caption. It would be good to provide some more information on the rationale of this analysis and how to interpret it. In particular, I don't see clear clusters in Figure 2H although the description of the authors seems to indicate that they observe clear functional classes such as choice, stimulus, and history neurons. Similarly, in Figure 3B, I don't see a clear separation between history and choice neurons in the t-SNE map. The example cells in Figure 3A appear to be delayed or long-tailed choice neurons rather than a dedicated group of 'history neurons'. It would be helpful for the interpretation of the t-SNE plots to show different PSTHs for different regions of the t-SNE map to better illustrate what different regions within the t-SNE projection represent and what distinguishes these cells.

      Thank you for the comment. The absence of clearly defined clusters in the t-SNE map suggests that neuronal activity forms a continuum rather than discrete classes. Importantly, the purpose of the t-SNE map here is not to identify sharp clusters, but to demonstrate that the functional categorization provided by our encoding model broadly and comprehensively spans the major structures present in the unsupervised t-SNE map. We have revised the relevant text in the manuscript accordingly as follows.

      Line 158: “To examine whether the neuron groups labeled by this model broadly capture the diversity of neuronal activity, we performed unsupervised clustering of neuronal activity using t-SNE. The functional labels revealed by this encoding model were consistent with the t-SNE clusters, indicating the validity of the encoding model (Figure 2H; Figure S4B; materials and methods).”

      The issue regarding History neurons was also raised in Reviewer #1’s comment (5). We provide an enlarged view of Figure 3A in Figure S3A. Each History neuron exhibits multiple calcium transients repeatedly and asynchronously following the previous reward acquisition. Therefore, rather than being “choice neurons with a long tail,” these neurons are better interpreted as neurons whose activity is sustained during this delay period.

      (2) Although the authors mention that neurons represent a mixture of features, they then use the encoding model to isolate clusters, such as vision or choice neurons. In general, the language throughout the manuscript suggests that there are various clusters of functionally segregated neurons (vision, choice, history, or coupling neurons). However, it is not clear to me to what extent this is supported by the data. Couldn't a choice neuron also be a vision neuron if both variables make significant contributions to the model? Similarly, are 'history' and 'choice' separate labels from the encoding model, or could a cell be given multiple labels? If a cell could be given multiple labels how did the authors create the colored plots on the right-hand side of Figures 2H and 3B? The example history cells in Figure 3J also appear to be highly selective for the contralateral choice, so again this seems to argue against a clear separation of choice and history neurons.

      Each label is assigned based on whether the corresponding coefficient is significant in the encoding model, and therefore neurons that are both vision- and choice-selective do exist. The presence of mixed selectivity neurons in PPC is well established (e.g., MJ Goard et al., 2016 elife). In this manuscript, however, we focus not on functional overlap at the single neuron level, but on the spatial distribution of functional classes, and thus do not explicitly address mixed selectivity. Although the colors in Figure 2H and Figure 3B overlap, the underlying data for each are presented separately in Figure S4B and S4D, respectively. As shown there, each color generally occupies distinct regions in the t-SNE map.

      (3) The decoding analysis in Figure 3F also suggests that a potential reason why there are more choice history signals in areas S1 and A is that neural activity is simply larger rather than due to the activity of a dedicated group of history neurons. Are the authors interpreting this differently? Could the duration of stored choice information also be affected by the dynamics of the calcium indicator?

      Thank you for the comment. Simply having larger neural activity in S1t or A would not result in calcium transients with a ~1-s time constant persisting throughout a delay period lasting up to 10 seconds. As also noted in comment (1), History neurons exhibit sustained and repeated calcium transients, and therefore their activity cannot be explained merely by elevated neural activity levels. One could argue that all cortical areas carry history-related information but that the signal-to-noise ratio is higher in S1t or A, which might make such signals more detectable there. If this were the case, however, differences across areas in all forms of selectivity should similarly depend on signal-to-noise ratio. This is not what we observe in our data.

      (4) I'm confused as to why the decoding accuracy is so high for areas A and S1t at time -3 relative to the choice in Figure 3F. Shouldn't this be the same as predicting the next choice in Figure 3H? Why is the decoding accuracy lower in this case?

      Thank you for the comment. The analysis shown in Figure 3F includes only trials in which the choice was correct. This is the reason why the decoding performance in Figure 3H is lower. We have added this clarification to the main text.

      Figure 3F: “Decoding accuracy of choice, outcome, and visual stimuli by the activity of 20 neurons from each area using only correct trials, before and after the choice onset, reward delivery, and the end of the visual stimuli, respectively. Line colors corresponded to the areas shown in panel G.”

      (5) In general, the text is not very detailed about the statistics. While test scores and p-values are mentioned, it would be good to also state what is actually compared and what the n is (e.g. how many neurons, neuron pairs, areas, sessions, or animals) for each case. How do the authors account for the nested experiment design where many neurons are coming from a low number of animals?

      Thank you for the comment. In our decoding analyses, we generally treat the number of animals as the independent variable. In contrast, for the encoding model analyses, we treat the number of neurons as the independent variable. As you correctly pointed out, because we recorded activity from a large number of neurons, statistical tests that treat individual neurons as independent samples can readily yield significant p-values even with a small number of animals. We have therefore confirmed that our conclusions are not driven by a large effect from a single animal. When making qualitative claims, we rely not only on statistical significance (p-values) but also require clear differences in effect size. We have added the following clarification to the Statistics section accordingly.

      Line 1049: ”For the decoding analyses, the number of animals was treated as the independent variable, whereas for the encoding model analyses, the number of neurons was treated as the independent variable. To ensure that the results were not driven by a single animal, we repeated the statistical tests while systematically excluding data from one animal at a time and confirmed that statistical significance was preserved in all cases. Furthermore, qualitative interpretations were made only when differences in effect size were clearly observed.”

      (6) How was the grouping in Figure 2O done? Specifically, how were the thresholds for the dashed lines selected to separate PM and V1 from AM and RL as association areas? It seems to me like this grouping was done rather arbitrarily as the difference in choice decoding accuracy is not particularly large between these areas.

      This line does not have a specific quantitative basis, but we consider it useful as an illustrative aid. We have added this clarification to the figure legend.

      Figure 2O: “Decoding accuracies of time in video presentation and choice direction indicate that AM would be the best position for associating these two signals. The background color and dashed lines are provided as visual aids for illustrative purposes.”

      (7) The fact that neurons with high rt_single tend to share the same function might also indicate the approach is insufficient to remove all effects of tuning to trial types from the neural data. Since the authors subtract the average of each trial type, the average trial-type related information is removed but type-specific variations that are not equally presented in the average might remain. For choice neurons for example, attentive vs in-attentive choices could be represented differently and thus remain in the data since the average would be a mixture of both. The same goes for other factors that would drive a particular modulation in the choice - or stimulus - related part of the trial which could still tie these neurons together. One way to circumvent this concern could be to first compute the mean activity for all time points in each trial and then compute the trial-to-trial variability across all trials of the same type. Alternatively, I would be curious how the results play out when using data when the animal is not actively performing the task to compute rt_single.

      Thank you for the comment. The concern raised by the reviewer applies to all noise-correlation analyses and highlights an important limitation of this approach, namely that factors other than the observed variables are treated as noise. By subtracting the trial-averaged activity, information related to sensory input and the direction of the first lick at choice can be removed. However, other factors cannot be eliminated if they are not observed. For example, if right hindlimb movements tend to occur only in trials with visual stimulation combined with left choice, such effects cannot be removed because they are not measured. The same issue remains even when restricting the analysis to a single trial type. Based on these considerations, we have added the following text to the manuscript.

      Line 932: “Correlation of trial-to-trial variance of activity between a pair of single neurons was defined as r<sub>t_single</sub>. To calculate r<sub>t_single</sub>, we averaged the activity of individual neurons over the sampling period, and the average across each trial type was subtracted from this value. The trial types consisted of four sets of pairs of stimuli and responses, that is, the video stimulation and left choice, the video stimulation and right choice, the black screen and left choice, and the black screen and right choice. By this operation, we extracted the fluctuating components of single-neuron activity that are independent of the trial types. Although the finding that neurons with high r<sub>t_single</sub> tend to share the functional properties we propose is not a trivial consequence of the analysis. At the same time, it remains possible that high r<sub>t_single</sub> reflects the degree to which neurons share unobserved features, and that such features are correlated with our functional classification. Thus, while this analysis suggests that correlated fluctuations across cortical areas may contribute to the determination of functional types, establishing an exclusive conclusion will require more fine-grained behavioral measurements, tighter control of internal states, and causal identification through targeted interventions.”

      Minor points:

      (1) Why did the authors use the activity of 50 neurons for the decoder analysis in Figure 2K? Didn't they have many more neurons available? How were these selected?

      We found that the conclusions were identical when using datasets consisting of either 50 neurons or 20 neurons across all analyses. Because the total number of recorded PM neurons did not reach 100 in at least one mouse, we standardized the analyses to 50 neurons in order to match the number of neurons across all cortical areas and animals.

      (2) The authors mention that some PPC neurons showed complex dynamics rather than encoding a specific feature such as visual or choice information but do not mention actual numbers on this point. It would be good to quantify to what extent neurons in different regions represent such mixed selectivity and whether there are clear differences in selectivity. This would also be interesting to discuss in context to earlier work on mixed selectivity in the parietal cortex, such as Raposo et al 2015.

      Thank you for the comment. Your point is entirely valid. However, as explained in our response to your major comment, our analyses focus not on how individual neurons are classified, but rather on the spatial distribution of these functional categories.

      (3) I have a hard time understanding what the length of the bars in the right panel of Figure 2k indicates. Does this plot show more than the decoder accuracy before and after the choice? Is the bar length related to the standard deviation? The same question for the visualization in panel 2n. It looks nice but I'm confused about what it shows exactly.

      These bars represent confidence intervals. Although this is stated at the end of the Figure 2 legend, we agree that it may not be sufficiently clear, and we have therefore added this information to the Statistics section.

      Line 1046: “In Figure 2K and N, and Figure 3G, L, M, and O, the bars indicate the 95% confidence intervals. All other bars denote s.e.m., unless otherwise noted.”

      (4) Is Figure 3D showing the same association index as in Figure 2j, thus showing the same result as in the vision task or is this meant to show something new? It was not clear to me from the wording, so it would be good to clarify.

      You are correct that the magenta trace in Fig. 3D is the same as in Fig. 2J. This panel was included to explicitly illustrate that, in areas A and AM, the separation between History and Association approximately overlaps. We have added the following clarification to the figure legend accordingly.

      Figure 3D: “The percentage of history neurons and the association index (as defined in Fig. 2J) were overlaid for comparison.”

      (5) When computing the Pseudo R2 for regressor contribution, how was the null model computed? From shuffling all regressors in the model? I think this is fine but it's not fully clear what the intended effect of this procedure is. For the description of Figure 4C it would be good to add a sentence explaining how to interpret the pseudo R^2.

      The null model predicts a fixed value that is independent of the explanatory variables, i.e., it predicts only the intercept. This provides a useful correction term when performing cross-validation, particularly in cases where baseline values differ across folds. In Figure 4C, the analysis shows the contribution of adding body part positions and pupil diameter to the model for predicting neural activity. We have added the following text to the Methods section.

      Line 881: “To estimate the contribution of parameters for the left forelimb, the right forelimb, the tail, and the pupil, we repeated the same analysis with a reduced model where each set of predictors was eliminated from the full model (Figure 4B). Then, the pseudo-R<sup>2</sup> was obtained for each set of predictors by (MSE<sub>reduced</sub>MSE<sub>full</sub>) /MSE<sub>null</sub>, where MSE is the mean squared error, MSE<sub>reduced</sub> is MSE for the reduced model, MSE<sub>full</sub> is the MSE of the full model, and MSE<sub>null</sub> is the null model. The null model predicts a fixed value that is independent of the explanatory variables; specifically, it simply outputs the mean of the training data. For example, we constructed a regression model without the parameters regarding the left forelimb (green shade of Figure 4B), obtained MSE<sub>reduced</sub> for the left forelimb, and the pseudo-R<sup>2</sup> was calculated as above by comparing the MSE of the full model and the null model. This value reflects the extent to which the position of the left forelimb contributes to the prediction of neuronal activity.”

      (6) It seems surprising that the pupil-size-related neurons were mapped around visual areas although the pupil should carry clear luminance information. Is this because the luminancerelated information in the pupil can also be explained by the stimulus variable in the model?

      Pupil size changed markedly before and after visual stimulus presentation (Figure S5C), dilating during the black stimulus and constricting during the video stimulus. This likely reflects changes relative to the luminance of the gray screen presented in the absence of visual stimuli. In our encoding model, visual stimuli are included as independent regressors for each corresponding time window. Therefore, pupil fluctuations that are temporally locked to visual stimulation are explained by these visual regressors. Neuronal activity that is better explained by pupil size changes not accounted for by the visual regressors is classified as pupil-related. At least three mechanisms may underlie the influence of pupil size on neuronal activity. First, fluctuations in pupil diameter have been linked to behavioral state or noradrenergic level [REF], which can act as variables independent of visual stimulation. Second, pupil fluctuations may be amplified in a stimulus-dependent manner, reflecting nonlinear interactions between visual input and brain state. Third, changes in pupil diameter alter the amount of light reaching the retina, which can modulate activity in visual cortical areas. The latter two mechanisms are therefore expected to predominantly affect visual areas and may explain why pupil-related neurons are more frequently observed there. The first mechanism is likely related to global brain state, and its association with behavior may account for the presence of pupil-related neurons in S1. However, these interpretations require confirmation through more refined causal manipulations. Accordingly, we limited the addition to the manuscript to the following statement.

      Line 292: “We found that the neurons related to the tail and forepaws were similarly distributed around the parietal cortex including S1 and A, while the pupil-size related neurons were mapped around visual areas (Figure 4C). Changes in pupil diameter may influence neuronal activity through multiple mechanisms, including behavioral state or noradrenergic level [REF], nonlinear interactions with visual stimulation, and changes in the amount of light reaching the retina.”

      (7) What is meant by 'external control parameters such as a video frame' when explaining the encoding model?

      Thank you for the comment. We added the following explanation.

      Line 151: “In the encoding model, the activity of each neuron was fitted by a weighted sum of external control parameters, such as video frames, and behavioral parameters, such as choice and reward direction. Because the visual stimulus changes continuously over time, sliding time windows were placed during the visual stimulus period.”

      (8) What does the trace in Figure 2G show? Is this a single-cell example? What are the axes here?

      We added an explanation to the figure legend.

      Figure 2G: “Schematic of our encoding model. The bottom right panel shows an example of single-neuron activity with an overlay of the fitting obtained by the encoding model.”

      (9) There seems to be a word missing in the sentence that describes the results for Figure 3O in the main text.

      Thank you for the comment. We added the following description related to Fig. 3O.

      Line 247: “resulting in the decoding accuracy of time after a specific choice being lower than in A (Figure 3O).”

      (10) The abbreviation RP is used when describing Figure S5A. It should be mentioned that this refers to the response period.

      Thank you for the comment. We added the following description related to Figure S5A.

      Line 283: “We found that the angle of the tail was significantly different from the baseline values several seconds after the response period (RP) (Figure S5A)”

      (11) I can't see the color difference between the traces in Figure 2E. There are probably red and green but this is hard to see for readers with red-green color blindness. Does the black indicate the time of visual stimulation? Is the line in Figure 2F the time when the spouts move in?

      Thank you for the comment. In Fig. 2E, we improved visibility by changing the line opacity. In addition, the vertical line in Fig. 2E indicates the onset of the visual stimulus, and the vertical line in Fig. 2F indicates the onset of the response period. We have added the following explanations to the figure legend.

      Figure 2: E. “Representative vision neurons (ROI 1-4 in I). The red bars indicate sampling periods during video presentation, and the brown bars indicate sampling periods without video stimulation. Vertical black lines mark the onset of the sampling period. F. Representative choice neuron (ROI 5-8 in I) and a non-selective neuron (ROI 9). Light blue lines indicate the response periods in trials with left choices, and purple lines indicate the response periods in trials with right choices. Vertical black lines mark the onset of the response period.”

      (12) It might be useful to provide a short explanation in the results or methods of why the harmonic mean was used for the computation of the association index. I think it makes sense but since it is not commonly used this could be helpful for the reader to understand the approach.

      Thank you for the comment. We added the following explanation to the main text.

      Line 869: “The association index was determined by the harmonic mean of the rates of vision neurons and choice neurons. The harmonic mean approaches the arithmetic mean when the two values are similar, but becomes closer to the smaller value when the two values differ substantially. Therefore, the association index takes a large value when both vision neurons and choice neurons are abundant.”

      (13) I don't fully understand how coupling diversity is computed. If there are six preference vectors, what is meant by taking the average of angles between all pairs of the two vectors?

      Which two are meant here?

      Thank you for the comment. We revised the explanation as follows.

      Line 950: “To quantify the diversity of coupling patterns across clusters, we computed the angle between every pair of preference vectors. We then averaged these pairwise angles and defined this quantity as the “coupling diversity.”

      (14) The results text states that the high correlation between r_anatomy and r_neuropil (Figure 6I) is evidence for the functional correlations being driven by cortico-cortical connectivity. However, Figure 6J shows that correlations for either cortico-cortical or thalamo-cortical connectivity are below 0.94 and generally higher for thalamo-cortical connectivity. This doesn't negate the general point of the authors but it would be good to clarify this section so it is easier to understand if r_anatomy includes both cortico-cortical and thalamo-cortical data and how the results in Figure I and J go together with the description in the results section.

      You are correct. We have revised the text to clarify that the analysis reflects the combined effects of both cortico-cortical and thalamo-cortical inputs.

      Line 436: “This correspondence suggests that the mesoscale interarea correlation is determined by the cortico-cortical and thalamo-cortical common input at mesoscale. Figure S8: A. Using Allen connectivity atlas, the axonal density of cortico-cortical and thalamo-cortical projection was analyzed.”

      (15) I'm not very familiar with canonical correlation analysis and found this part hard to follow. Some additional explainer sentences would be helpful here. For example, what does it mean to take the average of the top 10 canonical correlations as rt_population? What exactly are the canonical correlation vectors? It was also not clear to me what exactly the results in Figure 5J signify.

      Thank you for the comment. We have clarified the description in the main text related to CCA and the associated analyses as follows.

      Line 374: “Next, to investigate r<sub>t</sub> of the population activity (r<sub>t_population</sub>), we first reduced the dimension of population activity in each area into 10 by using PCA (principal component analysis) (Figure S6B,C). Then, “fluctuation activity” was recalculated for each dimension and trial type, analogous to the single-neuron analysis described above, but here representing noise in population-level activation patterns. We applied CCA (canonical correlation analysis) to each pair of areas and obtained an average of 10 canonical correlations (CC<sub>t</sub>) as r<sub>t_population</sub>. CCA identifies pairs of linear combinations of population activity from two areas that maximize their correlation across trials, thereby capturing shared population-level fluctuations. The CC<sub>t</sub> structure between areas was similar across task types (Figure 5H) indicating that this structure reflects the underlying functional connectivity independent of the task. The CC<sub>t</sub> between A and S1t was the largest among all the pairs (Figure 5H), whereas when the CC<sub>t</sub> was averaged across all connections for each area, A and AM had the largest and second largest CC<sub>t</sub>, respectively (Figure 5I). The dominance in CC<sub>t</sub> in A and AM disappeared when the neurons with r<sub>t,single</sub> >0.3 were removed. Notably, the CC<sub>t</sub> of AM and the other areas was uniform regardless of the paired areas across all 10 canonical components (Figure 5J). Thus, area AM is an integration hub of interareal communication, whereas A simply coupled with S1t, and such a correlation structure at the population level critically depends on this subset of neurons.”

    1. The Heimberg et al. Model of SA/SAD

      the Heimberg et al. model of SA/SAD - There is a perceiving audience (being evaluated) - So you create a mental representation of self as seen by audience, o This image is negative  - The attention shifts inward (attentional resources) o Instead of the attention to the conversation, you start to monitor yourself (only observe self)  - You search got signs of evaluation, you interpret all of these as proof you doing badly even though they are natural  - The comparison (the “arithmetic problem”) o You do a mental calculation  How I think I’m doing vs how I think they expect me to do o Conclusion: I’m far below what they expect - Judgement of consequences: brain makes conclusions of what they think about you  - Anxiety symptoms: physical, cognitive, behavioural  - The vicious cycle: o These anxiety symptoms now become new evidence  See I am doing nervous – this worsens the negative self images - these models that help us come up with therapist and tell oit patients whay is happening and yo get a grasp on what we see and observe - walking in the city is nit the same as looking at ther streed plan - what people observed in patients

    1. O save his life and let me die for him

      The plea “O save his life and let me die for him” reinforces, within the Spanish revenge tragedy, her embodiment of extreme romantic devotion, shaping the audience’s impression of her as a tragic heroine, emotionally intense and morally sympathetic. Yet this moment of self-sacrificial love is complicated by the lingering shadow of her earlier revenge rhetoric, which subtly unsettles the purity of her devotion.

    2. O stay my Lord, she loves Horatio.

      This line crystallises the central conflict. My expectations were now convinced of: A jealousy plot danger for Horatio interference from powerful men Character impressions: Horatio - endangered hero Bel-imperia - active lover Lorenzo/Balthazar - potential antagonists

    1. Se necesita entrenamiento para pensar en las cosas en múltiples niveles de abstracción simultáneamente, y ese tipo de pensamiento es justo lo que se necesita para diseñar una excelente arquitectura de software.

      ¿Qué alternativas propone (explícita o implícitamente) el autor para mejorar la enseñanza?

    1. Note: This response was posted by the corresponding author to Review Commons. The content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      1. General Statements [optional]

      *We thank the reviewers for their insightful and constructive comments, which have substantially strengthened the manuscript. We have addressed all concerns and replaced the previous non-quantitative RNA-seq analysis with a new analysis that allowed for quantitative assessment. We were encouraged to find that the revised analysis not only confirmed our original observations but also reinforced and extended our conclusions. *

      2. Point-by-point description of the revisions

      Reviewer #1


      Significance

      Comment 1: At its current stage, this work represents a robust resource for molecular parasitology research programs, paving the way for mechanistic studies on multilayered gene expression control and it would benefit from experimental evidence for some of the claims concerning the in silico regulatory networks. Terms like "regulons", "recursive feedback loop" are employed without solid confirmation or extensive literature support. In my view, the most relevant contribution of this study is centered in the direct association between proteasome-dependent degradation and Leishmania differentiation.

      __Response: __We thank the reviewer to acknowledge the impact of our work as a robust resource for further mechanistic studies. We agree that the new concepts emerging from our multilayered analysis should be experimentally assessed. However, given the scope of our analysis (i.e. a complete systems-level analysis of bona fide, hamster-isolated L. donovani amastigotes and derived promastigotes) and the amount of data presented in the current manuscript, such functional genetic analysis will merit an independent, in-depth investigation. The current version has been very much toned down and modified to emphasize the impact of our work as a powerful new resource for downstream functional analyses.


      Evidence, reproducibility and clarity

      Comment 1: The narrative becomes somewhat diffuse with the shift to putative multilevel regulatory networks, which would benefit from further experimental validation.

      Response: We agree with the reviewer and toned down the general discussion while suggesting putative multilevel regulatory networks for follow-up, mechanistic analyses. We now emphasize those networks for which evidence in trypanosomatids and other organisms has been published. Experimental validation of some of these regulatory networks is outside the scope of our manuscript and will be pursued as part of independent investigations.

      Major issues

      Comment 1: Fig.1D suggests a significant portion of the SNPs are exclusive, with a frequency of zero in one of the two stages. Were only the heterozygous and minor alleles plotted in Fig.1D, since frequencies close to 1 are barely observed? Is the same true in Sup Fig. S2B? Why do chrs 4 and 33 show unusual patterns in S2B?

      __Response: __We thank the reviewer for this observation. The SNPs exclusive to either one or the other stage are likely the result of the 10% cutoff we use for this kind of analysis (eliminating SNPs that lack sufficient support, i.e. less than 10 reads). Due to bottle neck events (such as in vitro culture or stage differentiation), many low frequency SNPs are either 'lost' (filtered out) or 'gained' (passing the 10% cutoff) between the ama and pro samples. All SNPs above 10% were plotted. The absence of SNPs at 100% is one of the hallmarks of the Ld1S L. donovani strain we are using. Instead, these parasites show a majority of SNPs at a frequency of around 50%, which is likely a sign of a previous hybridization event. Chr 4 and chr 33 show a very low SNP density, most likely as they went through a transient monosomy at one moment of their evolutionary history, causing loss of heterozygosity. We now explain these facts in the figure legend.


      Comment 2: Chr26 revealed a striking contrasting gene coverage between H-1 and the other two samples. While a peak is observed for H-1 in the middle of this chr, the other two show a decrease in coverage. Is there any correlation with the transcriptomic/proteomic findings?

      Response: This analysis is based on normalized median read depth, taking somy variations into account. This is now more clearly specified in the figure legend. We do not see any significant expression changes that would correlate with the observed (minor) read depth changes. As indicated in the legend, we do not consider such small fluctuations (less than +/- 1,5 fold) as significant. The reversal of the signal for chr 26 sample H1 eludes us (but again, these fluctuations are minor and not observed at mRNA level).

      Comment 3: The term "regulon" is used somewhat loosely in many parts of the text. Evidence of co-transcriptomic patterns alone does not necessarily demonstrate control by a common regulator (e.g., RNA-binding protein), and therefore does not fulfill the strict definition of a regulon. It should be clear whether the authors are highlighting potential multiple inferred regulons within a list of genes or not. Maybe functional/ gene module/cluster would be more appropriate terms.

      Response: We thank the reviewer for this important comment. We replaced 'regulon' throughout the manuscript by 'co-regulated, functional gene clusters' (or similar).

      Comment 4: It is unclear whether the findings in Fig.3E are based on previous analysis of stage-specific rRNA modifications or inferred from the pre-snoRNA transcriptomic data in the current work or something else. I struggle to find the significance of presenting this here.

      __Response: __We thank the reviewer for this comment. Yes, these data show stage-specific rRNA modifications based on previous analyses that mapped stage-specific differences of pseudouridine (Y) (Rajan et al., Cell Reports 2023, DOI: 10.1016/j.celrep.2024.114203) and 2'-O-modifications (Rajan et al., Nature Com, in revision) by various RNA-seq analyses and cryoEM. This figure has been modified in the revised version to consider the identification of stage-regulated snoRNAs in our new and statistically robust RNA-seq analysis. These data are shown to further support the existence of stage-regulated ribosomes that may control mRNA translatability, as suggested by the enriched GO terms 'ribosome biogenesis', 'rRNA processing' and 'RNA methylation' shown in Figure 2. We better integrated these analyses by moving the panels from Figure 3 to Figure 2.

      Comment 5: The protein turnover analysis is missing the critical confirmation of the expected lactacystin activity on the proteasome in both ama and pro. A straightforward experiment would be an anti-polyUb western blotting using a low concentration SDS-PAGE or a proteasome activity assay on total extracts.

      Response: We thank the reviewer for this comment and have now included an anti-polyUb Western blot analysis (see Fig S7).

      Comment 6: The viability tests upon lactacystin treatment need a positive control for the PI and the YoPro staining (i.e., permeabilized or heat-killed promastigotes).

      Response: This control is now included in Fig S7 and we have added the corresponding description to the text.

      Comment 7: I found that the section on regulatory networks was somewhat speculative and less focused. Several of the associated conclusions are, in some parts, overstated, such as in "uncovered a similar recursive feedback loop" (line 566) or "unprecedented insight into the regulatory landscape" (line 643). It would be important to provide some form of direct evidence supporting a functional connection between phosphorylation/ubiquitination, ribosome biogenesis/proteins and gene expression regulation.

      Response: We agree with the reviewer and have considerably toned down our statements. Functional analyses to investigate and validate some of the shown network interactions are planned for the near future and will be published separately.

      Minor issues

      1) The ordinal transition words "First,"/"Second," are used too frequently in explanatory sections. I noted six instances. I suggest replacing or rephrasing some to improve flow.

      Response: Rectified, thanks for pointing this out.

      2) Ln 168: Unformatted citations were given for the Python packages used in the study.

      Response: Rectified, thanks for pointing this out.

      3) Fig.1D: "SNP frequency" is the preferred term in English.

      Response: Corrected.

      4) Fig.2A: not sure what "counts}1" mean.

      __Response: __This figure has been replaced.

      5) Ln 685: "Transcripts with FC 0.01 are represented by black dots" -> This sentence is inaccurate. The intended wording might be: "Transcripts with FC 0.01 are represented by black dots"

      Response: We thank the reviewer and corrected accordingly.

      6) Ln 698: Same as ln 685 mentioned above.

      Response: We thank the reviewer and corrected accordingly.

      7) Fig.2B and elsewhere: The legend key for the GO term enrichment is a bit confusing. It seems like the color scales represent the adj. p-values, but the legend keys read "Cluster efficiency" and "Enrichment score", while those values are actually represented by each bar length. Does light blue correspond to a max value of 0.05 in one scale, and dark blue to a max value of 10-7 in the other scale?

      Response: This was corrected in the figure and the legends were updated accordingly.

      8) Sup Figure S3A and S4A: The hierarchical clustering dendrograms are barely visible in the heatmaps.

      Response: Thanks for the comment. Figure S3 was removed and replaced by a hierarchical clustering and a PCA plot.

      9) S3A Legend: The following sentence sounds a bit awkward: "Rows and columns have been re-ordered thanks to a hierarchical clustering". I suggest switching "thanks to a hierarchical clustering" to "based on hierarchical clustering".

      Response: This figure was removed and the legend modified.

      10) Fig.5D: The font size everywhere except the legend key is too small. In addition, on the left panel, gene product names are given as a column, while on the right, the names are shown below the GeneIDs. Consistency would make it clearer.

      Response: Thank you, this is now rectified. To ensue readability, we reduced the number of shown protein kinase examples.



      Reviewer #2

      Evidence, reproducibility and clarity

      Comment 1: In the absence of riboprofiling the authors return to the RNA-seq to assess the levels of pre-Sno RNA (the role of the could be more explicitly stated).

      Response: We thank the reviewer for this comment. We moved the snoRNA analysis from Fig 3 to Fig 2 (see also the similar comment of reviewer 1), which better integrates and justifies this analysis. Based on the new and statistically robust RNA-seq analysis, the volcano plot showing differential snoRNA expression and possible ribosome modification has been adjusted (Figures 2C and D).

      __Comment 2: __The authors provide a clear and comprehensive description of the data at each stage of the results and this in woven together in the discussion allowing hypotheses to be formed on the potential regulatory and signalling pathways that control the differentiation of amastigotes to promastigotes. Given the amount and breadth of data presented the authors are able to present a high-level assessment of the processes that form feedback loops and/or intersectional signalling, but specific examples are not picked out for deeper validation or exploration.

      __Response: __We thank the reviewer to acknowledge the amount and breadth of data presented. As indicated above (see responses to reviewer 1), mechanistic studies will be conducted in the near future to validate some of the regulatory interactions. These will be subject of separate publications. As noted above (response to reviewer 1), we toned down the general discussion, suggest follow-up mechanistic analyses and emphasize those networks for which evidence in trypanosomatids and other organisms has been published.

      __ __ Major comments:

      Are the claims and the conclusions supported by the data or do they require additional experiments or analyses to support them?

      Comment 1: As I have understood it from the description in the text, and in Data Table 4, the RNA-seq element of the work has only been conducted using two replicates. If this is the case, it would substantially undermine the RNA-seq and the inferences drawn from it. Minimum replicates required for inferential analysis is 3 bio-replicates and potentially up to 6 or 12. It may be necessary for the authors to repeat this for the RNA-seq to carry enough weight to support their arguments. (PMID: 27022035)

      Response: We agree with the reviewer and conducted a new RNA-seq analysis with 4 independent biological replicates of spleen-purified amastigotes and derived promastigotes. Given the robustness of the stage-specific transcriptome, and the legal constrains associated with the use of animals, we chose to limit the number of replicates to the necessary. We thank the reviewer for this important comment, and the new data not only confirm the previous one (providing a high level of robustness to our data) but allowed us to increase the number of identified stage-regulated snoRNAs, thus further supporting a possible role of ribosome modification in Leishmania stage development.

      Comment 2: There are several examples that are given as reciprocal or recursive signalling pathways, but these are not followed up with independent, orthogonal techniques. I think the paper currently forms a great resource to pursue these interesting signalling interactions and is certainly more than just a catalogue of modifications, but to take it to the next level ideally a novel signalling interaction would be demonstrated using an orthogonal approach. Perhaps the regulation of the ribosomes could have been explored further (same teams recently published related work on this). Or perhaps more interestingly, a novel target(s) from the ubiquitinated protein kinases could have been explored further; for example making precision mutants that lack the ubiquitination or phosphorylation sites - does this abrogate differentiation?

      Response: We agree with the reviewer that the paper currently forms a great resource. In-depth molecular analysis investigating key signaling pathways and regulatory interactions are outside the scope of the current multilevel systems analysis but will be pursued in independent investigations.

      Comment 3: I found the use of lactacystin a bit curious as there are more potent and specific inhibitors of Leishmania proteasomes e.g. LXE-408. This could be clarified in the write-up (See below).

      __Response: __We thank the reviewer for this comment. We opted for the highly specific and irreversible proteasome inhibitor lactacystin that has been previously applied to study the Leishmania proteasome (PMID: 15234661) rather than the typanosomatid-specific drug candidate LXE408 as the strong cytotoxic effect of the latter makes it difficult to distinguish between direct effects on protein turnover and secondary effects resulting from cell death, limiting its utility for dissecting proteasome function in living parasites. We have added this information in the Results section.

      Comment 4: If it is the case that only 2 replicates of the RNA-Seq have been performed it really is not the accepted level of replication for the field. Most studies use a minimum of 3 bioreplicates and even a minimum of 6 is recommended by independent assessment of DESeq2.

      __Response: __See response to comment 1 above.


      Comment 5: As far as I could see, the cell viability assay does not include a positive control that shows it is capable of detecting cytotoxic effects of inhibitors. Add treatment showing that it can differentiate cytostatic vs cytotoxic compound.

      __Response: __This control has now been added to Fig S7.

      If you have constructive further reaching suggestions that could significantly improve the study but would open new lines of investigations, please label them as "OPTIONAL". Are the suggested experiments realistic in terms of time and resources? It would help if you could add an estimated time investment for substantial experiments.

      Comment 6: It is realistic for the authors to validate the cell viability assay. If the RNA-seq needs to be repeated then this would be a substantial involvement.

      Response: Redoing the RNA-seq analysis was entirely feasible and very much improved the robustness of our results.

      Are the data and the methods presented in such a way that they can be reproduced?

      Comment 7: All the methods are written to a good level of detail. The sample prep, acquisition and data analysis of the protein mass spectrometry contained a high level of detail in a supplemental section. The authors should be more explicit about the amount of replication at each stage, as in parts of the manuscript this was quite unclear.

      Response: We thank the reviewer for this comment and explicitly state the number of replicates in Methods, Results and Figure legends for all analyses. The number of replicates for each analysis is further shown in the overview Figure S1.

      Are the experiments adequately replicated and statistical analysis adequate?

      Comment 8: Unless I have misunderstood the manuscript, I believe the RNA-seq dataset is underpowered according to the number of replicates the authors report in the text.

      Response: See response to comment 1 above.

      Comment 9: Looking at Figure 1 and S1 and Data Table 4 to show the sample workflow I was surprised to see that the RNA-seq only used 2 replicates. The authors do show concordance between the individual biological replicates, but I would consider that only having 2 is problematic here, especially given the importance placed on the mRNA levels and linkage in this study. This would constitute a major weakness of the study, given that it is the basis for a crucial comparison between the RNA and protein levels.

      Response: We agree and have repeated the RNAseq analysis using four independent biological replicates - see response to comment 1.

      Comment 10: It also wasn't clear to me how many replicates were performed at each condition for the lactacystin treatment experiment - can the authors please state this clearly in the text, it looks like 4 replicates from Figure S1 and Data Table 8.

      Response: Indeed, we did 4 replicates. This is now clarified in Methods, Results and Figure legends and shown in Figure S1.

      Comment 11: Four replicates are used for the phosphoproteomics data set, which is probably ok, but other researchers have used a minimum of 5 in phosphoproteomics experiments to deal with the high level of variability that can often be observed with low abundance proteins & modifications. The method for the phosphoproteomics analysis suggests that a detection of a phosphosite in 1 sample (also with a localisation probability of >0.75) was required for then using missing value imputation of other samples. This seems like a low threshold for inclusion of that phosphosite for further relative quantitative analysis. For example, Geoghegan et al (2022) (PMID: 36437406) used a much more stringent threshold of greater than or equal to 2 missing values from 5 replicates as an exclusion criteria for detected phoshopeptides. Please correct me if I misunderstood the data processing, but as it stands the imputation of so many missing values (potentially 3 of 4 per sample category) could be reducing the quality of this analysis.

      Response: We thank the reviewer for this remark and for highlighting best practices in phosphoproteomics data analysis. Unlike other studies that use cultured parasites and thus have access to unlimited amounts, our study employs bona fide amastigotes isolated from infected hamster spleens. In France, the use of animals is tightly controlled and only the minimal number of animals to obtain statistically significant results is tolerated (and necessary to obtain permission to conduct animal experiments).

      Regarding the number of biological replicates, we would like to emphasize that the use of four biological replicates is fully acceptable and used in quantitative proteomics and phosphoproteomics, particularly when combined with high-quality LC-MS/MS data and stringent peptide-level filtering. While some studies indeed employ five or more replicates, this is not a strict requirement, and many high-impact phosphoproteomics studies have successfully relied on four replicates when experimental quality and depth are high. In the present study, we adopted a discovery-oriented approach, aimed at detecting as many confidently identified phosphopeptides as possible. The consistency between replicates, combined with the depth of coverage and signal quality, indicates that four replicates are adequate for both the global proteome and the phosphoproteome in this context. Importantly, the quality of the MS data in this study is supported by (i) a high number of confidently identified peptides and phosphopeptides (identification FDR0.75), and (iii) reproducible quantitative profiles across replicates. Notably, most of the identified phosphopeptides are quantified in at least two replicates within a given condition (between 73.2% and 83.4% of all the identified phosphopeptides among replicates of the same condition).

      Regarding missing value imputation, we appreciate that our initial description may have been unclear and we have revised the Methods to avoid misunderstanding. Phosphosites were only considered if detected with high confidence (identification FDR0.75) in at least one replicate. This criterion was chosen to retain biologically relevant, low-abundance phosphosites, which are more difficult to identify and are often stochastically sampled in phosphoproteomics datasets. For statistical analyses, missing values within a given condition were imputed with a well-established algorithm (MLE) only when at least one observed value was present in that condition. Notably, they were replaced by values in the neighborhood of the observed intensities, rather than by globally low, noise-like values.

      We agree that more stringent exclusion rules, such as those used by Geoghegan et al. (2022), are appropriate in some contexts. However, there is no universally accepted standard for missingness thresholds in phosphoproteomics, and different strategies reflect trade-offs between sensitivity and stringency. In our discovery-oriented approach, we deliberately prioritized biological coverage while maintaining data quality. Our main conclusions are supported by coherent biological patterns, rather than by isolated phosphosite measurements.


      Comment 12: For the metabolomics analysis it looks like 2 amastigote samples were compared against 4 promastigote samples. Why not triplicates of each?

      Response: We thank the reviewer for noticing this point. It is an error in the figure file (Sup figure S1). Four biological replicates of splenic amastigotes were prepared (H130-1, H130-2, H133-1 and H133-2). Amastigotes from 2 biological replicates (H131-1 and H131-2) were seeded for differentiation into promastigotes in 4 flasks (2 per biological replicate) that were collected at passage 2. We have updated the figure file accordingly.

      Minor comments:

      __ __Specific experimental issues that are easily addressable. Are prior studies referenced appropriately?

      * *Comment 1: Yes

      Are the text and figures clear and accurate?

      * *Comment 2: The write up is clear, with the data presented coherently for each method. The analyses that link everything together are well discussed. The figures are mostly clear (see below) and are well described in the legends. There is good use of graphics to explain the experimental designs and sample names - although it is unclear if technical replicates are defined in these figures.

      Response: We thank the reviewer for these positive comments. We now included the information on replicates in the overview figure (Figure S1).

      Do you have suggestions that would help the authors improve the presentation of their data and conclusions?

      Comment 3: As I have understood it, the authors have calculated the "phosphostoichiometry" using the ratio of change in the phosphopeptide to the ratio of the change in total protein level changes. This is detailed in the supplemental method (see below). Whilst this has normalised the data, it has not resulted in an occupancy or stoichiometry measurement, which are measured between 0-1 (0% to 100%). The normalisation has probably been sufficient and useful for this analysis, but this section needs to be re-worded to be more precise about what the authors are doing and presenting. These concepts are nicely reviewed by Muneer, Chen & Chen 2025 (PMID: 39696887) who reference seminal papers on determination of phosphopeptide occupancy - and may be a good place to start. An alternative phrase should be used to describe the ratio of ratios calculated here, not phosphostoichiometry.

      Response: We thank the reviewer for this insightful comment and fully agree with the conceptual distinction raised. The reviewer is correct that the approach used in this study does not measure absolute phosphosite occupancy or stoichiometry, which would indeed require dedicated experimental strategies and would yield values bounded between 0 and 1 (0-100%). Instead, we calculated a normalized phosphorylation change, defined as the ratio of the change in phosphopeptide abundance relative to the change in the corresponding total protein abundance (a ratio-of-ratios approach - see doi :10.1007/978-1-0716-1967-4_12), and we tested whether this normalized phosphorylation change differed significantly from zero. This normalization approach is comparable to those previously published in the « Experimental Design and Statistical Analysis of the Proteome and the Phosphoproteome » section of the following paper (DOI: 10.1016/j.mcpro.2022.100428).

      Our intention was to account for protein-level regulation and thereby better isolate changes in phosphorylation dynamics. While this normalization is informative and appropriate for the biological questions addressed here, we agree that the term "phosphostoichiometry" is imprecise and not correct in this context.

      In response, we (i) replaced the term "phosphostoichiometry" throughout the manuscript with a more accurate description, such as "normalized phosphorylation level", or "relative phosphorylation change normalized to protein abundance", and (ii) revised the corresponding Methods and Results text to clearly state that absolute occupancy was not measured.

      This rewording will improve conceptual accuracy without altering the validity or interpretation of the results.

      Comment 4: From the authors methods describing the ratio comparison approach: "Another statistical test was performed in a second step: a contrasted t-test was performed to compare the variation in abundance of each modified peptide to the one of its parent unmodified protein using the limma R package {Ritchie, 2015; Smyth, 2005}. This second test allows determining whether the fold-change of a phosphorylated peptide between two conditions is significantly different from the one of its parent and unmodified protein (paragraph 3.9 in Giai Gianetto et al 2023). An adaptive Benjamini-Hochberg procedure was applied on the resulting p-values thanks to the adjust.p function of R package cp4p {Giai Gianetto, 2016} using the Pounds et al {Pounds, 2006} method to control the False Discovery Rate level."

      Response: The references have been formatted.

      Comment 5: Several aspects of the figures that contain STRING networks are quite useful, particularly the way colour around the circle of each node to denote different molecular functions/biological processes. However, some have descended into "hairball" plots that convey little useful information that would be equally conveyed in a table, for example. Added to this, the points on the figure are identified by gene IDs which, while clear and incontrovertible, are lacking human readability. I suggest that protein name could be included here too.

      Response: We thank the reviewer for this comment but for readability we opted to keep the figure as is. We now refer to Tables 8, 9, and 12 that allow the reader to link gene IDs to protein name and annotation (if available).

      Comment 6: It is also not clear what STRING data is being plotted here, what are the edges indicating - physical interactions proven in Leishmania, or inferred interactions mapped on from other organisms? Perhaps as supplemental data provide the Cytoscape network files so readers can explore the networks themselves?

      Response: We thank the reviewer for this comment. While the STRING plugin in Cytoscape enables integrated network-based analyses, it represents protein-protein associations as a single edge per protein pair derived from the combined confidence score. Consequently, the specific contribution of individual evidence channels (e.g. experimental evidence, curated databases, co-expression, or text mining) cannot be disentangled within this framework. However, this representation was considered appropriate for the present study, which focused on global network topology and functional enrichment rather than on the interpretation of individual interaction types. The information on stringency has been added to the Methods section and the Figure legends (adding the information on confidence score cutoff).

      We decided not to submit the Cytoscape files as they were generated with previous versions of Cytoscape and the STRING plugin. Based on the differential abundance data shown in the tables it will be very easy to recreate these networks with the new versions for any follow up study.

      Comment 7: The title of columns in table S10 panel A are written in French, which will be ok for many people particularly those familiar with proteomics software outputs, but everything else is in English so perhaps those titles could be made consistent.

      __Response: __We apologize and have translated the text in English.

      Comment 8: I would suggest that the authors provide a table that has all the gene IDs of the Ld1S2D strain and the orthologs for at least one other species that is in TriTrypDB. This would make it easy to interrogate the data and make it a more useful resource for the community who work on different strains and species of Leishmania. Although this data is available it is a supplemental material file in a previous paper (Bussotti et al PNAS 2021) and not easy to find.

      Response: We thank the reviewer for this very useful suggestion and have added this table (Table S13).

      Comment 9: Figure 5b - from the legend it is not clear where the confidence values were derived in this analysis, although this is explained in the supplemental method. Perhaps the legend can be a bit clearer.

      Response: We have the following statement to the legend: 'Confidence values were derived as described in Supplementary Methods'.

      Comment 10: Can the authors discuss why lactacystin was used? While this is a commonly used proteasome inhibitor in mammalian cells there is concern that it can inhibit other proteases. At the concentrations (10 µM) the authors used there are off-target effects in Leishmania, certainly the inhibition of a carboxypeptidase (PMID: 35910377) and potentially cathepsins as is observed in other systems (PMID: 9175783). There is a specific inhibitor of the Leishmania proteasome LXE-408 (PMID: 32667203), which comes closer to fulfilling the SGC criteria (PMID: 26196764) for a chemical probe - why not use this. Does lactacystin inhibit a different aspect of proteasome activity compared to LXE-408?

      Response: We have add the following justification to the results section (see also response above to comment 3 for reviewer 2): We chose the highly specific and irreversible proteasome inhibitor lactacystin over the typanosomatid-specific, reversible drug candidate LXE408 as the latter's potent cytotoxicity can confound direct effects on protein turnover with secondary consequences of cell death, limiting its utility for dissecting proteasome function in living parasites.

      Comment 11: The application of lactacystin is changing the abundance of a multitude of proteins but no precision follow up is done to identify if those proteins are necessary and/or sufficient from driving/blocking differentiation. This could be tested using precision edited lines that are unable to be ubiquitinated? There is a lack of direct evidence that the proteins protected from degradation by lactacystin are ubiquitinated? Perhaps some of these could be tagged and IP'd then probed for ubiquitin signal. Di-Gly proteomics to reveal ubiquitinated proteins? These suggestions should be considered as OPTIONAL experiments in the relevant section above.

      Response: We very much appreciate these very interesting suggestions, which we will be considered for ongoing follow-up studies.

      Comment 12: In the data availability RNA-seq section the text for the GEO link is : (https://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc= GSE227637) but the embedded link takes me to (https://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE165615) which is data for another, different study. Also, the link to the GEO site for the DNA seq isn't working and manual searches with the archive number (BioProject PRJNA1231373 ) does not appear to find anything. The IDs for the mass spec data PRIDE/ProteomeXchange don't seem to bring up available datasets: PXD035697 and PXD035698

      Response: The links have now been rectified and validated. For those data that are still under quarantine, here is the login information: To access the data:

      DNAseq data: https://dataview.ncbi.nlm.nih.gov/object/PRJNA1231373?reviewer=6qt24dd7f475838rbqfn228d0

      RNAseq data:

      https://www.ebi.ac.uk/biostudies/ArrayExpress/studies/E-MTAB-16528?key=65367b55-d77f-4c06-b4bd-bc10f2dc0b14

      Proteomic data: http://www.ebi.ac.uk/pride

      __Username: __reviewer_pxd035698@ebi.ac.uk

      __Password: __gOIcRx0g

      Phosphoproteomic data: http://www.ebi.ac.uk/pride

      __Username: __reviewer_pxd035697@ebi.ac.uk

      __Password: __7GWtBmvx

      Significance Provide contextual information to readers (editors and researchers) about the novelty of the study, its value for the field and the communities that might be interested. The following aspects are important:

      * General assessment: provide a summary of the strengths and limitations of the study. What are the strongest and most important aspects? What aspects of the study should be improved or could be developed?*

      Strengths: Comment 1: The molecular pathways that regulate Leishmania life-stage transitions are still poorly understood, with many approaches exploring single proteins/RNAs etc in a reductionist manner. This paper takes a systems-scale approach and does a good job of integrating the disparate -omics datasets to generate hypotheses of the intersections of regulatory proteins that are associated with life-cycle progression.

      Response: We thank the reviewer for this positive assessment of our work.

      Comment 2: The differentiation step studied is from amastigote to promastigote. I am not aware that this has been studied before using phosphoproteomics. The use of the hamster derived amastigotes is a major strength. While a difficult/less common model, the use of hamsters permits the extraction of parasites that are host adapted and represent "normal", host-adapted Leishmania ploidy, the promastigote experiments are performed at a low passage number. This is a strength or the work as it reduces the interference of the biological plasticity of Leishmania when it is cultured outside the host.

      Response: We thank the reviewer for the acknowledgment of our relevant hamster system, for which we face many challenges (financial, ethical, administrative as protocols need to be approved by the French government).

      Limitations: __ __Comment 1: Potential lack of appropriate replication (see above).

      Response: See response to comment 1.

      Comment 2: Lack of follow up/validation of a novel signalling interaction identified from the systems-wide approach. There is a lack of assessment of whether a single signalling cascade is driving the differentiation or these are all parallel, requisite pathways. The authors state the differentiation is not driven by a single master regulator, but I am not sure there is adequate evidence to rule this in or out.

      Response: See response to comment 2 above.

      Advance: compare the study to the closest related results in the literature or highlight results reported for the first time to your knowledge; does the study extend the knowledge in the field and in which way? Describe the nature of the advance and the resulting insights (for example: conceptual, technical, clinical, mechanistic, functional,...).

      Comment 3: The study applies well established techniques without any particular technical step-change. The application of large-scale multi-omics techniques and integrated comparisons of the different experimental workflows allow a synthesis of data that is a step forward from that existing in the previous Leishmania literature. It allows the generation of new hypotheses about specific regulatory pathways and crosstalk that potentially drive, or are at least active, during amastigote>promastigote differentiation.

      Response: We thank the reviewer for these positive comments.

      *Audience: describe the type of audience ("specialized", "broad", "basic research", "translational/clinical", etc...) that will be interested or influenced by this research; how will this research be used by others; will it be of interest beyond the specific field? * This manuscript will have primary interest to those researchers studying the molecular and cell biology of Leishmania and other kinetoplastid parasites. The approaches used are quite standard (so not so interesting in terms of methods development etc.) and given the specific quirks of Leishmania biology it may not be that relevant to those working more broadly in parasites from different clades/phyla, or those working on opisthokont systems- yeast, humans etc. Other Leishmania focused groups will surely cherry-pick interesting hits from this dataset to advance their studies, so this dataset will form a valuable reference point for hypothesis generation.

      Response: We thank the reviewer for this assessment and agree that our data sets will be very valuable for us and other teams to generate hypotheses for follow-up studies.

      Please define your field of expertise with a few keywords to help the authors contextualize your point of view. Indicate if there are any parts of the paper that you do not have sufficient expertise to evaluate.

      Relevant expertise: Trypanosoma & Leishmania molecular & cell biology, RNA-seq, proteomics, transcriptional/epigenetic regulation, protein kinases - some experience of UPS system.

      I have not provided comment on the metabolomics as it is outside my core expertise. However, I can see it was performed at one of the leading parasitology metabolomics labs.

      Response: We thank the reviewer for sharing expertise, investing time and intelligence in the assessment of our manuscript, and the highly constructive criticisms provided.


      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      __Summary: __The study presents a comprehensive multi-omics investigation of Leishmania differentiation, combining genomic, transcriptomic, proteomic, phospho-proteomic and metabolomic data. The authors aim to uncover mechanisms of post-transcriptional and post-translational regulation that drive the stage-specific biology of L. donovani. The authors provide a detailed characterization of transcriptomic, proteomic, and phospho-proteomic changes between life stages, and dissect the relative contributions of mRNA abundance and protein degradation to stage-specific protein expression. Notably, the study is accompanied by comprehensive supplementary materials for each molecular layer and provides public access to both raw and processed data, enhancing transparency and reproducibility. While the data are rich and compelling, several mechanistic interpretations (e.g., "feedback loops," "recursive networks," "signaling cascades") are overstated. Similarly, the classification of gene sets as "regulons" is not adequately supported, as no common regulatory factor has been identified and only a single condition change (amastigote to promastigote) was assessed.

      __Response: __We thank the reviewer for these comments and have corrected the manuscript to eliminate all unjustified mechanistic interpretations.

      Major Comments:


      Comment 1:__ Across several sections (incl abstract, L559-565, L589-599, L600-L603, L610-612, L613-614, L625, L643-645, L650-652), the manuscript describes "recursive or self-controlling networks", "signaling cascades", "self-regulating", and "recursive feedback loops" - involving protein kinases, phosphatases, and translational regulators. While the data convincingly demonstrate stage-specific changes in phosphorylation and abundance changes in key molecules, the language used implies causal, direct and directional regulatory relationships that have not been experimentally validated.

      Response: __We agree with the reviewer and have corrected the text, replacing all expressions that may allude to causal or directional relationships by more neutral expressions such as 'co-expression'. __

      Comment 2: Co-expression and shared function alone do not define a regulon (L363, and several other places in the manuscript). A regulon also requires the gene set to be regulated by the same factor, for which there is no evidence here. Regulons can be derived from transcriptomic experiments, but then they need to show the same transcriptional behavior across many biological conditions, while here just 1 condition change is evaluated. Therefore, this analysis is conventional GO enrichment analysis and should not be overinterpreted into regulons.

      __Response: __We agree with the reviewer and have replaced 'regulon' with 'co-regulated gene clusters' (or similar).

      Comment 3: LFQ intensity of 0 (e.g., L389): An LFQ intensity of 0 does not necessarily indicate that a protein is absent, but rather that it was not detected. This can occur for several reasons: (1) true biological absence in one condition, (2) low abundance below the detection threshold, or (3) stochastic missingness due to random dropout in mass spectrometry. While the authors state that adjusted p-values for the 1534 proteins exclusively detected in either amastigotes or promastigotes are below 0.01, I could not find corresponding p-values for these proteins in Table 8 ('Global_Proteomic'). An appropriate statistical method designed to handle this type of missingness should be used. In this context, I also find the following statement unclear: "identified over 4000 proteins at each stage in at least 3 out of 4 biological replicates, representing 3521 differentially expressed proteins (adjusted p-value Response: We fully agree with the reviewer, an LFQ intensity of 0 may results from various reasons. We realize that our wording may have been ambiguous. For clarity, we have modified the original text to: 'Label-free quantitative proteomic analysis of 4 replicates of amastigotes and derived promastigotes identified over 4000 proteins, including 1987 differentially expressed proteins (adjusted p-value<br /> Comment 4: L412 - Figure 3B: The figure shows proteins with infinite fold changes, which result from division by zero due to LFQ intensity values of zero in one of the compared conditions. As previously noted, interpreting LFQ zero values as true absence of expression is problematic, since these zeros can arise from several technical reasons - such as proteins being just below the detection threshold or due to stochastic dropout during MS analysis. Therefore, the calculated fold changes for these proteins are likely highly overestimated. This concern is visually supported by the large gap on the y-axis (even in log scale) between these "infinite" fold changes and the rest of the data. Moreover, given Leishmania's model of constitutive gene expression, it seems biologically implausible that all these proteins would be completely absent in one stage. This issue applies not only to Figure 3B, but also to the analyses presented in Figures 4D and 4E.

      Response: __We thank the reviewer for this comment. To clarify this section, we modified the text as follows: 'Only expression changes were considered that either showed statistically significant differential abundance at both RNA and protein levels (p <br /> __Minor Comments:

      Methods L132: Typo: "A according" should be "according."

      __Response: __The 'A' refers to RNase A. We added a comma for clarification (...RNase A, according to...)

      L158: How exactly were somy levels calculated? Please specify the method used, as I could not find a clear description in the referenced manuscript.

      __Response: __We thank the reviewer for this comment. Aside the already quite detailed description in Methods and the reference there to the paper describing the pipeline, we now added a link to the description of the karyotype module of the giptools package (https://gip.readthedocs.io/en/latest/giptools/karyotype.html). There the following explanation can be found: "The karyotype module aims at comparing the chromosome sequencing coverage distributions of multiple samples. This module is useful when trying to detect chromosome ploidy differences in different isolates. For each sample the module loads the GIP files with the bin sequencing coverage (.covPerBin.gz files) and normalizes the meancoverage values by the median coverage of all bins. The bin scores are then converted to somy scores which are then used for producing plots and statistics." The description then goes into further detail.

      L158: Chromosome 36 is not consistently disomic, as stated. It has been observed in other somy states (e.g., Negreira et al. 2023, EMBO Reports, Figure 1), even if such occurrences are rare in the studied context. Normalizing by chr36 remains a reasonable choice, but it would be helpful to confirm that the majority of chromosomes appear disomic post-normalization to support the assumption that chr36 is disomic in this dataset as well.

      __Response: __We thank the reviewer for this comment. Unlike the paper cited above (using long-term cultured promastigotes), our analysis uses promastigote parasites from early culture adaptation (p2) that were freshly derived from splenic amastigotes known to be disomic (and confirmed here), which represents an internal control validating our analysis.

      L163: Suggestion: Cite the GIP pipeline here rather than delaying the reference until L173.

      Response: corrected

      L188: "Controlled" may be a miswording. Consider replacing with "confirmed" or "validated."

      Response: corrected to 'validated'

      L214: Please specify which statistical test was used to assess differential expression at the protein level. L227: Similarly, clarify which statistical test was applied for determining differential expression in the phospho-proteomics data.

      Response: As noted in the Methods section, a limma t-test was applied to determine proteins/phosphoproteins with a significant difference in abundance while imposing a minimal fold change of 2 between the conditions to conclude that they are differentially abundant {Ritchie, 2015; Smyth, 2005}.

      __Results __ L337-339: The interpretation here is too speculative. Phrases like "suggesting" and "likely" are too strong given the evidence presented. Alternative explanations, such as mosaic variation combined with early-stage selective pressure in the culture environment, should be considered.

      Response: We thank the reviewers for these suggestions and have reformulated into: 'In the absence of convergent selection, it is impossible to distinguish if these gene CNVs provide some strain-specific advantage or are merely the result of random genetic drift.'

      L340: The "undulating pattern" mentioned is somewhat subjective. To support this interpretation, consider adding a moving average (or similar) line to Figure 3A, which would more clearly highlight this trend across the data points.

      Response: These lines have been added to Figure 1C (not 3A).

      L356: It may be more accurate to say "control of individual gene expression," since Leishmania does have promoters - the key distinction is that initiation does not occur on a gene-by-gene basis.

      Response: corrected

      L403-405: The statement "this is because these metabolites comprise a glycosomal succinate shunt..." should be rephrased as a hypothesis rather than a definitive explanation, as this causal link has not been experimentally validated.

      Response: Thank you for the comment - we followed your advice.

      L407: Replace "confirming" with "matching" to avoid overstating the agreement with previous observations.

      Response: corrected

      L408: Replace "correlated" with "matched" for more accurate interpretation of results.

      Response: corrected

      L433: It is unclear how differential RNA modifications were detected. Please specify which biological material was used, the number of replicates per life stage, and how statistical evaluation of differential modifications was performed.

      Response: This figure has now been updated using our statistically robust RNA-seq analysis conducted for the revision. See comments above.

      L436: This conclusion appears incomplete. While the manuscript mentions transcript-regulated proteins, it should also note that other proteins showed discordant mRNA/protein patterns. A more balanced conclusion would mention both the matching and non-matching subsets.

      Response: We thank the reviewer for this comment and have made the necessary adjustments to better balance this conclusion.

      L441: The phrase "poor correlation" overgeneralizes and lacks nuance. Earlier sections of the manuscript describe hundreds of genes where mRNA and protein levels correlate well, suggesting that mRNA turnover plays a key regulatory role. Please rephrase this sentence to clarify that poor correlation applies only to a subset of the data.

      Response: This has been corrected to 'The discrepancies we observed in a sub-set of genes between....'.

      L454: The claim that "epitranscriptomic regulation and stage-adapted ribosomes are key processes" should be supported with references. If this builds on previously published work, please cite it accordingly.

      Response: corrected

      L457: Proteasomal degradation is a well-established mechanism in Leishmania. These findings are interesting but should be presented in the context of existing literature (e.g. Silva-Jardim et al.2014, [PMID: 15234661]) rather than as entirely novel.

      Response: corrected

      L459: The authors shoumd add a microscopy image of promastigotes treated with lactacystin. This would provide insight into whether treatment affects morphology, as is known in T. cruzi (see Dias et al., 2008). It would be particularly informative if Leishmania behaves differently.

      Response: We added this information to Figure S7.

      L472 + L481: Table 9 shows several significant GO terms not discussed in the manuscript. Please clarify how the subset presented in the text was selected.

      Response: We added this information to the text ('some of the most significantly enrichment terms included ...').

      L482: The argument that a single master regulator can be excluded is unclear. Could the authors please elaborate on the reasoning or data supporting this conclusion?

      Response: This statement was too speculative and has been removed. Instead, we added 'Thus, Leishmania differentiation correlates with the expression of complex signaling networks that are established in a stage-specific manner'.

      L494: The term "unexpected" may not be appropriate here, as protein degradation is a well-established regulatory mechanism in trypanosomatids. Consider omitting this term to better reflect the field's current understanding.

      Response: We deleted the term as suggested and reformulated to '....our results confirm the important role of protein degradation....'.

      L543: The term "feedback loop" should be used more cautiously. The current data are correlative, and no interventional experiments are provided to support a causal regulatory loop between proteasomal activity and protein kinases. As such, this remains a hypothesis rather than a confirmed mechanism.

      Response: We fully agree and have toned down the entire manuscript, referring to feedback loops only as a hypothesis and not as a fact emerging from our datasets, which set the stage for future functional analyses.

      __Discussion __ L555: As noted in L494, reconsider using the word "unexpected."

      Response: removed

      L589: The data do not fully support the presence of stage-specific ribosomes. Rather, they suggest differential ribosomal function through changes in abundance and regulation. Please consider rephrasing.

      Response: We thank the reviewer for this comment and have follow the advice reformulating the sentence according to the suggestion.

      L657-658: The discussion of post-transcriptional and post-translational regulation of gene dosage effects would benefit from citing additional literature beyond the authors' own work. E.g. the study by Cuypers et al. (PMID: 36149920) offers a relevant and comprehensive analysis covering 4 'omic layers.

      Response: We apologize for this omission and now describe and cite this publication in the Results section when concluding the results shown in Figure 1.

      L659-664: The reference to deep learning for biomarker discovery appears speculative and loosely connected to the current findings. As no such methods were applied in the study, and the manuscript does not clarify what types of biomarkers are intended, this statement could be seen as aspirational rather than evidence-based. Consider either omitting or elaborating with clear justification.

      Response: We agree and have deleted this section.

      L690 + L705 (Figure 2): The phrase "main GO terms" is vague. Please clarify the criteria for selecting the GO terms shown - were they chosen based on adjusted p-value, enrichment score, or another metric? Additionally, define "cluster efficiency," explaining how it was calculated and what it represents.

      Response: Corrected to 'some of the most significantly enriched GO terms'.

      Signed: Bart Cuypers, PhD

      **Referee cross-commenting**

      Overall, I think the other reviewers' comments are fair. They seem to align particularly on the following points:

      1) Reviewers agree that this is a comprehensive body of work with original contributions to the field of Leishmania/trypanosomatid molecular biology, and that it will serve as a valuable reference for hypothesis generation.

      2) Several reviewers raise concerns about overinterpretation of the data, particularly regarding regulatory networks, regulons, and master regulators. The interpretation and large parts of the discussion are considered too speculative without additional functional validation.

      3) There are comments about the incorrect statistical treatment of missing values in the proteomics experiments, which affects confidence in some of the conclusions.

      4) While the correlation between the two RNA-Seq replicates is high, the decision to include only two biological replicates is seen as unfortunate and not ideal for statistical robustness.

      5) The use of lactacystin should be more clearly motivated, and its limitations discussed in the context of the experiments.

      Even though I did not remark on the last two points (4 and 5) in my own review, I agree with them.

      Response: We thank the reviewer for this cross-comparison, which served us as guide to revise our manuscript. We believe that we have responded to all these concerns.

      Reviewer #3 (Significance (Required)):


      This study provides a rich, integrative multi-omics dataset that advances our understanding of stage-specific adaptation in the transcriptionally unique parasite Leishmania. By dissecting the relative contributions of mRNA abundance and protein turnover to final protein levels across life stages, the authors offer valuable insights into post-transcriptional and post-translational regulation. The work represents a resource-driven yet conceptually informative contribution to the field, with comprehensive supplementary materials and transparent data sharing standing out as additional strengths.

      However, the mechanistic insights proposed are speculative in several places and require more cautious language. The study is most impactful as a resource and descriptive atlas, initiating hypotheses for future validation. The broad scientific community working on Leishmania, trypanosomatids, and post-transcriptional regulation in eukaryotes would benefit from this work.

      Response: We thank the reviewer for this positive assessment and have modified the manuscript to further emphasize its strength as an important resource to incite mechanistic follow-up studies.

      Field of reviewer expertise: multi-omics integration, bioinformatics, molecular parasitology, transcriptomics, proteomics, metabolomics, Leishmania, Trypanosoma.

      Reviewer #4 (Evidence, reproducibility and clarity (Required)): __ __Summary:

      This study investigates the regulatory mechanisms underlying stage differentiation in Leishmania donovani, a parasitic protist. Pesher et al., aim to address the central question of how these parasites establish and maintain distinct life cycle stages in mostly the absence of transcriptional control. The authors employed a five-layered systems-level analysis comparing hamster-derived amastigotes and their in vitro-derived promastigotes. From those parasites, they performed a genomic, transcriptomic, proteomic, metabolomic and phosphoproteomic analysis to reveal the changes the parasites undertook between the two life stages.

      The main conclusion stated by the authors are:

      • The stage differentiation in vitro is largely independent of major changes in gene dosage or karyotype.
      • RNA-seq analysis identified substantial stage-specific differences in transcript abundance, forming distinct regulons with shared functional annotations. Amastigotes showed enrichment in transcripts related to amastins and ribosome biogenesis, while promastigotes exhibited enrichment in transcripts associated with ciliary cell motility, oxidative phosphorylation, and post-transcriptional regulation itself.

      • Quantitative phosphoproteome analysis revealed a significant increase in global protein phosphorylation in promastigotes. Normalizing phosphorylation changes against protein abundance identified numerous stage-specific phosphoproteins and phosphosites, indicating that differential phosphorylation also plays a crucial role in establishing stage-specific biological networks. The study identified recursive feedback loops (where components of a pathway regulate themselves) in post-transcriptional regulation, protein translation (potentially involving stage-specific ribosomes), and protein kinase activity. Reciprocal feedback loops (where components of different pathways cross-regulate each other) were observed between kinases and phosphatases, kinases and the translation machinery, and crucially, between kinases and the proteasomal system, with proteasomal inhibition disrupting promastigote differentiation.

      Response: We thank the reviewer for the time and implication dedicated to our manuscript.

      Comments:

      Further details are organised by order of apparition in the text:

      Comment 1: Material and Methods: while the authors are indicating some key parameters, providing the codes and scripts they used throughout the manuscript would improve reproducibility.

      Response: We thank the reviewer for this comment and added the URL for the codes to the data availability section.

      Comment 2: Why only 2 biological replicates for RNA while the others layers have 3 or 4?

      __Response: __We agree with the other reviewers and have repeated this analysis to have statistically more robust results.

      Comment 3: Is the slight but reproducible increase in median coverage observed for chr 1, 2, 3, 4, 6 and 20 stable on longer culture derived promastigotes and sandfly derived promastigotes ?

      Response: No, as published in Barja et al Nature EcolEvol 2017 (PMID: 29109466) and Bussotti et al PNAS 2023 (PMID: 36848551), these minor fluctuations are not predicting subsequent aneuploidies in long-term culture nor in sand fly-derived promastigotes. This information has been added to the text.

      Comment 4: Is this change of ploidy a culture adaptation representation rather than a life cycle event as the authors discuss later on? (This is probably an optional request that would be nice to include, if the authors have performed the sequencing of such parasites. Otherwise, it should be mentioned in the discussion).

      __Response: __Yes, this is a well-known culture adaptation phenomenon, on which we have published extensively. We added this conclusion and the references to the text.

      Comment 5: L333 "Likewise, stage differentiation was not associated with any major gene copy number variation (Figure 1C, Table 2)". The authors are looking here at steady differentiated stages rather than differentiation itself. "Likewise, stage differentiation was.." would be more appropriate.

      __Response: __We corrected this sentence to 'Likewise, differentiation of promastigotes was not associated with any major gene copy number variation at early passage 2'.

      Comment 6: L349-355: have the mRNA presenting change in abundance between stages been normalised by their relative DNA abundance ? Said otherwise, can the wave patterns observed at the genome level explain the respective mRNA level ? Can the authors plot in a similar way the enrichment scores in regards to the position on the genome and can the authors indicate if there is a positional enrichment in addition to the functional one they observe ? This may affect the conclusion in L356-358.

      Response: As noted above, we did not see any significant read depth changes at DNA level when comparing amastigotes and promastigotes. Thus there is no need to normalize the RNA-seq results to DNA read depth. Furthermore, in our comparative transcriptomics analysis, we only consider 2-fold or higher changes in mRNA abundance (which is far beyond the non-significant read depth change we have observed on DNA level). Manual inspection of the enrichment scores with respect to position did not reveal any significant signal (other than revealing some over-represented tandem gene arrays where all gene copies share the same location and GO term).

      Comment 8: L415 "stage-specific expression changes correlate between protein and RNA levels, suggesting that the abundance of these proteins is mainly regulated by mRNA turn-over". Overstatement. Correlation does not suggest causation. "suggesting that the abundance of these proteins could be regulated by mRNA turn-over" would be more appropriate.

      Response: We thank the reviewer for this comment and have corrected the statement accordingly.

      Comment 9: Figure 3B, could the authors clarify what are the "unique genes" that are on the infinite quadrants? It seems these proteins are identified in one stage and not the other. This implies that the corresponding missing values are missing non-at random (MNAR). Rather than removing those proteins containing NMAR from the differential expression analysis, the authors should probably impute those missing values. Methods of imputation of NMAR and MAR can be found in the literature. Indeed, the level of expression in one stage of those proteins is now missing, while it could strongly affect the conclusions the authors are drawing in figure 4E regarding the proteins targeted for degradation and rescued in presence of the proteasome inhibitor.

      Response: We thank the reviewer for this important comment. However, we would like to clarify several key points regarding the treatment of proteins identified in only one condition.

      First, the reviewer assumes that proteins identified in one stage but not the other are necessarily missing not-at-random (MNAR). However, this cannot be definitively established, as these missing values could equally be missing completely at random (MCAR). Without additional information, categorizing them specifically as MNAR may be an oversimplification. More importantly, we have concerns about the reliability of imputation methods in this specific context. Algorithms designed to impute MNAR values (such as QRILC) replace absent data using random sampling from arbitrary probability distributions, typically assuming low intensity values. However, when no intensity value has been detected or quantified for a protein in a given condition, imputing an arbitrary low value raises significant concerns about data interpretation. Such imputed values would not reflect actual measurements but rather statistical assumptions that could introduce bias into downstream analyses. For instance, imputed values could lead to the conclusion that a protein is not differentially abundant, when in reality it is detected in one condition but completely absent in the other. In our view, there are two biologically plausible scenarios: either these proteins are expressed at levels below our detection threshold, or they are genuinely absent (or present at negligible levels) in the corresponding stage. Rather than introducing potentially misleading imputed values, we chose to treat these as genuine stage-specific differences (presence/absence), which results in infinite fold-changes in Figure 3B. Critically, our approach is strongly supported by independent validation through RNA-seq data, which corroborates the differential presence/absence patterns observed at the protein level. Furthermore, our enrichment analyses reveal significant over-representation of specific biological terms among these stage-specific proteins, providing biological coherence to these findings. These converging lines of evidence (proteomics, transcriptomics, and functional enrichment) strengthen our confidence that these represent biologically meaningful differences rather than technical artifacts.Therefore, we believe our conservative approach of treating these as genuine presence/absence differences, validated by orthogonal data, is more appropriate than introducing imputed values based on arbitrary statistical assumptions.To clarify this section, we modified the text as follows: 'Only expression changes were considered that either showed statistically significant differential abundance at both RNA and protein levels (p Comment 10: L430-435 "These data fit with the GO [...] the ribosome translational activity (34)." This discussion feels out of place and context. It is too speculative and with little support by the data presented at this stage of the manuscript. It should be removed as Figure 3E or could be placed in the discussion and supplementary information.

      Response: We agree with the reviewer. In response to a comment from reviewer 1, we have moved both panels to Figure 2, which much better integrates these data.

      Comment 10: The authors present an elegant way to show stage specific degradation through the comparison of stage specific proteasome blockages that show rescue in ama of proteins present in pro and vice versa. L494 "reveal an unexpected but substantial" the term unexpected is inappropriate, as several studies have shown in kinetoplastids the essential role of protein turnover through degradation / autophagy during differentiation. Furthermore the conclusions may be strongly affected by the level of expression of the proteins in the infinite quadrants as we discussed above, and should be revised accordingly.

      Response: We rephrased the conclusion to 'In conclusion, our results confirm the important role of protein degradation in regulating the L. donovani amastigote and promastigote proteomes and identify protein kinases as key targets of stage-specific proteasomal activities.' Please see the response to comment 9 regarding the unique proteins.

      Comment 11: L518 "These data reveal a surprising level of stage-specific phosphorylation in promastigotes, which may reflect their increased biosynthetic and proliferative activities compared to amastigotes." Overstatement. Could also be due to culture adaptation - What is the overlap of stage-specific phosphorylations with previous published datasets in other species of Leishmania? Looking at such comparisons could help to decipher the role of culture adaptation response, species specificity and true differentiation conserved mechanisms.

      Response: We agree with the reviewer and have toned this statement down by adding the statement '....or simply be a consequence of culture adaptation'.

      Comment 12: The discussion is extremely speculative. While some speculation at this stage is acceptable, claiming direct link and feedback without further validation is probably far too stretched. For example, the changes of phosphorylation observed on particular sets of proteins, such as phosphatase and DUBs, need to be validated for their respective change of protein activity in the direction that fits the model of the authors. Those discussions should be toned down.

      Response: We agree with the reviewer and have strongly toned down the entire discussion, emphasizing the hypothesis-building character of our results, which provide a novel framework for future experimental analyses.

      Comment 13: A couple of typos:

      • In the phosphoproteome analysis section, "...0,2 % DCA..." should be "...0.2 % DCA..." (use a decimal point).

      • L225 "...peptide match was disable." should be "...peptide match was disabled."

      Response: both corrected

      __Reviewer #4 (Significance (Required)): __

      While there is not too much novelty around the emphasis of gene expression at post-translational level in kinetoplastid organisms, the scale of the work presented here, looking at 5 layers of potential regulations, is. Therefore, this study represents a substantial amount of work and provides interesting and comprehensive datasets useful for the parasitology community.

      Response: We thank the reviewer for this positive statement.

      Several potential concerns regarding the biological meaning of the findings were identified. These include the limitations of in vitro systems promastigote differentiation potentially limiting the conclusions, the challenge of inferring causality from correlative "omics" data, and the complexities of functional interpretation of changes in phosphorylation and metabolite levels. The proposed feedback loops and functional roles of specific molecules would require further experimental validation to confirm their biological relevance in the natural life cycle of Leishmania, but that would probably fall out of the scope of this manuscript.

      Response: We agree with the reviewer and have modified pour manuscript throughout to remove any causal relationships. Indeed, this work is setting the stage for future investigations on dissecting some of the suggested regulatory mechanisms.

      Area of expertise of the reviewers: Kinetoplastid, Differentiation, Signalling, Omics

    1. [TYBALT under ROMEO's arm stabs MERCUTIO, and flies with his followers] Mercutio. I am hurt. A plague o' both your houses! I am sped. Is he gone, and hath nothing?

      Romeo didn't want to fight Tybalt, so Mercutio offered to duel in his place, hence the death of Mercutio

    1. XX
      • A alienação do controle acionário de empresas públicas e sociedades de economia mista exige autorização legislativa e licitação pública. A transferência do controle de subsidiárias e controladas não exige a anuência do Poder Legislativo e poderá ser operacionalizada sem processo de licitação pública, desde que garantida a competitividade entre os potenciais interessados e observados os princípios da administração pública constantes do art. 37 da Constituição da República.

      [ADI 5.624 MC REF, rel. min. Ricardo Lewandowski, j. 6-6-2019, P, DJE de 29-11-2019.]


      • Pelo inc. XIX do art. 37 da Constituição da República, a autorização legislativa para criação de sociedade de economia mista há de ser dada por lei específica, mas, para a criação das subsidiárias, no inc. XX do mesmo art. 37, exige -se apenas autorização legislativa genérica.
      • No caso da Petróleo Brasileiro S/A – Petrobras, essa autorização foi dada pela Lei n. 9.478/1997, pela qual se dispõe sobre a política energética nacional e sobre as atividades referentes ao monopólio do petróleo e se instituem o Conselho Nacional de Política Energética e a Agência Nacional do Petróleo.

      [Rcl 42.576-MC, red. do ac. min. Alexandre de Moraes, voto da min. Cármen Lúcia, j. 1º-10-2020, P, DJE de 17-6-2021.]


      No que tange às EP, SEM e FP, portanto: - LEI ESPECÍFICA = autoriza a criação de empresa pública, sociedade de economia mista e fundação; - LEI GENÉRICA = autoriza a criação de subsidiárias; - LEI COMPLEMENTAR = fixa a finalidade de fundação pública; - <u>É</u> necessária autorização legislativa para alienação de controle societário de empresa pública e sociedade de economia mista. - <u>Não </u>é necessária autorização legislativa para transferência do controle de subsidiária.

    1. pasiva morfológica, que funcionaba tan bien en latín y que se usa a diestro ysiniestro en inglés o en alemán, nunca cuajó en las lenguas románicas.

      Me llama la atención que esta forma pasiva no se haya adaptado a las lenguas románicas, aunque en otras lenguas sí sea común. Es interesante ver cómo cada idioma evoluciona de manera distinta.

    2. a gramática condena el llamado gerundio copulativo o de posteridad: el queequivale a una oración coordinada con y y que expresa un tiempo posterior al del verboprincipal.

      Me llama la atención cómo el autor utiliza la palabra "condena", ya que nos da a entender que es un no rotundo o que usar el gerundio de esta forma puede resultar muy mal.

    3. En cambio, si la prosa esconde a losprotagonistas semánticos en construcciones impersonales o pasivas, el discurso pierdefuerza

      Coincido con lo que afirma el autor, ya que cuando no se identifica claramente quién realiza la acción, el lector puede perder el hilo del texto.

    4. Por ello, parece lógico que la información importante del texto,que tendría que vehicularse en la frase principal, ocupe siempre esta posiciónpreeminente.

      Este planteamiento del autor contrasta, en mi opinión, con muchos textos jurídicos o administrativos, ya que, a diferencia de lo que menciona Cassany, estos suelen colocar la información o la idea principal al final de la oración. Esto puede dificultar la comprensión, porque el lector debe leer todo el enunciado antes de entender el punto central.