5,252 Matching Annotations
  1. Sep 2022
    1. It should, at the very least, tag the tile as "done", and not expose it as a playable tile again.

      that would be if decision was "yes" or "no", I guess.

      Does the game provider know who is playing?

  2. Aug 2022
    1. 1) get an extra 'search' attribute on to the <a> tag in HTML so that we have: e.g. <a href='...' search='...'>link text</a> 2) If there's take-up, then later on push for adding a date-time of creation attribute to <a>. This will add link history to the internet. The way (1) works is someone sticks the basic href to a page in the href attribute, and then sticks the text they want to link to in the search attr. The browser fetches the page, and as a secondary action (at user option) searches for the text.

      Another approach, inspired by the <label> element, would be to encode these selectors as separate <link> elements in the head. You could write your links as normal, and then add these <link rel="selector" for="foo" href="XXX[...]X" /> to your document (where foo is the ID of the <a> element, and the href value is selector).

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      In this paper, Staneva et al describe a novel complex found at RNA PolII promoters that they term the SPARC. The manuscript focuses on defining the core components of the complex and the pivotal role of SET27 in defining its function, and role in PolII transcription. This manuscript is a logical follow on from an initial paper (Staneva et al, 2021) by the same authors where they systematically analyzed chromatin factors, and their role in both transcription start and termination. What is also very clear, is that this complex is one made of histone readers and writers which suggests its function is to change the chromatin structure around a PolII promoters. The authors show that this complex is necessary for the correct positioning of PolII and directionality of transcription.

      This was a well-designed study and well written and clear manuscript that provides fascinating insight transcription control in bloodstream form parasites.

      I have no major comments only a few minor ones.

      1) Localisation of the different SPARC components appears to be either nuclear or nuclear and cytoplasmic. - Both SET27 and CRD1 show a nuclear and cytoplasmic localisation in the bloodstream form IFA (Supplementary Fig 1B), but only a nuclear localisation procyclic form.

      Did the authors attempt C terminally tagging SET27, CRD1 to see if this resulted in a change in the pattern?

      We have not tagged either protein at the C terminus, however SET27 (Tb927.9.13470) has been tagged both N- and C-terminally in procyclic form (PF) cells as part of the TrypTag project (http://tryptag.org). In both cases, SET27 localized to the nucleus, suggesting that the differences in localization we observe for SET27 depend on the life cycle stage, and not on the position of the tag. One caveat is that in the TrypTag project proteins are tagged with mNeonGreen whereas in our study proteins were tagged with YFP. Based on our images, CRD1 appears to be predominantly nuclear in both bloodstream form (BF) and PF parasites. CRD1 (Tb927.7.4540) has been tagged only N-terminally in PF cells as part of the TrypTag project where it has also been classified as mostly nuclear with only 10% of cells showing cytoplasmic localization for CRD1.

      We are well aware that tags can alter the behaviour of a protein. Absolute confirmation of location will require the generation of antibodies that detect untagged proteins. However, this is a longer-term undertaking. We have added the following statement to the Results section to address the point raised:

      “We tagged the proteins on their N termini to preserve 3′ UTR sequences involved in regulating mRNA stability (Clayton, 2019). We note, however, that the presence of the YFP tag and/or its position (N- or C-terminal) might affect protein expression and localization patterns”.

      • The point is made that JBP2 shows a 'distinct cytoplasmic localisation' in PF cells. by this logic, the SET27 localisation in BF is also distinctly cytoplasmic and a nuclear enrichment is not clear.

      Indeed the reviewer is correct - we have inadvertently over accentuated the significance of this difference in the text. We had emphasized the predominantly cytoplasmic localization of JBP2 in PF trypanosomes as potentially related to its weaker association with other (predominantly nuclear) SPARC components in the mass spectrometry experiments. The presence of SET27 in the nuclei of both BF and PF cells is confirmed by a positive ChIP signal. We have revised the manuscript text by changing “distinct cytoplasmic” to “predominantly cytoplasmic” to describe JBP2 localization in PF cells. We hope that this resolves the issue.

      • Why would the localisation pattern change between life cycle stages? Surely PolII transcription should remain the same?

      Although our analysis suggests that there may be some shift in SET27 and JBP2 localization between BF and PF stages, sufficient amounts of these proteins may be present in the nucleus for proper SPARC assembly and RNAPII transcription regulation in both life cycle forms. The proportion of SET27 and JBP2 proteins that localizes to the cytoplasm may have functions unrelated to transcription.

      2) Several of the images in Supplementary Fig 1B seem to show foci in the nucleus (CSD1, PWWP1, CRD1). Do you see foci throughout the cell cycle or just in G1/S phase cells as shown here?

      We have not systematically investigated protein localization at different cell cycle stages, so we do not have microscopy images for all proteins at all stages of the cell cycle. However, the images we did collect suggest the punctate pattern is preserved for CRD1 in the G2 phase in both BF and PF cells (see below) as we showed in Supplemental Figure S1B for cells with 1 kinetoplast and 1 nucleus (G1/S phase cells). The significance of these puncta remains to be determined.

      3) In Figure 6, what does 'TE' stand for?

      TE denotes transposable elements. We have added this to the figure legend.

      4) The authors show this interesting link between SPARC complex and subtelomeric VSG gene silencing. -In the CRD1 ChIP or RBP1 ChIP, are there any other peaks in telomere adjacent regions in the WT cells similar to that seen on chromosome 9A? And does the sequence at this point resemble a PolII promoter?

      Apart from peaks located on Chromosome 9_3A, there are other CRD1 and RPB1 ChIP peaks in chromosomal regions adjacent to telomeres in WT cells. We observed broadening of RPB1 distribution in these regions upon SET27 deletion, similar to what we show for Chromosome 9_3A. In particular, wider RPB1 distribution on Chromosome 8_5A coincides with upregulation of 10 VSG transcripts. These two loci explain most of the differentially expessed genes (DEGs) detected, but other subtelomeric regions show a similar pattern. We have added the following statement to the Results section to highlight that the phenotype shown for Chromosome 9_3A is not unique:

      “We also observed a similar phenotype at other subtelomeric regions, such as Chromosome 8_5A where 10 VSGs and a gene encoding a hypothetical protein were upregulated upon SET27 deletion (Supplemental Table S3)”.

      Cordon-Obras et al. (2022) have recently defined key sequence elements present at one RNAPII promoter. We searched for similar sequence motifs but failed to identify them as underlying CRD1 and RPB1 ChIP peaks, highlighting the likely sequence heterogeneity amongst trypanosome RNAPII promoters. To address this point, we have added the following sentence to the Discussion:

      “Sequence-specific elements have recently been found to drive RNAPII transcription from a T. brucei promoter (Cordon-Obras et al., 2022), however, we were unable to identify similar motifs underlying CRD1 or RPB1 ChIP-seq peaks, suggesting that T. brucei promoters are perhaps heterogeneous in composition”.

      -In the FLAG-CRD1 IP (Figure 3B), the VSG's seen here are not represented (as far as I can tell) in Figure 6B and C. If my reading is correct could, is this a difference in the FC cut off for what is significant in these experiments?

      The VSGs detected in the FLAG-CRD1 IP from set27D/D cells are indeed different from the ones shown in Figure 6 (even after setting the same fold change cutoffs). We have highlighted this by adding the following statement to the Results section: “Gene ontology analysis of the upregulated mRNA set revealed strong enrichment for normally silent VSG genes (Figure 6B-D) which were distinct from the VSG proteins detected in the FLAG-CRD1 immunoprecipitations from set27D/D cells (Figure 3B)”.

      The VSGs in the mass spectrometry experiments likely represent unspecific interactors of FLAG-CRD1. To clarify this, we have added the following statement to the Results section: ”Instead, several VSG proteins were detected as being associated with FLAG-CRD1 in set27D/D cells, though it is likely that these represent unspecific interactions”.

      Reviewer #1 (Significance (Required)):

      Trypanosomes are unusual in the way that they transcribe protein coding genes. Recent advances have defined the chromatin composition at the TSS and TTS, and the recent publication of a PolII promoter sequence(s) further adds to our understanding of how transcription here is regulated. Defining the SPARC complex now add to this understanding and highlights the role of potential histone readers and writers. I think that this will be of interest to the kinetoplastid community especially those working on control of gene expression.

      Our lab studies gene expression and antigenic variation in T. brucei.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      In this manuscript, the authors identify a six-membered chromatin-associated protein complex termed SPARC that localizes to Transcription Start Regions (TSRs) and co-localizes with and (directly or indirectly) interacts with RNA polymerase II subunits. Careful deletion studies of one of its components, SET27, convincingly show the functional importance of this complex for the genomic localization, accuracy, and directionality of transcription initiation. Overall, the experiments are well and logically designed and executed, the results are well presented, and the manuscript is easy to read.

      There are a few minor points that would benefit from clarification and/or from a more detailed discussion:

      1) The concomitant expression of many VSGs (37) in a SET27 deletion strain is remarkable and has important implications for their normally monoallelic expression. It is well established that VSG expression in wild-type T. brucei can only occur from one of ~15 subtelomeric bloodstream expression sites, which include the ESAGs. This result implies that VSG genes are also transcribed from "archival VSG sites" in the genome, not only from expression sites. Are there VSGs from the silent BESs among the upregulated VSGs? Is there precedence in the literature for the expression of VSGs from chromosomal regions besides the subtelomeric expression sites?

      Our analysis of differentially expressed genes (DEGs) revealed that 43 VSG genes (37 of which are subtelomeric) and 2 ESAG genes are upregulated in the absence of SET27. Both ESAGs but none of the upregulated VSGs in set27D/D cells are annotated as located in BES regions. While it is possible that recombination events have resulted in gene rearrangements between the reference strain and our laboratory’s strain, at least some of the upregulated VSGs are likely to be transcribed from non-BES archival sites. VSG transcript upregulation from non-BES regions was also recently described by López-Escobar et al (2022).

      We note that the upregulated mRNAs in set27D/D are still relatively lowly expressed (Figure 6C). This is presumably insufficient to coat the surface of T. brucei, and expression from BES sites instead may be required to achieve this. We have revised the manuscript Discussion section to make these points more clear:

      “Bloodstream form trypanosomes normally express only a single VSG gene from 1 of ~15 telomere-adjacent bloodstream expression sites (BESs). In contrast, in set27D/D cells we detected upregulation of 43 VSG transcripts, none of which were annotated as located in BES regions. Recently, López-Escobar et al (2022) have also observed VSG mRNA upregulation from non-BES locations, suggesting that VSGs might sometimes be transcribed from other regions of the genome. However, the VSG transcripts we detect as upregulated in set27D/D were relatively lowly expressed (Figure 6C) and may not be translated to protein or be translated at low levels compared to a VSG transcribed from a BES site”.

      2) The role of SPARC in defining transcription initiation is compelling. It's less clear to the reviewer if the observed transcriptional silencing within subtelomeric regions can also ascribed to SPARC. Have the authors considered the possibility that some components of the SPARC may be shared by other chromatin complexes, which could be responsible for the transcriptional activation of silent genes in SET27 deletion mutants?

      We cannot rule out indirect effects through the participation of some SPARC components in other complexes operating independently of SPARC. Indeed, the transcriptional defect within the main body of chromosomes appears to be somewhat different from that observed at subtelomeric regions, particularly with respect to distance from SPARC. We have added a statement in the Discussion section to highlight the possibility raised by the reviewer:

      “However, an alternative possibility is that transcriptional repression in subtelomeric regions is mediated by different protein complexes which share some of their subunits with SPARC, or whose activity is influenced by it”.

      3) The authors mention that the observed interaction of FLAG-CRD1 with VSGs in the immunoprecipitations (Fig. 3B) is evidence for the actual expression of normally silent VSGs on the protein level. This is true, but it should be spelled out that this interaction is nevertheless likely an artifact, at least the physiological relevance of these interactions is questionable.

      We agree that these are likely background associations and have added the following statement to the Results section to clarify this point:

      “Instead, several VSG proteins were detected as associated with FLAG-CRD1 in set27D/D cells, though it is likely that these represent unspecific interactions”.

      To avoid unnecessary confusion we have also removed the following sentence from the revised Discussion:

      “The interactions of FLAG-CRD1 with VSGs in the affinity selections from set27Δ/Δ cells indicate that some of the normally silent VSG genes are also translated into proteins in the absence of SET27”.

      4) "ophistokont" is misspelled in the introduction

      Thanks for noticing. We have corrected it to “Opisthokonta”.

      Reviewer #2 (Significance (Required)):

      The manuscript by Staneva et al. addresses the fundamental regulatory mechanism of gene transcription in the protozoan parasite Trypanosoma brucei, a highly divergent eukaryotic organism that is renowned for unusual features and mechanisms in gene regulation, metabolism, and other cellular processes. While post-transcriptional regulation is prevalent and relatively well established in T. brucei, much less is known about the mechanism of transcription initiation and transcriptional control, in part due to the general paucity of well-defined conventional promoter regions in this organism (only very few have been identified thus far). In this context, the work by Staneva et al. is highly significant and represents an important contribution to the field of gene regulation and chromatin biology in T. brucei and other related kinetoplastid parasites.

    1. GoutPal Research

      My GoutPal Research notes are similar to GoutPal Triage. But they're a response to my own interests and concerns. As such, I usually assign them lower priority than my notes on specific issues.

      In fact, this note is an example. Because I'm researching how to best implement my new GoutPal Links services. Then I'm adding notes like this to describe my progress towards a complete set of documented resources.

      As I move forward, I will publish extensive notes for subscribers and for members. That will give readers choices about extra information beyond these public gout research notes.

      Please note that those public gout notes are from every Hypothes.is user who writes about gout. Currently, that's only me. But I hope other gout sufferers will join me. At which point, you can find my gout notes with my user tag.

      To get more gout research notes, join the waitlist for gout subscribers.

    1. ```html

      <div class="select-container" data-content=""> <select class="select" id="words"> <option value="lorem ipsum dolor sit amet">Lorem ipsum dolor sit amet</option> <option value="lorem">Lorem</option> <option value="ipsum">Ipsum</option> <option value="dolor">Dolor</option> <option value="sit">Sit</option> <option value="amet">Amet</option> </select> </div>

      css .select { color: transparent; appearance: none; padding: 5px; background: transparent url("https://cdn4.iconfinder.com/data/icons/ionicons/512/icon-arrow-down-b-128.png") no-repeat calc(~"100% - 5px") 7px; background-size: 10px 10px; }

      .select-container { position: relative; display: inline-block; }

      .select-container::before { content: attr(data-content); pointer-events: none; position: absolute; top: 0; right: 10px; bottom: 0; left: 0; padding: 7px; font: 11px Arial, sans-serif; white-space: nowrap; text-overflow: ellipsis; overflow: hidden; text-transform: capitalize; } js const selectContainer = document.querySelector(".select-container"); const select = selectContainer.querySelector(".select");

      select.value = "lorem ipsum dolor sit amet"; selectContainer.dataset.content = select.value;

      function handleChange(e) { selectContainer.dataset.content = e.currentTarget.value; }

      select.addEventListener("change", handleChange); ```

    1. 如果我们想要将信息记住,那是否可以顺应大脑的习惯,刻意地做出以上行为?比如刻意「使用」?基于这一点,视频作者总结的记忆方法是
      1. 在阅读的时候记笔记:这个可以是在书本上进行高亮或者使用在书上写笔记。
      2. 在读完书后,重新阅读你的笔记,并修改笔记:这一步是将书上的笔记转移到卡片上。
      3. 对笔记进行分类和归档:可以给笔记卡片进行分类,或者打上 tag。
    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      This study shows that the ORF1 protein of the LINE-1 retroelement forms puncta in vivo that they define as cytoplasmic biomolecular condensates based on the characterization of the biophysical properties of ORF1p condensates in vitro.

      Defective retrotransposition of some ORF1p mutants correlates with defects in puncta formation in vivo and alteration of biophysical properties of in vitro condensates leading the authors to conclude that condensation of ORF1p is required for retrotransposition.

      The study combines biochemical reconstitution, biophysic analysis and live-cell imaging. In particular, the authors take advantage of a new powerful tool they have developed based on the tagging of ORF1 within a functional L1 reporter element. The fluorescent tag allows following the dynamics of ORF1p by live-cell imaging.

      The key conclusion is that ORF1p condensation is important for L1 retrotransposition. The correlation is clearly shown but raises several questions: Is the defect in ORF1p condensation the only explanation for the retrotransposition defects of the ORF1p mutants analyzed here? Can we exclude that the mutations in ORF1p affect other functions of the protein such as its binding to RNA (as in the case of the R261 mutant) and cis-preference, or its binding to other factors involved in L1 replication? Could the loss of these functions affect L1 retrotransposition independently of ORF1p condensation?

      Major comments:

      On several occasions, the authors propose that ORF1p-HALO dynamics in vivo is linked to its co-translational association with L1 RNA. However, they never show the presence of L1 RNAs in ORF1p-HALO puncta in vivo. To strengthen the conclusion that the puncta observed in vivo are L1 RNPs, the authors should add experiments showing the presence of L1 RNA in the cytoplasmic puncta (by RNA FISH) or that the puncta are dependent on the presence of L1 RNA (expressing ORF1p-HALO alone should not be sufficient for puncta formation). These experiments seem to be realistic in few weeks with the tools already available in the laboratory.

      Apart from this comment, the authors are cautious in their conclusions. It is clear, as they indicate in the Discussion, that showing that ORF1p condensation is also required for the mobility of other retroelements will strengthen the implication of ORF1p condensation in L1 replication.

      The data are well presented and the methods described in detail so that others should be able to use them. The experiments seem to be adequately replicated and the statistical analysis adequate.

      Minor comments:

      Figure 1F: Having the pictures of cell nuclei (like in Figure 1D) would be nice to know how many cells we are looking at in this panel.

      Figure 2E: it is surprising that there is no correlation between the ORF1p:RNA ratio and the number of individual fusion events (i.e. curves of ORF1p+RNA 10000:1 and 1000:1 overlap while 3000:1 is different). Could the authors discuss this point?

      Previous studies are appropriately referenced. Text and figures are clear and precise.

      Referees cross-commenting

      The main critical points shared by all reviewers are: 1) the need to show the presence of LINE1 RNAs in ORF1p condensates in vivo and 2) the lack of evidence for causality between ORF1 condensate formation and L1 transposition efficiency (At this stage, the authors should moderate their conclusions, especially in the abstract). Regarding the other reviews, we noticed the need to cite additional relevant studies in the field (reviewer #2) and the interesting points raised by reviewer #3 to investigate the formation of ORF1 condensates in an endogenous situation, and whether other RNAs do affect ORF1p condensates.

      Significance

      The study is technically interesting in that it describes a new system for tracking ORF1p puncta formation in vivo. The findings are not unexpected because it comes after the publication of Newton et al. in 2021 (PMID : 33798566), describing that ORF1p does phase separation in vitro. Furthermore, the fact that RNPs form "membrane-less" structures is already established in other situations as the authors point out. Compared to Newton et al., condensates are better-defined biochemically, especially for RNA association features and in vivo dynamics.

      The ORF1 protein is widely studied for its role in L1 retrotransposition. The protein forms a homotrimer in vitro, binds to L1 mRNA in a cis-preferential manner, and is required for retrotransposition. On the other hand, RNA-binding proteins are often involved in the formation of membrane-less organelles (stress granules, RNA processing bodies...). These observations suggest that ORF1p may also form RNP condensates required for L1 retrotransposition. A study published in Biophysical Journal in 2021 (Newton et al. PMID: 33798566) has already reported the phase separation of the LINE-1 ORF1p that is mediated by the N-terminus and coiled-coil domain. This former study was based on in vitro microscopy and NMR approaches and is cited in the submitted manuscript. The study submitted to Rev commons goes further by analyzing the biochemical properties of ORF1p condensates in the presence of L1 RNA and by following in vivo condensates of ORF1p (WT or mutants) expressed from a functional L1 reporter element by live-cell imaging. The findings will interest a wide audience investigating the biology of retroelements and more particularly scientists who study the L1 retrotransposon.

      I am an expert in retrotransposon biology but I do not work on L1. I am not expert enough to assess the quality and relevance of the biophysical experiments in the paper. In particular, panels 2D, 3B and 3D were difficult to analyze.

    1. Constantly spinning down/up can reduce the life of the hard disk, so I recommend you leave the drive spinning all the time, or set the drive to turn off after a longer period (one or two hours) of inactivity
      • OK
    1. Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Ruchika Bajaj and Gary McDowell. Review synthesized by Bianca Melo Trovò.


      This study demonstrates the utility of an L-Methionine analog - ProSeMet - to tag and enrich proteins which have residues that are methylated in vivo, ex vivo and in vitro. Furthermore, the study demonstrates that this can be used in combination with mass spectrometry to identify these sites. Overall this is a useful, well-verified and well-described approach that will be helpful for future identification and investigation of methylation sites.

      Major comments

      It would be helpful if the manuscript could additionally discuss the reversibility of methylation generally, and the reversibility of the modification of protein residues by the alkyne group specifically, in the discussion, and whether that has any implications for their results. It may be that the dynamics of methylation and demethylation vary between the two; or it may be that they are the same - either way, that may affect how they suggest others use this method and interpret its results.

      Perhaps related to the question of reversibility, it would be helpful if the manuscript would comment on whether these are “true” methylation sites or not; i.e. whether they consider all these methylation sites to be functional. Trying to determine this would be an interesting direction for future work, but for this study a reflection on whether these novel functional methylation sites are simply capable of being methylated, or are likely to be methylation sites that are meaningful biologically, would be helpful.

      Results, ProSeMet competes with L-Met to pseudo methylate protein in the cytoplasm and nucleus: the manuscript claims that ProSeMet is not incorporated into newly synthesized proteins but rather converted to ProSeAM and used by native methyltransferases. There does appear to be some reduction in the labeling with ProSeMet on cycloheximide treatment in Figure 2D - could this suggest that it is incorporated into newly synthesized proteins as well as being converted to ProSeAM? If not, could the manuscript explain why not? This experiment clearly shows that in contrast to AHA labeling, there is still use of ProSeMet as a substrate when translation is inhibited; however, it is not clear how this demonstrates that it is not incorporated at all into newly synthesized proteins. If methyl has been incorporated in previously present proteins, perhaps this can be clarified in the text.

      Results, ProSeMet competes with L-Met to pseudomethylate protein in the cytoplasm and nucleus: the conclusion that “Cell fractionation of the cytosolic and nuclear compartments followed by SDS-PAGE fluorescent analysis revealed no fluorescent labeling of the L-Met control” is correct but may be overstated as there appears to be some background in the cytosolic fraction.

      Minor comments

      • Introduction: Recommend including a mention to ProSeMet's permeability.
      • Introduction, Figure 1: the last step with CuAAC and N3 labeling in the description of the Chemoenzymatic approach for metabolic MTase labeling is not clear. Please, add the description in the legend.
      • Results, Figure 2D: the image suggests an overloaded gel, consider using an alternative gel image.
      • Supplementary Material, Fig. S1: the data with L-met is only shown with T47D stacks.
      • Supplementary Material, Fig. S3: please add the control for the no treatment condition.
      • Results, Fig. 2A ‘ incubating for 30 m in L-Met free media’: Please confirm that the length of incubation was 30 minutes.
      • Results, Enrichment of pseudo methylated proteins used to determine breadth of methyl proteome: Please provide some description for the SMARB1-deficient G401 cell line. Why smarb1 deficient?
      • Results, Figure 3: Please define BP, MF, HP, NES, and label the x and y axes in panel D.
      • Results, ProSeMet-directed pseudo methylation is detectable in vivo: Please, clarify if the administration was oral.

      Comments on reporting

      • Results, ProSeMet competes with L-Met to pseudo methylate protein in the cytoplasm and nucleus: Please verify the quantity reported: 5µg on SDS-PAGE gel seems low.
      • Results, ProSeMet-directed pseudo methylation is detectable in vivo: the manuscript reports that “mice starved prior to ProSeMet injection had increased ProSeMet labeling in the heart, whereas mice fed prior to ProSeMet administration had increased labeling in the brain and lungs”. The error bars are large, it would be helpful to show the individual real data points for the graphs in Figure 4.
      • Results, Figure 4C: please report the mathematical expression used to calculate the relative fluorescence.
      • Supplementary Material, Fig. S7: please provide more details on the antibody employed.

      Suggestions for future studies

      Future studies could investigate the biological functionality of the novel methylation sites - but this is a great proof of principle.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      This study characterises a Plasmodium class I Histone deacetylase (PfHDAC1). The manuscript reports a wide range of experiments - some of them complex and involved, but not all of these experiments appear to be well controlled, and some are insufficiently described to know if they have been appropriately designed and interpreted. A link to HDAC1 regulation and artemisinin resistance is advanced, but the evidence here is very indirect and inconclusive.

      The study shows that HDAC1 interacts with PfCKII- a homologue of the mammalian casein kinase known to interact with mammalian HDAC1. They also demonstrate that, at least in vitro, HDAC1 can serve as a substrate for phosphorylation by PfCKII, and that this phosphorylation impacts HDAC1's deacetylation of histones. Such assays where a kinase is provided with a single, abundant substrate in vitro, are not always rigourous tests for kinase specificity, but do in this case at least indicate that HDAC1 associated with its activity.

      Major issues:

      1. The authors conduct CHiP seq experiments on a GFP tagged HDAC. It is unclear from the methods and results section what control is used in these experiments. The ENCODE consortium has established minimum standards (Landt et al 2012) for conducting and reporting CHiP seq experiments, and states that the "recommended control for epitope-tagged measurements is an immunoprecipitation using the same antibody against the epitope tag in otherwise identical cells that do not express the tagged factor.". These experiments appear to lack that control and the enrichments reported should be approached with caution in the absence of such a control.
      2. The genes with apparently altered ChiP seq were subjected to gene ontology enrichment analysis, and the authors report potential enrichments - which appear to impact a range of unconnected biological pathways throughout the parasite and throughout the lifecycle, despite the CHIP seq being conducted only at a single time stage. No mention is made of correction for multiple hypothesis testing, known to present a considerable problem for such analyses, and no correction is described for background GO distributions in the P. falciparum genome, so again it's unknown if or how that was performed. The reported enriched categories must be also treated with considerable caution given the absence of description of these crucial steps. The authors report from this section that HDAC1 is associated with stress responses, but really, by their criteria, HDAC1 is associated with 1/3 of the whole genome, so it's a bit selective to regard it as a stress regulator
      3. The authors preform a well-designed series of transfection experiments with modulation of HDAC1 to show that an overexpression of HDAC1 leads to increased growth rate, and that this increase reduces when the overexpression of HDAC1 is inducibly repressed. However, I found the presentation of results from these experiments difficult to understand and there is considerable transformation of the data prior to plotting - they would be easier to understand if no background subtraction to normalise for GFP were conducted, and if all strains were plotted on the same axes. A potential confounding factor in this experiment is that many lines overexpressing GFP grow more slowly, and that this growth defect can be localisation dependent, so that over-expression of GFP alone may cause a different growth penalty than GFP on a nuclear protein. I am uncertain that the conclusion of 50% faster growth is a safe one based on these graphs - at some time intervals the over-expressor appears to grow just as slow or even slower (as a percentage of the previous timepoint) than the control, and these appear to have been based on technical replicates of a single biological experiment. The authors contend that the growth rate is due to changed expression of invasion genes (among many other substrate gene categories) giving rise to enhanced invasion - such a phenomenon is readily testable, and the authors should dissect this if they wish to substantiate the frankly surprising claim that overexpression of HDAC leads to increased growth rate.
      4. The authors also report an apparent down regulation of HDAC abundance in artemisinin resistant parasites. This conflicts with previous global proteomic analyses of artemisinin resistant parasites which found no such change in HDAC1 regulation or abundance (eg Siddiqui et al 2017, Yang et al 2019). Stage matching is a particular challenge in such experiments given the differences in cycle progression between ARTR and ARTS parasites, and it isn't clear that this has been adequately controlled for to have confidence in these results, particularly given their contradiction of previous analyses. The abundance of PfHDAC1 changes considerably throughout the asexual intraerythrocytic cycle, (out of synch with the control used here actin), so potential stage-mismatch might contribute to apparent differences here. Again, explicit mention of replicates is lacking. The authors also mention genes regulated by HDAC1 as including genes related to processes related to artemisin resistance, but this is hard to sustain - indeed with so many genes apparently substrates of HDAC1 it would be highly surprising if there were no overlap with some genes in pathways related to artemisin resistance. An accompanying experiment demonstrating an increase in survival (of both ART resistant and ART sensitive lines) in an artemisinin ring stage survival assay is intriguing, after using a possible inhibitor of HDAC but these results are hard to reconcile with a dynamic transcriptional response. (Why was this done with an uncharacterised inhibitor, rather than the more specific HDAC1 overexpressor/knockdown system? An accompanying RNAseq analysis is described, but the analysis is piecemeal and selective, with the authors pointing out candidate genes representing categories plausibly linked to artemisinin resistance. I found this section unconvincing and indirect - lots of genes are changed in these experiments, and so they inevitably include some that are feasibly linked to artemisinin resistance, but the one gene convincingly known to modulate resistance, K13, isn't mentioned, and presumably wasn't specifically changed in this analysis.
      5. A previous study by the laboratory of Christian Doerig (Eukaryot Cell. 2010 Jun; 9(6): 952-959.) reported that HDAC1 activity (unclear which of the HDACs) is associated with Pfcrk-3). This activity may not correspond to the HDAC1 characterised here, but deserves some discussion.
      6. The Western blots are letterboxed and in some cases appear to crop out bands on the limit of the image (eg Fig 5, 6). Please provide fuller pictures of the blots and indicate the relevant bands if there are several background bands.

      Minor issues

      The text uses breaking spaces for the gap between genus abbreviation and species throughout. Replace with non-breaking spaces. Abstract: "is correlated with parasitemia progression" - Unclear meaning. Reword. Introduction "closes in on 400,000 deaths annually" Unclear meaning/vernacular usage. Reword. Very long paragraph on pages 3-4. Reorder logical flow and break into smaller paragraphs to make this more easily read. "Given the evidence of the role of HDAC inhibition in the emergence of chemotherapeutic resistance in mammalian system" - needs a reference - no mention of this phenomenon up until this point of the manuscript

      Referees cross-commenting

      I agree with the other reviewers comments. Although the manuscript contains a very large number of complex experiments, necessary controls, sufficient replicates, and appropriate analysis are missing from many of the experiments.

      I appreciate that the experiments referred to would require a very substantial time and resource commitment to complete, but in their current form, many of these experiments are not safely interpretable.

      Significance

      This manuscript makes major claims for HDAC1, in particular for its role in artemisinin resistance. Such a link would be significant, but I regard few of these claims as having been robustly substantiated in this manuscript. The CHIP-seq evidence is of interest as a useful dataset, particularly if accompanied by relevant controls

    1. level 2hog8541ssOp · 15 hr. agoVery nice! I am a pastor so I am researching Antinet being used along with Bible studies.

      If you've not come across the examples, one of the precursors of the slip box tradition was the widespread use of florilegia from the 8th through the 13th centuries and beyond, and they were primarily used for religious study, preaching, and sermon writing.

      A major example of early use was by Philip Melanchthon, who wrote a very popular handbook on how to keep a commonplace. He's one of the reasons why many Lutheran books are called or have Commonplace in the title.

      A fantastic example is that of American preacher Jonathan Edwards which he called by an alternate name of Miscellanies which is now digitized and online, much the way Luhmann's is: http://edwards.yale.edu/research/misc-index Apparently he used to pin slips with notes on his coat jacket!

      If I recall, u/TomKluender may have some practical experience in the overlap of theology and zettelkasten.

      (Moved this comment to https://www.reddit.com/r/antinet/comments/wth5t8/bible_study_and_zettelkasten/ as a better location for the conversation)

    1. 📒 ShrewdNotes Web Page Annotation

      I often rush into assessing new applications. Because I learn quicker by applying compared to reading. But one downside is that I frequently miss key features.

      That's only a major drawback if I abandon the application where I can't see how it fits my project. And today I avoided that with serendipity. Because… 1. My application was a Chrome Extension 1. I wanted to test to see if was active and change webpage content accordingly 1. I found I could run the app without an extension - as fully described in the documentation that I skipped reading!

      All of which is an idea for my next blog post. But the real point is I have established a process for starting ad-hoc Shrewd Learning projects "in the wild". Because normally, I start making notes somewhere. Then forgetting where I put them.

      I think we all do that when we spot something interesting that might warrant future research. Now for my established subject areas, I always start annotating new topics within that subject area. So, I can prioritize it in my usual processes.

      Today, I've extended this by tagging public notes with Shrewd Learning. So when I look at the Shrewd Learning Tag, I see all notes that present potential new learning topics. Which opens a great way to collaborate loosely with other people if I can establish some traction with Shrewd Learning.

      For now, this is my reminder to do a personal blog entry based on this. More importantly, I should update this blog entry to reflect recent advances in Shrewd Learning and my other 2 online learning projects.

    1. Author Response

      Reviewer #1 (Public Review):

      Rasicci et al. have developed a FRET biosensor that is designed to light up when cardiac myosin folds. This structure is extremely important to understand, and its link to the super-relaxed (SRX) state has not been fully shown. Their study provides a comprehensive review of the literature and provides compelling data that the 15 heptad+leucine zipper+GFP construct does function well and that the DCM mutant E525K has a similar IVM velocity despite a reduced ATPase compared with HMM. They rely on the ionic strength-dependent changes in the rate of MantATP release to argue that the E525K mutation stabilizes the 'interacting heads motif' (IHM) state, which makes logical sense.

      Strengths:

      Well written and comprehensive.

      Utilizes the appropriate fluorescence-based sensor for measuring the folding of the myosin structure. Provides a detailed range of techniques to support the premise of the study

      Weaknesses:

      Over-interpretation of the outcomes from this study means that the IHM and SRX are the same. Similar studies, e.g. Anderson 2018 and Chu 2021 support the opposite view that IHM and SRX are not necessarily the same, Anderson (and Rohde 2018) point out that S1 has some element of a reduced ATPase, this clearly cannot be due to folding of the molecule. Also, mavacamten was used in these studies to show that even S1 is inhibited suggesting that SRX and IHM are not connected. This is not to say that with enough supporting evidence that these observations cannot be over-ridden, it is just not clear that there is enough in this study to support this conclusion.

      We have revised our discussion to emphasize that our results support a model in which the SRX state is enhanced by formation of the IHM, but given the S1 and 2HP data the IHM may not be required for populating the SRX biochemical state (see page 8).

      I felt that the authors passed over the recent Chu 2021 paper too quickly, the Thomas group used a FRET sensor as well and provides a direct comparison as a technique, but with opposite conclusions. They also have supporting data in Rohde 2018 that their constructs were less ionic strength sensitive. It would be useful to understand what the authors think about this.

      We have discussed the Rohde and Chu papers in more detail in the discussion (see page 8). In the Rhode paper they used proteolytically prepared HMM and S1. Rohde found 20% SRX at all KCl concentrations in S1, while HMM shifted from 50% to 20% SRX in low and high salt conditions, respectively. Our results are different in terms of the absolute fraction of the SRX state but the trend is similar in terms of S1 being salt-insensitive and HMM being salt-sensitive. The difference could be proteolytic HMM, which is a longer construct, and proteolytic S1, which is prone to internal cleavage that can impact ATPase activity. Another difference could be the mixed isoform of mantATP used in previous studies and the single isoform of mantATP used on our study (see page 5)

      Reviewer #2 (Public Review):

      The paper by Rasicci et al. examines the impact of the DCM mutation E525K in beta-cardiac myosin on its function and regulation by autoinhibition. The role of the auto-inhibited state of beta-cardiac myosin in fine-tuning cardiac contractility is an active and exciting area of current research related to muscle biology and cardiomyopathies. Several studies in the past have linked the destabilization of the autoinhibited, super-relaxed (SRX) state of myosin to the pathogenesis of hypertrophic cardiomyopathy. This timely study provides one of the first few examples where the hypocontractile phenotype of a DCM mutation has been linked to the stabilization of the SRX state.

      One of the strengths here is the utilization of a wide variety of both pre-existing and novel biochemical and biophysical assays for the study. The authors have characterized a new two-headed long-tailed myosin construct containing 15-heptad repeats of the proximal S2 (15HPZ), which they show allows myosin to form the SRX state in vitro using single ATP turnover assays. The authors go on to compare the E525K and WT proteins using the 15HPZ myosin construct in terms of their steady-state actin-activated ATPase activity, in-vitro actin-sliding velocity and single ATP turnover measurements. These assays reveal that the predominant effect of this mutation is the stabilization of the SRX state which is maintained even at 150 mM salt concentration where the WT SRX is largely disrupted. This is an important observation because DCM mutations so far have been believed to only affect the force-generating capacity of myosin.

      One of the biggest strengths of this study is the attempt to develop a FRET-based approach to directly ask if the biochemical SRX state here correlates well with the structural IHM state, which is an important unresolved question in the field. The authors have designed a FRET pair (C-terminal GFP and Cy3ATP bound to the active site) that is sensitive to the relative position of the heads and the tail, allowing them to distinguish between the low-FRET closed IHM conformation and the no-FRET open conformation. Remarkably, the authors show that the salt dependence of the FRET efficiency values closely follows their results from the salt dependence of the percent SRX for both WT and E525K proteins. The authors then attempt to substantiate their FRET results by a direct visual analysis of the conformational states populated by both WT and E525K proteins at low salt using negative staining EM analysis. The authors have optimized conditions to allow the deposition of the IHM state on grids without adding the small molecule mavacamten, which was found to be necessary in an earlier study to visualize the closed state using EM. The authors conclude that the SRX state correlates well with the IHM state and that the E525K mutation indeed stabilizes the folded-back conformation of myosin.

      This study significantly strengthens the previously illustrated correlation between the SRX and IHM states and provides methodological advances (especially visualization of the IHM state by negative EM in the absence of cross-linking agents) that will be very useful to the field going forward. The observation that a DCM mutation can lead to stabilization of the folded back state is a novel insight that should spark interest in the field to test how broadly this applies to other DCM mutations. The conclusions of the paper are mostly supported by the data; however, some clarifications and qualifications are needed.

      Weaknesses:

      The extremely low enzymatic activity of the M2β 15HPZ myosins as compared to the WT S1 control (which is a historical control not assayed in parallel with the 15HPZ proteins), is concerning for the low protein quality of the 15HPZ myosins. The authors attribute the low kcat to the high proportion of SRX population in their ensembles. However, the DRX rates reported for the WT and E525K 15HPZ proteins in the single ATP turnover assay are ~3-4 fold lower than those of their S1 counterparts. These rates reflect basal turnover of ATP in the open state and thus should not be affected by the presence of the S2 tail, which leads to concerns about the 15HPZ protein activity. In addition, the very high percentage of stuck filaments in the in vitro motility assay for the 15HPZ constructs (despite the use of dark actin) is also concerning for significant amounts of enzymatically inactive protein.

      We thank the reviewer for pointing out the differences in the S1 and HMM DRX rates. We performed additional single turnover measurements with S1, adding two sets of measurements from one additional preparation (N=3), and we demonstrate that there is a significant increase in the DRX rates of WT S1 compared to WT HMM (see pages 4-5, Table 3, Figure 3- figure supplement 3). A faster rate in S1 was also reported in Rohde et al. 2018. Indeed, the DRX rates of E525K S1 are significantly higher than WT in S1, which we also now report in the results (see page 5, Figure 3 – figure supplement 3). We addressed the concerns about 15HPZ activity by performing NH4+ ATPase assays to demonstrate that the number of active heads was similar in S1 and 15HPZ HMM (see page 4). It is possible that the higher percentage of stuck filaments in the HMM motility is due to myosin heads in the IHM state on the motility surface, which generate a drag force by non-specifically interacting with actin, but further study is necessary to examine this question.

      The authors assert that the E525K mutation represents a new mechanism by which DCM-causing mutations lead to decreased contractility - by stabilizing the sequestered state rather than affecting motor function. However, there is no evaluation of the motor function (actin-activated ATPase activity or in vitro motility) of the E525K S1, which would reveal the effects of the mutation without confounding effects due to the sequestering of heads. Interestingly, in the single ATP turnover assay, the DRX rate of the E525K S1 is >2-fold higher than the WT control, suggesting that the mutation may have effects beyond stabilization of the SRX state. The conclusion that the E525K mutation's effect on myosin function is mediated via stabilization of the SRX state would be strengthened if the effects of the mutation on the motor domain alone were also known.

      We thank the reviewer for this suggestion. We performed actin-activated ATPase assays with WT and E525K S1 and found that E525K increases kcat and lowers KATPase, demonstrating enhanced intrinsic motor activity in the mutant S1 construct (see page 4, Figure 2B). This adds an interesting dimension to the manuscript because we report a mutant that enhances the intrinsic motor activity but stabilizes the SRX/IHM (see Discussion page 10). We did not perform in vitro motility, because this assay depends on the surface attachment strategy, and we would like to compare all constructs with the same attachment strategy using a C-terminal GFP tag (mutant and WT S1 and 15HPZ HMM). Therefore, we are making the S1 construct with a C-terminal GFP tag for this purpose, to be examined in a future study.

      While the authors show strong qualitative correlations between the SRX and IHM states using single ATP turnover, FRET, and EM experiments, attempts to quantitatively compare the fraction of heads in the IHM state using the various experimental approaches is problematic. For example, the R0 value of the FRET pair used here doesn't allow precise measurement of the distances being probed here to be made, but the distances are reported and compared to predicted distances. The authors report that the R0 for their FRET pair is 63 Å. Surprisingly the authors go on to use the steady-state FRET efficiency values to determine the average D-A distance (Fig 5B) which is 100 Å when all heads are in the IHM configuration and becomes larger than that when heads open. R0 of 63 Å allows a precise distance measurement to be made in the 31.5-94.5 Å range which corresponds to 0.5-1.5 R0. It is therefore technically incorrect to use the steady-state FRET efficiency values to determine the D-A distance here. Besides, there are several unknown factors here like orientation factor (κ2) which further complicate these calculations. Similarly, the quantification of IHM state molecules from the negative stain EM experiments is significantly hampered by the disruptive effect of the grid surface on the structure of the IHM state. The authors find that limiting the contact time with the grid to ~ 5s is necessary to preserve the IHM state.

      Despite that, only ~15% WT molecules were seen in the IHM state at low salt (Fig. 6B). In contrast, ~56% E525K molecules were in the IHM state. Both these proteins have similar SRX proportions (Fig. 3C) and similar FRET efficiency values (Fig. 5A) at this salt concentration. This mismatch highlights the problem arising due to not having a measure of the populations from the FRET data. It is not clear if the hugely different proportions of the IHM state in EM experiments are indicative of the relative stability of this state in the two proteins or a random difference in the electrostatic interactions of WT vs mutant with the grid. These experiments do not provide a correct idea of the %IHM in the two proteins. In the absence of any IHM population measurement, it is important to proceed with caution when quantitatively correlating the SRX and IHM.

      We thank the reviewer for pointing out that measuring precise distances by FRET can be difficult. We agree that the low FRET efficiency makes precise distance determination even more challenging. However, FRET is quite good at measuring a change in distance given a specific donor-acceptor pair. We feel our FRET biosensor clearly demonstrates FRET efficiencies that are salt-insensitive in E525K but a clear decrease in FRET at higher salt concentrations in WT. In order to compare the trend in the predicted FRET, based on the single turnover measurements, and the actual FRET we thought it was important to plot the two together on the same graph. We understand that this could have been misleading that we were reporting actual distances. We have now plotted the FRET efficiency instead of distance as a function of KCl concentration (Figure 5B), to prevent any confusion with reporting distances. In addition, we have emphasized that the data are plotted to allow for a comparison of the trend in the single turnover and FRET data (see page 6, 10, Figure 5B).

      We agree that it is important to proceed with caution when comparing the EM to the FRET and single turnover data. The EM does not give a quantitative estimate of the fraction of IHM molecules, due to the disruptive effect of the grid surface on protein conformation. However, it does provide direct (though qualitative) evidence that the conformation underlying SRX and enhanced FRET is the IHM, and it is consistent with our interpretation that the E525K mutation enhances FRET and SRX by stabilizing the IHM. To consolidate this result, we have performed EM experiments now with a total of 3 preparations of WT and mutant (see page 6-7 and Figure 6D). We find that while there is variability from experiment to experiment, likely because the grid surface is slightly different each time the experiment is performed, in all cases there was a ~4-fold higher fraction of folded molecules in the mutant. Since each WT/mutant experimental pair was studied in parallel, using identically prepared grids, the results provide further evidence that the mutant stabilizes the IHM. However, we agree that a quantitative, direct visual correlation of the SRX and IHM is not possible based on the current EM data.

      Finally, the utility of the methods described in the paper to the field would be greatly enhanced if they were described in more detail. As currently written, it would be difficult for others to replicate these experiments.

      Thank you for the comment. We have made significant changes in the methods to clarify the details of the experiments (see pages 11-14). In addition, we have added details to the results and figure legends.

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary:

      The authors used CRISPR engineering to drop a V5 or GFP tag into teh PGRP-LE locus (protein fusions) to monitor the behavior of this intracellular peptidoglycan sensing receptor in the drosophila midgut. They show that upon immune stimulation with Ecc that PGRP-LE forms some sort of aggregate or punctae that is dynamic during the 24 hour of infection monitored. A similar response is not seen with live E. coli but a week and smaller response is observed with heat killed E. coli, for unclear reasons. These punctae appear to form independent of the classic IMD signaling components, suggesting it is upstream event in the pathway which is consistent with early studies showing the PGRP-LE multimerizes (infinitely) upon binding PGN and also that it forms amyloid fibrils doing signaling. The Ecc punctae tightly colocalize with Rab5 but not Rab7 or other early endosome markers, but in the absence of Rab5 the PGRP-LE punctae are greatly enlarged. Rab5 was found to critical for induction of PGRP-SC1 but not the classic IMD pathway AMP, Attain.

      While the conclusions of the report are intriguing and the development of these tools is very exciting, the conclusions are not fully convincing. To start, the author wish to conclude that PGRP-LE localization is altered with Ecc infection but they have not excluded that the expression of the protein is sharply upregulated. I.e. in the uninfected animals there is not really any PGRP-LE observed (1D). The try to tackle this by looking at mRNA expression, but this data lacks the unaffected control. [In fact, the uninfected control is missing on most of the gene expression data, which is a troubling omission and makes it hard to really understand what the data shows.]. Moreover, the mRNA levels do not necessarily corresponding to the protein levels, i.e. there could be post translation control. So, overall, the authors need to provide more compelling evidence that PGRP-LE is relocalized upon Ecc challenge rather than upregulated.

      Moreover, the paper contains some seeming contradictory findings that the authors make little effort explain. For example, they conclude "These results suggest that although smaller PGRP-LE aggregates can form normally in the absence of Rab5, the latter is required for proper bigger E.cc mediated PGRP-LE aggregates" because E. coli induced PGRP-LE clusters don't colocalize with Rab5, yet in the absence of Rab5, the Ecc cluster are super-enlarged (4F). This makes no sense with the conclusions.

      Finally, the interaction and function of the Rab5 interaction is underdeveloped and lacks insight. For example, why is Rab5 required for the induction of one target gene but not another? And, why not characterize this more completely? Why is there not Rab5 vesicle with E. coli feeding or even uninfected? The cell biology requires more in-depth consideration. From 4E, the authors wish to conclude that the Rab5 vesicle are induced by Ecc (even in the absence of PGRP-LE) yet the uninfected control is not shown. IN a simple world, would not one would expect Rab5 endosomes in all cells, at least to some level?

      And, focusing on the big picture, the authors claim that it is "not easily testible" if the PGRP-LE aggregates are amyloidal, as suggested by earlier publications. This could actually be tested by staining with amyloid specific dies and/or suitable mutants engineered int he RHIM domain. This would be very informative if the authors could extend this work to examine this question.

      Minor comments:

      All the colocalization data should be quantified as in 4B. It is not true that DAP = Gram negative. Gram-positive bacilli also have DAP PGN. The wording in the Introduction should be adjusted. The text needs a careful proofreading.

      Referees cross-commenting

      I think the comments from #2 and myself are aligned. Working is interesting, tools are especially exciting, but the studies are descriptive and under-developed. I will further add, I found the absence of uninfected controls for many assays a major problem.

      Significance

      The significance of this work lies in the development of powerful tools to track an intracellular innate immune receptor in an intact animals. The connection to Rab5 is curious and likely an important advance in our understanding of the cell biology of this pathway, but is under-developed. The significance is this difficult to know for certain. The Drosophila immunity field, and the insect immunity field more broadly, will be keenly interested in this study. The wider NF-κB/innate immune field will also be interested in these findings, given teh similarity between this pathway and NOD1/NOD2 immune sensing in mammals.

      My area of expertise is the Drosophila immune response and this manuscript is very much in my wheelhouse.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      August 17, 2022

      RE: Review Commons Refereed Preprint #RC-2022-01442

      Dear Editor of the EMBO Journal,

      Please find our updated manuscript and response to the reviewers’ comments. We appreciate the effort that the reviewers have put into the evaluation of our manuscript.

      We are happy with the potential importance the reviewers realise in the study:

      Reviewer 1: The finding that ubiquitination occurs inside mitochondria would be an important conceptual advance, which would open new perspectives both for ubiquitination and mitochondrial biology

      Reviewer 2: This work would represent a significant/exceptional discovery if supported by compelling data.

      Reviewer 3: the results are interesting and very important, as mentioned in the major comments section…

      With regard to the major comments raised by the reviewers, you will find below our specific response point by point with explanations and suggested novel experiments (highlighted in yellow). In summary we suggest the following actions to fully support our model:

      • We will perform a-complementation with ubiquitin (lacking the GG motif) fused at its C-terminus to the short fragment of b-galactosidase (a). Blue colonies with ωm will indicate import.
      • As shown in Figure S2, now added to the manuscript, we show detection of ubiquitinated proteins and mono ubiquitin in extracts of mitochondria pre-treated with trypsin.
      • A bio-archives address of our other manuscript will be provided.
      • The use of a-complementation for protein localization was developed by us 15 years ago and since then has been used by us and other groups verifying its use as a screening tool. One point is clear, ωm or ωc do not leak into other subcellular compartments. Nevertheless, in the research of specific genes validation is important. Yes!!! ωm and ωc are exclusively located in mitochondria or the cytosol respectively.
      • We will highly purify mitochondria on gradients and treat them with protease.
      • We cannot be sure that we will be able to detect a protein with ubiquitin modifying activity which functions solely on certain proteins in mitochondria, so publication cannot rely on this.
      • Repeat mass spectrometry with careful editing will be undertaken as suggested by the reviewer.
      • We will attempt to perform protease protection assays in the presence of specific detergents.

      Before tackling the very tough revision, we would like to know if EMBO Journal would positively consider acceptance of our manuscript based on the review and planned revision.

      Prof. Ophry Pines Microbiology & Molecular Genetics Hebrew University of Jerusalem Jerusalem 91220 Israel


      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      Summary:

      In this manuscript, Zhang et al. investigate whether ubiquitination occurs inside mitochondria of the budding yeast S. cerevisiae. They first observe thanks to a sensitive complementation assay that several components of the yeast ubiquitination (and deubiquitination) machinery can localize inside mitochondria. To be able to specifically probe ubiquitin conjugates assembled inside mitochondria they fused HA-tagged ubiquitin to a mitochondrial targeting sequence. Using this construct, they demonstrate that ubiquitin conjugates can be assembled in mitochondria. A series of elegant experiments demonstrates that the pattern of ubiquitin conjugates depends on the mitochondrial localization and the activity of the ubiquitin conjugating enzyme Rad6. Altogether, these results convincingly demonstrate that ubiquitination can occur inside yeast mitochondria when ubiquitin is intentionally targeted inside this organelle. It however remains unclear whether mitochondrial ubiquitination occurs in endogenous conditions (without targeting ubiquitin into this compartment) and whether it affects mitochondrial functions.

      Response: Regarding the question whether mitochondrial ubiquitination occurs in endogenous conditions, we feel that this is obvious based on our results. We detect numerous ubiquitination related enzymes (E1, E2, E3, DUB) eclipsed in mitochondria but none of the proteasome subunits. As pointed out by the reviewer “these results convincingly demonstrate that ubiquitination can occur inside yeast mitochondria”. With that said, additional data will be incorporated into the manuscript as suggested by the reviewer and can be seen below.

      Major comments:

      1) The materials and methods section is lacking important information (western blot protocol, details of antibodies, strains, plasmids...). It is thus difficult to evaluate how several experiments were performed and how their design (e.g. the promoters chosen to express tagged proteins) could impact the interpretation of the results. This is a major issue that needs to be corrected. The main text should also explicitly indicate whether tagged proteins used in the alpha-complementation assay are overexpressed or not.

      Response: The materials and methods section will be updated accordingly.

      2) Despite the previous comment, the data presented in the manuscript convincingly demonstrate that multiple components of the ubiquitination machinery can localize within mitochondria and that ubiquitin conjugates can be assembled in mitochondria when ubiquitin is modified to be intentionally targeted into this compartment. However, little data is shown to support the hypothesis that ubiquitin conjugates can be assembled in mitochondria when ubiquitin is not fused to a mitochondrial targeting sequence. Thus, in my opinion, the evidences presented in the current manuscript are not sufficient to conclude that ubiquitin conjugates are assembled in mitochondria in endogenous conditions (as this is done implicitly). Additional evidences are needed to draw this conclusion (see some experimental suggestions hereafter). Without further evidences, the speculative aspects of the claim that "ubiquitination occurs in the mitochondrial matrix" should be discussed explicitly.

      Response: See the discussion above why we are confident that ubiquitination occurs in mitochondria. Our major problem with ubiquitin and the ubiquitination enzymes is that they are eclipsed in mitochondria. We propose as suggested by the reviewer (item 4 of his review) to perform a-complementation with ubiquitin fused at its C-terminus to the short fragment of b-galactosidase (a). Blue colonies with ωm will indicate import.

      3) The authors used a mass spectrometry approach to identify mitochondrial ubiquitination substrates. However, they have not yet succeeded in identifying a substrate whose modification is specifically regulated by a given component of the mitochondrial ubiquitination machinery. They have also not identified a phenotype or process impacted by mitochondrial ubiquitination. Thus, at this stage, the biological consequences of mitochondrial ubiquitination remain elusive.

      __Response: __We have not identified a substrate whose modification is dependent on a given component of the mitochondrial ubiquitination machinery, even though we have tried. Again, the problem is low levels of these proteins eclipsed in mitochondria. Even when we do find a protein that is ubiquitinated (e.g. Aco1) its ubiquitination is not exclusively dependent on Rad6. Thus, different ubiquitin enzymes may have the same substrates.

      4) The authors have not directly investigated whether ubiquitin itself (without a mitochondrial targeting sequence) localizes in mitochondria. I encourage them to address this question since it would provide an important piece of evidence suggesting that mitochondrial ubiquitination can occur in endogenous conditions. This could be done using the alpha-complementation assay and the results could be presented within Figure 1. Ideally this experiment should be performed without overexpressing ubiquitin. Note that if the authors decide to use a C-terminally tagged form of ubiquitin for this experiment, the GG motif of ubiquitin should be mutated to avoid cleavage of the alpha tag by cellular DUBs. This form of ubiquitin will not be conjugatable, but this is not an issue for this experiment since its aim is to determine whether ubiquitin can be targeted to mitochondria, not to probe conjugates.

      Response: We will perform experiments as suggested by the reviewer including ubiquitin fused at its C-terminus to the short fragment of b-galactosidase (a), see item 2. We have previously made a PreSu9-Ubi lacking a GG motif but now will look at a different combination of this and other constructs.

      5) In the top panels of Figure 2 and S1, free ubiquitin is well detectable in the total and cytosolic fractions. It is however not clear to me whether it is also detectable in the concentrated mitochondrial fraction. If yes and if it would be resistant to trypsin digestion, it would provide additional evidence that endogenous ubiquitin can be targeted to the mitochondrial matrix (see previous comment).

      Response: See Item 6.

      6) The data shown in the top panel of Figure 2 and S1 also suggest that free ubiquitin is less concentrated in mitochondria than in the cytosol (since it is more difficult to detect in the concentrated mitochondrial fraction than in the cytosolic fraction, see previous comment). It is thus possible that the use of preSu9-HA-Ubi (or preFum1-HA-Ubi) lead to an artificially high intra-mitochondrial concentration of free ubiquitin. As the concentration of free ubiquitin is known to impact ubiquitination processes, I encourage the authors to compare the relative levels of free ubiquitin present in the mitochondrial fraction prepared from WT and preSu9-HA-Ubi (or preFum1-HA-Ubi) expressing cells. If free ubiquitin is detectable in mitochondrial fractions and resistant to trypsin (see previous comment), this could be done by repeating the experiment shown in Figure 3B and probing the blot with an antibody that recognizes free ubiquitin.

      Response to 5 and 6: Detection of ubiquitin in mitochondria is extremely difficult even when mitochondria are 15-fold concentrated versus the cytosol and when HA-Ubi is overexpressed. Thus, ubiquitin is eclipsed in mitochondria. Nevertheless, as shown in the Figure below which was not part of the submitted manuscript yet was performed in parallel to experiments done early on, shows detection of very weak bands of free ubiquitin in extracts of mitochondria pre-treated with trypsin.

      Endogenous ubiquitination pattern in mitochondria of _Δrad6 _cells is restored to normal by Rad6-α. __WT or Δrad6 cells containing a Rad6-α construct or an empty plasmid were subjected to subcellular fractionation. Mitochondrial fractions with or without trypsin treatment, were probed for ubiquitin by WB. Aco1 is a matrix mitochondrial protein, and Tom70 is a mitochondrial outer membrane protein (MOM) facing the cytosol.

      7) I strongly encourage the authors to provide more data indicating that "ubiquitination occurs in mitochondria" by performing experiments that do not rely on the use of the preSu9-HA-Ubi or other forms of ubiquitin that are intentionally targeted to mitochondria. For instance, they could analyse the pattern of HA-Ubi conjugates of trypsin digested mitochondrial fractions prepared from wt, rad6-delta, and rad6-delta complemented with preSu9-Rad6-alpha-SL17. Note that if trypsin digested mitochondrial fractions are too contaminated by ubiquitinated proteins present outside mitochondria to perform this experiment, the authors may use the unspecific DUB Usp2 as an alternative protease to strip ubiquitinated proteins from the mitochondria periphery.

      Response: Concentrated mitochondrial extracts from WT and Δrad6 cells untreated or treated with trypsin were probed with anti-ubiquitin antibodies (Figure above). A very weak band corresponding to free ubiquitin can be detected in extracts of mitochondria treated with trypsin but these are very weak and are on the limit of detection.

      Minor comments:

      1) Overall, the manuscript is well organized and easy to follow. The text is clearly written; the figures are well annotated.

      2) The authors should provide full images of all the blots with anti-ubiquitin and anti-HA antibodies so that one can see the bands corresponding to free ubiquitin (or free HA-Ubi). For instance, in Figure 3B, it is not possible to see the presence (or absence) of the band corresponding to free HA-Ubi because the very bottom of the image is cut.

      3) The authors should indicate whether the MTS of Su9 (and Fum1) are expected to be cleaved after import of preSu9-HA-Ubi (and preFum1-HA-Ubi) in mitochondria. They should also label on the corresponding immunoblots the presence (or absence) of the band corresponding to the free preSu9-HA-Ubi (and preFum1-HA-Ubi) (or HA-Ubi if the MTS is expected to be cleaved from these constructs).

      4) In Figure 3B, the ubiquitin conjugates produced with preSu9-HA-Ubi and preFum1-HA-Ubi have different migration patterns. I think this should be explicitly mentioned and discussed. Could it be due to the presence of lysine residues in the Su9 or Fum1 MTS that could lead to the assembly of artificial ubiquitin chains?

      5) The authors indicate that "endogenous Rad6 [...] is expressed at very low levels and can hardly be detected in the mitochondrial fraction by WB (Figure S5)". I did not manage to observe the band corresponding to endogenous Rad6 in the mitochondrial fraction in the pdf. The authors should provide a more contrasted or better quality image.

      CROSS-CONSULTATION COMMENTS I agree with reviewer 2 that proper validation of the complementation assay is crucial for this manuscript. I was myself wondering whether it uses endogenously tagged proteins or whether it is based on an overexpression system. I imagine this information will be detailed in the manuscript in preparation mentioned by the authors. I am therefore wondering whether it would be possible to ask the authors to provide the draft of this manuscript (or at least the validation part).

      Response: A bio-archives address of our other manuscript will be provided upon resubmission. See other issues referred to the response Reviewer 2.

      I agree with most comments of reviewer 3. Regarding the hypothesis that preSu9-HA-Ubi could form aggregates on the cytosolic surface of the mitochondria, I think that the results presented on Figure 7B rather argue against it (since they indicate that Rad6 localized inside mitochondria can restore the pattern of ubiquitin conjugates). That's why (in my opinion) the major question the author now need to adress is whether intra-mitochondrial ubiquitination occurs in endogenous conditions (ie without forcing ubiquitin into this compartment and without E2 or E3 overexpression).

      Response: See response to the other reviewers

      Reviewer #1 (Significance (Required)):

      The finding that ubiquitination occurs inside mitochondria would be an important conceptual advance, which would open new perspectives both for ubiquitination and mitochondrial biology research. However, the significance of the current manuscript is limited because the presented evidences heavily rely on the use of artificial conditions (ubiquitin tagged with a mitochondrial-targeting sequence) that may trigger irrelevant ubiquitination events. The significance would be much higher if the authors would provide further evidences indicating that intra-mitochondrial ubiquitination occurs in endogenous conditions and/or if they had identified a mitochondrial process specifically impacted by mitochondrial ubiquitination.

      Expertise of the reviewer: Ubiquitination, Yeast biology, protein-protein interactions. No specific expertise in mitochondrial biology

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      In the manuscript by Yu et al., the authors test the concept that certain proteins are unevenly distributed within distinct cell compartments. Due to this localization discrepancy, protein detection in some subcellular compartments can be "eclipsed" by a predominant subset of specific protein localizing in another cell compartment their actual distribution. Therefore, tiny amounts of physiologically relevant proteins could be biologically relevant. Still, their function in some locations can be overlooked (or eclipsed) because of the high expression level of the same protein in another subcellular compartment(s). Although, this concept is not particularly novel. For example, it is already known that many different proteins can localize to distinct cellular locations (e.g., permanent mitochondrial and peroxisomal localization of many proteins or transient localization of particular proteins to separate cell compartments). The authors apply a yeast system and an α-complementation assay to test further the role of such eclipsed proteins in mitochondrial biology. Specifically, they focus on the ubiquitin (Ub, or as abbreviated incorrectly in this manuscript; Ubi) conjugation pathway, components of which have never been convincingly shown to localize inside the mitochondria. This work proposes that certain ubiquitination events can occur inside yeast mitochondria. This work would represent a significant/exceptional discovery if supported by compelling data. However, the major problem with this work is that the conclusions are based on the ectopic expression of distinct proteins. This approach is not failproof in precise protein expression/delivery to the specific subcellular locations and is likely to result in a non-specific localization. Thus, the problem of eclipsed proteins is addressed by the methodology that may lead to the artificial generation of eclipsed overexpressed proteins. A more effective approach would be if the authors found a way to study this issue with endogenous proteins. The need for overexpression of mitochondria-targeted ubiquitin makes it challenging to reconcile the physiological role of these fundings. In addition, some critical technical issues and omissions further reduce the potential impact of this work (see Specific comments below). For example, strong evidence of mitochondria fraction purity and additional evidence that all the essential constructs used in this work are not misdirected to a different compartment are needed.

      Response: “Although, this concept is not particularly novel” is a very disappointing remark by the reviewer!! While dual targeting of proteins has been known for many, many years, how widespread the phenomenon was unknown and thought to be negligible. We are leaders for the last 30 years in the field of dual targeting and distribution and in particular distribution of single translation products. We coined the terms “echoforms” and “eclipsed distribution” and developed methods to detect and screen for dual targeting. The concept of eclipsed distribution and in particular eclipsed targeting to mitochondria is very new, and is leading to a novel perception of the mitochondrial proteome (see MS submission). While the reviewer appears to be an expert on ubiquitination, we are experts on dual targeting.

      • Ub was abbreviated incorrectly in this manuscript, Ubi. __Response: __This will be corrected.

      Other comments will be referred to in the response to Specific comments.

      Specific comments 1. The authors should demonstrate beyond doubt that the ω components of their assay (ω-C, which supposedly stays in the cytosol-ONLY and the ω-M component, which seemingly remains in the mitochondria-ONLY) are in the compartment that the authors claim. These two proteins are transfected into yeast cells and overexpressed. Therefore it is possible that they leak to other, not intended, subcellular compartments. The authors assume that ω-M and ω-C are exclusively located either in the mitochondria or the cytosol. However, this should be shown as validation of the assay. The indicated reference from 2005 (Ref.13) and others are irrelevant since assays have variations and are often researcher/lab dependent. This validation is very important since a misallocation of the overexpressed ω-M or ω-C, leaking into other subcellular compartments, may cause misdetection of the α-constructs.

      Response: The use of a-complementation for protein localization was developed by us 15 years ago and since then has been used by us and other groups verifying its use as a screening tool. One point is clear, ωm or ωc do not leak into other subcellular compartments. Nevertheless, in the research of specific genes validation is important. Yes!!! ωm and ωc are exclusively located in mitochondria or the cytosol respectively.

      It is not surprising that Ub conjugates are detected in mitochondrial fractions. It could be due to ubiquitination of the OMM (coming from the cytosol) or perhaps since the subcellular fractions were not pure mitochondria free from contamination (the likely culprit could be the ER). The mitochondrial fractions in this work were obtained by 10,000 g separation between cytosolic and mitochondrial crude fractions. Indeed, these 10,000 g crude fractions are highly impure with membranes from other compartments (i.e., microsomes, lysosomes, and so on). Therefore, more sophisticated purification methods should be used. In addition, the authors should also test these fractions for non-mitochondrial proteins from other membrane organelles.

      Response: We agree with the reviewer and therefore will take the following approaches:

      1. i) We will treat isolated mitochondria with protease in order to remove adhering proteins and digest OMM proteins…… see attached figure.
      2. ii) We will highly purify mitochondria on gradients and this will be straight forward since we are now employing such methods in other projects in the lab. iii) Matrix protein enrichment (by mass spec) is associated with IP for preSu9-HA-Ub conjugates which is three-fold higher than for HA-Ub. In any case the fact that we identify conjugates of proteins not known to be mitochondrial, strongly supports our thesis.

      Figure 2. Coomassie blue staining does not show any signal in the "M" fraction. It can be interpreted that the authors do not get any mitochondria there, and therefore the lack of Ub signal is due to the absence of the protein in the samples. Using the same amount of protein from each fraction would probably reduce the necessity of 15x enrichment.

      Response: The Coomassie blue staining does show a signal in the "M" fraction which is weak yet when a 15x enrichment is run, the protein level by Coomassie blue staining is similar to the cytosolic fraction.

      Figure 3. It is puzzling why the HA-UBQ presence is so strong in the crude mitochondrial fraction, but the preSu9-HA-Ub signal (mito-matrix) is comparatively weak. These data suggest that the crude mito-fraction could be highly contaminated with OTHER membranes. On the other hand, the preSu9-HA-UBQ signal is no more than 1-5% of the total mitochondrial signal. The high enrichment of the HA-Ubi in both cytosols and the mitochondria could indicate the OMM ubiquitination or (again) contamination by other compartments. The constructs with MTS are detected in the mitochondria. However, the localization of tagged MTS-Ubi in a non-targeted compartment (e.g., cytosol) should be excluded by additional exposure times. Because the manuscript talks about eclipsed proteins, this is important.

      Response: The HA-Ub is strong in the mitochondrial fraction, in the absence of trypsin, but is very weak in the presence of the protease indicating that most of the ubiquitinated proteins are externally attached to mitochondria. In contrast, PreSu9-HA-Ub is imported into the mitochondrial matrix and is protected from trypsin. This manuscript refers to “eclipsed in mitochondria” (not the cytosol) and this is true for ubiquitination enzymes as well as for ubiquitin.

      Figure 3C-E. These data indeed suggest that the Ub-conjugates could be formed inside the mitochondria. However, the above-discussed possibility that other than mitochondria compartments co-sediment in the 10,000g fractions makes the data interpretation highly challenging.

      __Response: __We will highly purify mitochondria on gradients and this will be straight forward since we are now employing such methods in other projects in the lab.

      Figure 4. Unsurprisingly, mitochondrial targeting of Ub leads to detecting some co-immunoprecipitating mitochondrial proteins. However, these data do not support the notion that Ub conjugation machinery acts inside the mitochondria and that the target proteins are indeed conjugated with Ub (the interaction with Ub is not equal to being conjugated). At the minimum, the authors should provide a validation that some of the detected mitochondrial matrix proteins are indeed ubiquitinated. To this end, purified mitochondria could be used for the candidate protein IP under denaturing conditions and then blotted for the candidate protein and Ub.

      __Response: __As shown in Table S2 and figure S7, forms of Ilv5, a mitochondrial protein, are ubiquitinated in WT and Drad6 cells. These modified forms of Ilv5 can be eluted from mitochondrial extracts of WT and Drad6 cells. However, the ubiquitination of ilv5 is not dependent or effected by the Drad6 mutation. We cannot be sure that we will be able to detect a protein with ubiquitin modifying activity which functions solely on certain proteins in mitochondria.

      Figure 5. The knock-out of the E2 Rad6 causes a change in the mitochondria ubiquitination pattern. This is an interesting observation, but again it does not prove that the change in the mitochondrial ubiquitination is due to the activity of Rad6 inside of the mitochondria, as opposed to ubiquitination of the OMM proteins or contaminating fractions. One also wonders why overexpression of mitochondria-targeted Ub would be necessary to detect the ubiquitination if this process was physiologically relevant, especially given that detecting endogenous Ub is not challenging. Furthermore, the apparent increase in ubiquitination in E2 mutant cells (Fig. 5) should also be addressed in more detail. Finally, data from one WB is shown, and quantification of several independent experiments should also be provided.

      __Response: __We show in the MS that RAD6 is exclusively targeted to mitochondria (Su9MTS) while unimported molecules are degraded (SL17; degron). This hybrid Rad6 can restore the WT ubiquitin pattern, while a rad6 active site mutant cannot.

      Figure 6. Can the authors provide Western blot data showing the expression of Rad6? Furthermore, quantifying these rescue experiments is necessary to make this conclusion more solid.

      Response: Even though we did not succeed in making good Rad6 antisera, we can clearly detect Rad6-a fusion proteins (Figure 7B).

      Figure 7. The authors found that preSu9-Rad6-α have problems being imported into the mitochondria matrix; therefore, they rebuild it as a preSu9-Rad6-α-SL17 protein. SL17 is a degron that targets the cytosolic protein (not imported into the mitochondria) to the proteasome and degraded (Figs. 7A-B-C). These issues could be a red flag for the rest of the manuscript, suggesting that other constructs (that were not critically evaluated for their localization in this work) could leak to different cellular compartments.

      Response: The wording used by the reviewer is particularly disturbing since current understanding in cell biology of eukaryotic cells does not accept “leaking” of proteins to different cellular compartments. One wouldn’t want DNAses, RNAses, Proteases etc leaking from one compartment to another. The localization of proteins to different cellular compartments involves very precise signals on the proteins, and specific cellular components, such as translocases, are required to target proteins to their exact destination. This is true for Rad6; it contains an MTS like sequence which when removed blocks import of the protein into mitochondria. Rad6 according to our analysis is an eclipsed dual targeted protein, so it no surprise that it is in two compartments and the trick with the SL17 degron solves the problem.

      The manuscript needs to be carefully edited, some references are in the not correct format, and there are issues with figure labels.

      Response: Careful editing will be undertaken as suggested by the reviewer.

      CROSS-CONSULTATION COMMENTS I agree with a great summary by reviewer 1. This discovery should be validated by top-quality data.

      Reviewer #2 (Significance (Required)):

      In the manuscript by Yu et al., the authors test the concept that certain proteins are unevenly distributed within distinct cell compartments. Due to this localization discrepancy, protein detection in some subcellular compartments can be "eclipsed" by a predominant subset of specific protein localizing in another cell compartment their actual distribution. Therefore, tiny amounts of physiologically relevant proteins could be biologically relevant. Still, their function in some locations can be overlooked (or eclipsed) because of the high expression level of the same protein in another subcellular compartment(s). Although, this concept is not particularly novel. For example, it is already known that many different proteins can localize to distinct cellular locations (e.g., permanent mitochondrial and peroxisomal localization of many proteins or transient localization of particular proteins to separate cell compartments). The authors apply a yeast system and an α-complementation assay to test further the role of such eclipsed proteins in mitochondrial biology. Specifically, they focus on the ubiquitin (Ub, or as abbreviated incorrectly in this manuscript; Ubi) conjugation pathway, components of which have never been convincingly shown to localize inside the mitochondria. This work proposes that certain ubiquitination events can occur inside yeast mitochondria. This work would represent a significant/exceptional discovery if supported by compelling data. However, the major problem with this work is that the conclusions are based on the ectopic expression of distinct proteins. This approach is not failproof in precise protein expression/delivery to the specific subcellular locations and is likely to result in a non-specific localization. Thus, the problem of eclipsed proteins is addressed by the methodology that may lead to the artificial generation of eclipsed overexpressed proteins. A more effective approach would be if the authors found a way to study this issue with endogenous proteins. The need for overexpression of mitochondria-targeted ubiquitin makes it challenging to reconcile the physiological role of these fundings. In addition, some critical technical issues and omissions further reduce the potential impact of this work (see Specific comments above). For example, strong evidence of mitochondria fraction purity and additional evidence that all the essential constructs used in this work are not misdirected to a different compartment are needed.

      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      Summary: In this study, the authors detected a set of components of a ubiquitination system in the mitochondrial matrix in budding yeast using the subcellular compartment-dependent α-complementation assay. The authors detected the conjugates of mitochondrial targeting signal sequence-directed HA-Ub (preSu9-HA-Ub) in the mitochondrial matrix. The immunoprecipitates of the preSu9-HA-Ubi conjugates were highly enriched for the mitochondrial matrix proteins. Subsequently, the authors focused on the Rad6 E2 ubiquitin conjugating enzyme in the mitochondrial matrix and evaluated its inactivation-altered ubiquitination pattern in the organelle. The authors conclude that ubiquitination occurs in the mitochondrial matrix because of the eclipsed targeted components of the ubiquitination machinery.

      Major comments: The authors argued that the proteins that were modified with preSu9-HA-Ubi, which was forced to be imported into the mitochondria, are present in the mitochondrial matrix, because these species are resistant to trypsin digestion. However, it was possible that they formed severe aggregates on the cytosolic surface of the mitochondria, and hence, were resistant to the proteinase. In other words, a small amount of proteins that were not imported into the mitochondria could be deposited on the cytosolic surface of the mitochondria, where they were modified with preSu9-HA-Ubi by cytosolic Rad6. To confirm if the preSu9-HA-Ubi-modified proteins were really present in the mitochondrial matrix, they should perform the protease protection assay in the presence of an appropriate detergent (Figure 3D). In addition, subcellular fractionation of the organelle by density gradient centrifugation, indirect immunofluorescence microscopic analysis of the preSu9-HA-Ubi conjugates, and/or experiments on the in vitro import of preSu9-HA-Ubi and Rad6 into the mitochondria would strongly support the authors conclusion. Other experiments that might support the authors conclusion would be to test whether the band pattern for the preSu9-HA-Ubi conjugates changes when the mitochondrial import is impaired.

      Response: We will attempt to perform 1) Protease protection assay in the presence of a detergent (Figure 3D). 2) Subcellular fractionation of the organelle by density gradient centrifugation. 3) In vitro import of Rad6 into the mitochondria.

      Minor comments: In Figure 3B, the molecular weight distributions of the preSu9-HA-Ubi conjugates and those of the preFum-HA-Ubi conjugates are different. Is there any reason for this difference?

      In Figure 3E, the position of "-" (MG132) for lane 1 is not correct.

      In Figure 6A: The band pattern for preSu9-HA-Ubi (lane 13) in the rad6-delta cells expressing Ubc8-alpha is different from that of the wild-type cells expressing Ubc8-alpha (lane 12) as well as that obtained from the rad6-delta cells harboring empty plasmids (lane 9). Is there any explanation for this observation?

      In Figure 7B and S6: The level of preSu9-Rad6-alpha-SL17 in the rad6-delta cells is always lower than that in the wild-type cells (compare lanes 13 and 10 in Figure 7B, and lanes 13 and 12 in Figure S6). Is there any explanation for this observation? The protease protection assay (with detergent control) is needed to fully confirm that preSu9-Rad6-alpha-SL17 is present in the mitochondria.

      In Figure S7, the authors presented the matrix proteins, Ilv5 and Aco1, detected in the preSu9-HA-Ubi IPed samples and described this observation in the main text. However, the authors also showed the blots for Idh1 and Fum1, which were also pulled down with preSu9-HA-Ubi from the WT cells more than from the rad6-delta cells. Is this correct? If so, please elucidate this observation in the main text.

      Figure 8D and 8E are not cited in the main text. Although there are no explanations for these figures in the main text, it looks like Rad6-deltaN11-alpha resides in the mitochondrial fraction. However, the alpha-complementation assay suggests that it resides in the cytosol. Please explain this discrepancy.

      First page of the discussion section, item 6): E2 Rad6, but not E3 Rad6?

      Figure S7: HA-Ub (cytosolic form) control is needed in addition to the empty vector control.

      Figure S7, left panel: There is an unnecessary line break in "Hsp60" and "Ilv5."

      Figure S7, right panel: There is an unnecessary line break in "Hsp60."

      CROSS-CONSULTATION COMMENTS I agree with comments of reviewer 1 and 2. -Validation of the complementation assay. -I also think that it is important to address whether intra-mitochondrial ubiquitination can be observed with endogenous level of ubiquitin. If even a small amount of preSu9-HA-Ub is mistargeted to the cytosol, proteins at the cytosolic side of mitochondrial outer membrane could be ubiquitinated and detected in the mitochondrial fraction. -Preparation of mitochondria with more sophisticated purification methods (i.e. high resolution density gradient) would be needed to separate mitochondria from ER and other organelles. -More information is needed in the materials and methods section.

      Reviewer #3 (Significance (Required)): Significance Although the results are interesting and very important, as mentioned in the major comments section, additional experiments are needed to support their model. However, researchers working on the mitochondrial biology and ubiquitin systems might be interested in and influenced by the reported findings.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary:

      In this manuscript, Zhang et al. investigate whether ubiquitination occurs inside mitochondria of the budding yeast S. cerevisiae. They first observe thanks to a sensitive complementation assay that several components of the yeast ubiquitination (and deubiquitination) machinery can localize inside mitochondria. To be able to specifically probe ubiquitin conjugates assembled inside mitochondria they fused HA-tagged ubiquitin to a mitochondrial targeting sequence. Using this construct, they demonstrate that ubiquitin conjugates can be assembled in mitochondria. A series of elegant experiments demonstrates that the pattern of ubiquitin conjugates depends on the mitochondrial localization and the activity of the ubiquitin conjugating enzyme Rad6. Altogether, these results convincingly demonstrate that ubiquitination can occur inside yeast mitochondria when ubiquitin is intentionally targeted inside this organelle. It however remains unclear whether mitochondrial ubiquitination occurs in endogenous conditions (without targeting ubiquitin into this compartment) and whether it affects mitochondrial functions.

      Major comments:

      1) The materials and methods section is lacking important information (western blot protocol, details of antibodies, strains, plasmids...). It is thus difficult to evaluate how several experiments were performed and how their design (e.g. the promoters chosen to express tagged proteins) could impact the interpretation of the results. This is a major issue that needs to be corrected. The main text should also explicitly indicate whether tagged proteins used in the alpha-complementation assay are overexpressed or not.

      2) Despite the previous comment, the data presented in the manuscript convincingly demonstrate that multiple components of the ubiquitination machinery can localize within mitochondria and that ubiquitin conjugates can be assembled in mitochondria when ubiquitin is modified to be intentionally targeted into this compartment. However, little data is shown to support the hypothesis that ubiquitin conjugates can be assembled in mitochondria when ubiquitin is not fused to a mitochondrial targeting sequence. Thus, in my opinion, the evidences presented in the current manuscript are not sufficient to conclude that ubiquitin conjugates are assembled in mitochondria in endogenous conditions (as this is done implicitly). Additional evidences are needed to draw this conclusion (see some experimental suggestions hereafter). Without further evidences, the speculative aspects of the claim that "ubiquitination occurs in the mitochondrial matrix" should be discussed explicitly.

      3) The authors used a mass spectrometry approach to identify mitochondrial ubiquitination substrates. However, they have not yet succeeded in identifying a substrate whose modification is specifically regulated by a given component of the mitochondrial ubiquitination machinery. They have also not identified a phenotype or process impacted by mitochondrial ubiquitination. Thus, at this stage, the biological consequences of mitochondrial ubiquitination remain elusive.

      4) The authors have not directly investigated whether ubiquitin itself (without a mitochondrial targeting sequence) localizes in mitochondria. I encourage them to address this question since it would provide an important piece of evidence suggesting that mitochondrial ubiquitination can occur in endogenous conditions. This could be done using the alpha-complementation assay and the results could be presented within Figure 1. Ideally this experiment should be performed without overexpressing ubiquitin. Note that if the authors decide to use a C-terminally tagged form of ubiquitin for this experiment, the GG motif of ubiquitin should be mutated to avoid cleavage of the alpha tag by cellular DUBs. This form of ubiquitin will not be conjugatable, but this is not an issue for this experiment since its aim is to determine whether ubiquitin can be targeted to mitochondria, not to probe conjugates.

      5) In the top panels of Figure 2 and S1, free ubiquitin is well detectable in the total and cytosolic fractions. It is however not clear to me whether it is also detectable in the concentrated mitochondrial fraction. If yes and if it would be resistant to trypsin digestion, it would provide an additional evidence that endogenous ubiquitin can be targeted to the mitochondrial matrix (see previous comment).

      6) The data shown in the top panel of Figure 2 and S1 also suggest that free ubiquitin is less concentrated in mitochondria than in the cytosol (since it is more difficult to detect in the concentrated mitochondrial fraction than in the cytosolic fraction, see previous comment). It is thus possible that the use of preSu9-HA-Ubi (or preFum1-HA-Ubi) lead to an artificially high intra-mitochondrial concentration of free ubiquitin. As the concentration of free ubiquitin is known to impact ubiquitination processes, I encourage the authors to compare the relative levels of free ubiquitin present in the mitochondrial fraction prepared from wt and preSu9-HA-Ubi (or preFum1-HA-Ubi) expressing cells. If free ubiquitin is detectable in mitochondrial fractions and resistant to trypsin (see previous comment), this could be done by repeating the experiment shown in Figure 3B and probing the blot with an antibody that recognizes free ubiquitin.

      7) I strongly encourage the authors to provide more data indicating that "ubiquitination occurs in mitochondria" by performing experiments that do not rely on the use of the preSu9-HA-Ubi or other forms of ubiquitin that are intentionally targeted to mitochondria. For instance, they could analyse the pattern of HA-Ubi conjugates of trypsin digested mitochondrial fractions prepared from wt, rad6-delta, and rad6-delta complemented with preSu9-Rad6-alpha-SL17. Note that if trypsin digested mitochondrial fractions are too contaminated by ubiquitinated proteins present outside mitochondria to perform this experiment, the authors may use the unspecific DUB Usp2 as an alternative protease to strip ubiquitinated proteins from the mitochondria periphery.

      Minor comments:

      1) Overall, the manuscript is well organized and easy to follow. The text is clearly written; the figures are well annotated.

      2) The authors should provide full images of all the blots with anti-ubiquitin and anti-HA antibodies so that one can see the bands corresponding to free ubiquitin (or free HA-Ubi). For instance, in Figure 3B, it is not possible to see the presence (or absence) of the band corresponding to free HA-Ubi because the very bottom of the image is cut.

      3) The authors should indicate whether the MTS of Su9 (and Fum1) are expected to be cleaved after import of preSu9-HA-Ubi (and preFum1-HA-Ubi) in mitochondria. They should also label on the corresponding immunoblots the presence (or absence) of the band corresponding to the free preSu9-HA-Ubi (and preFum1-HA-Ubi) (or HA-Ubi if the MTS is expected to be cleaved from these constructs).

      4) In Figure 3B, the ubiquitin conjugates produced with preSu9-HA-Ubi and preFum1-HA-Ubi have different migration patterns. I think this should be explicitly mentioned and discussed. Could it be due to the presence of lysine residues in the Su9 or Fum1 MTS that could lead to the assembly of artificial ubiquitin chains?

      5) The authors indicate that "endogenous Rad6 [...] is expressed at very low levels and can hardly be detected in the mitochondrial fraction by WB (Figure S5)". I did not manage to observe the band corresponding to endogenous Rad6 in the mitochondrial fraction in the pdf. The authors should provide a more contrasted or better quality image.

      CROSS-CONSULTATION COMMENTS

      • I agree with reviewer 2 that proper validation of the complementation assay is crucial for this manuscript. I was myself wondering whether it uses endogenously tagged proteins or whether it is based on an overexpression system. I imagine this information will be detailed in the manuscript in preparation mentioned by the authors. I am therefore wondering whether it would be possible to ask the authors to provide the draft of this manuscript (or at least the validation part).

      • I agree with most comments of reviewer 3. Regarding the hypothesis that preSu9-HA-Ubi could form aggregates on the cytosolic surface of the mitochondria, I think that the results presented on Figure 7B rather argue against it (since they indicate that Rad6 localized inside mitochondria can restore the pattern of ubiquitin conjugates). That's why (in my opinion) the major question the author now need to adress is whether intra-mitochondrial ubiquitination occurs in endogenous conditions (ie without forcing ubiquitin into this compartment and without E2 or E3 overexpression).

      Significance

      The finding that ubiquitination occurs inside mitochondria would be an important conceptual advance, which would open new perspectives both for ubiquitination and mitochondrial biology research. However, the significance of the current manuscript is limited because the presented evidences heavily rely on the use of artificial conditions (ubiquitin tagged with a mitochondrial-targeting sequence) that may trigger irrelevant ubiquitination events. The significance would be much higher if the authors would provide further evidences indicating that intra-mitochondrial ubiquitination occurs in endogenous conditions and/or if they had identified a mitochondrial process specifically impacted by mitochondrial ubiquitination.

      Expertise of the reviewer: Ubiquitination, Yeast biology, protein-protein interactions. No specific expertise in mitochondrial biology

    1. How can you generate category and tag pages? More generally, how do you generate any limited set of pages based on querying information from other content, without having to manually create a new (probably empty) content file?

      I am very much a dev, but anything but an expert when it comes to the web or SSGs. This didn't seem that unsolvable to me although I'll acknowledge I do more in Liquid than one "should".

      (ETA: Wait, no, the author agrees with me that doing a lot in one's templates is good.)

    1. Reviewer #3 (Public Review):

      In this work, Chen et al. measured the DNA binding dynamics of HIF transcription factors using single-particle tracking. In particular, they examined the impact of heterodimerization between the alpha and beta subunits, the integrity of the DNA binding domain and the nature of the transactivation domain in DNA binding. As expected, they found that the stoichiometry between the heterodimerization partners directly impacts the bound fraction of the beta subunit which is devoid of a DNA binding domain. More interestingly, using domain swaps between HIF-1alpha and HIF2-alpha they found that the transactivation domain of the alpha subunit plays a major role in determining the bound fraction of the beta subunit (and thus the heterodimer). This work is important because it increases our understanding of how TF search the genome, beyond the traditional conception of the "addressing tag" provided solely by the DNA binding domain. This work is thus of interest to the broad audience of scientists studying gene regulation.

    1. he war in Ukraine remains a major variable in the worldwide supply outlook since Russia normally supplies one of every 10 barrels of the global 100-million-barrel-a-day market

      Umfang des Ölmärkte: 100 Mill. Barrel am Tag.

      Russischer Anteil: 10%

      Verbrauch der USA: Ca ein Drittel

    1. Reviewer #1 (Public Review):

      Ahmed et al. examine the changes in the enhancer landscape that may contribute to the transition from Barrett's oesophagus (BO) to oesophageal adenocarcinoma (OAC), building upon their past works looking at the chromatin changes within this transition. They identified a repertoire of eRNA regions that display differential expression between OAC and BO, validating their association to enhancers using H3K27ac levels, CUT&TAG, and KAS-seq. The authors look further into the target genes and regulatory TFs that may define eRNA levels, finding several TFs - AP1, KLF5, CTCF, and HNF1 - that have previously been implicated in OAC and confirming that sets of eRNA target genes were downregulated upon depletion of these TFs. Ahmed et al. also showed that eRNA target genes were relevant to OAC phenotypes, akin to that of DEGs in whole RNA-seq datasets. The authors lastly validate the activity of certain eRNAs targeting JUP, MYBL2, and CCNE1 using functional methods to confirm enhancer activity and effects on cell viability, as well as clinical features such as the age of diagnosis and survival time.

      The landscape of eRNA activity seems to be well validated. However, deeper analyses to support the relevance of the function of key eRNAs, their specificity in regulating target genes, and the interaction with other OAC features would further support these findings.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Manuscript number: RC-2022-01481R

      Corresponding author(s): Sebastian Voigt. Mirko Trilling, David Schwefel

      1. General Statements [optional]

      -

      2. Description of the planned revisions

      Reviewer #1: Evidence, reproducibility and clarity

      Using proteome profiling of rat CMV infected cells, the authors of this study identify the E27 protein of rat cytomegalovirus as being crucial for proteasomal degradation of STAT2. Since E27 shares 56% sequence identity to the previously characterized STAT2 antagonist M27 of murine CMV the authors investigated association of E27 with the Cullin4-RING UbL CRL4. Using gel filtration chromatography they provide evidence that E27 forms a stable ternary complex with DDB1 and STAT2 suggesting that E27 bridges STAT2 to DDB1 which is further corroborated by data from cross-linking mass spectrometry. A cross-linked DDB1/DDA1/E27/STAT2 complex was then used for cryo-EM imaging experiments. The subsequent single particle analysis yielded a density map at 3.8 A resolution that was further used to generate an E27 molecular model. At this point it should be noted that resolution was not very high and data form AlphaFold2 prediction and CLMS experiments were necessary to build a model which was described as having "sufficient quality", however, no quality parameters are included for this model. In this model, a cryptic zinc-binding motif was identified that turned out to be well conserved in M27. At this point the study switches to a mutational analysis of M27: MCMV mutants either lacking M27 or bearing an AxAxxAA triple mutation were investigated both in cell culture and in animal models. Surprisingly, the M27-AxAxxA mutant while exhibiting attenuated IFN inhibition was still more active than an M27 deletion mutant. Later during the study it is postulated that this may be due to the fact that E27 binding to STAT2 abrogates the interaction with IRF9, however, this is only predicted from modeling and no experimental data are provided for this hypothesis. Furthermore, modeling approaches were used to predict how E27 replaces endogenous CRL4 substrate receptors and how E27 recruits STAT2 to mediate CRL4-catalysed ubiquitin transfer.

      Reviewer #1: Significance

      __Reviewer #1: __This is an interesting and well written paper describing for the first time in molecular detail how a cytomegalovirus-encoded interferon antagonist degrades STAT2 by mimicking the molecular surface properties of cellular CRL4 substrate receptors.

      This study should be of broad interest for both virologists and structural biologists.

      Authors Response: We thank the reviewer for the insightful and constructive evaluation. We are very grateful for highlighting the significance of our work.

      Reviewer #1: Major points

      __Reviewer #1: __To my opinion the authors should perform mutational analysis in the context of E27 and RCMV. I accept that switching to M27 may be easier due to established procedures for MCMV mutagenesis and analysis, however, since all structural work is primarily done on E27 it would be consequent to confirm these structural predictions in the context of E27 before switching to a related protein.

      Authors Response: As the Reviewer appreciated, there were multiple reasons for the switch from RCMV-E E27 to MCMV M27. Most importantly, the MCMV in vivo infection model in mice is very well-established. Please also note that MCMV is applied far more often by virologists and immunologist as a standard model. Thus, the extension of our findings from RCMV to MCMV increases the relevance and outreach of the study. By performing the experiments in the MCMV context, we also aimed to emphasise that the function of the zinc-binding motif, which structurally organises the DDB1-binding domain, is functionally conserved among E27/M27-like proteins. Obviously, Reviewer #1 could ask why we do not solve the structure of M27 parallel to E27. With the sole exception of E27, none of the rodent M27 homologues could be produced recombinantly in a soluble form, preventing the purification and structure analysis of M27.

      Since we agree with Reviewer #1 that the extension from E27 to M27 may read “a bit rough” without a mutational analysis in the E27 context, we will construct RCMV-E E27 mutants leading to Cys=>Ala exchanges in the Zn-binding motif. An analysis of the interaction between DDB1 and these E27 mutants will be included in the revised manuscript.

      __Reviewer #1: __Moreover, data on the replication of the generated E27 deletion RCMV should be included in the manuscript (i.e. growth curves).

      Authors Response: RCMV mutants lacking the E27 gene exhibit an impaired replication. According to the suggestion, the growth curves will be part of the revised manuscript.

      Reviewer #1: The hypothesis that STAT2/E27 interaction is sterically incompatible with IRF9 binding is only based on structural prediction. It would help if the authors could present experimental evidence for such a mechanism.

      Authors Response: The hypothesis is based on three lines of argumentation: (i) structural data regarding the binding interface between STAT2 and E27 covering the known STAT2-IRF9 interface (Fig. 7F) (Rengachari et al., 2018). (ii) The finding that M27 mutants incapable to bind DDB1 and induce STAT2 degradation along the ubiquitin proteasome pathway retain a residual capacity to inhibit ISRE signaling, suggesting that the binding of M27 to STAT2 suffices to elicit some signaling inhibitory functions (Fig. 7G). (iii) To elicit their function, CRL4 substrate receptors such as E27 interact with two partners. As we discussed elsewhere (Le-Trilling and Trilling, 2020), a simultaneous development of two independent traits violates evolutionary and probability theories. Thus, these receptors must acquire their binding interfaces sequentially, and the first interaction must provide an evolutionary advantage allowing the fixation of the allele in the population. Afterwards, the second binding interface evolves. Thus, a hypothesis in which E27/M27 precursors evolved the capacity to bind STAT2, preventing its association with IRF9 thereby establishing relevant but incomplete IFN inhibition (before the DDB1 interface was invented leading to STAT2 degradation by the proteasome), provides a parsimonious explanation for all these findings without violating evolutionary constraints. To corroborate our argumentation, we will analyse if E27 indeed displaces IRF9 from STAT2 by analytical gel filtration and/or co-immunoprecipitation experiments.

      Reviewer #2: Evidence, reproducibility and clarity

      __Reviewer #2: __The manuscript entitled "Structure and mechanism of a novel cytomegaloviral DCAF mediating interferon antagonism" by Dr. Schwefel and colleagues cleverly combines biochemistry, mass-spectrometry, Cryo-EM and cell biology to dissect how RCMV-E hijacks its hosts ubiquitylation machinery to mediate proteasomal degradation of STAT2, a key player driving the antiviral IFN response. They identify E27 as DDB1-binding element, which is able promote CRL4-dependent ubiquitylation of STAT2, and demonstrate its effect on STAT2 levels by knockout RCMV-E strains. These findings are supported by in vitro reconstitution of the DDB1/E27/STAT2 complex and analyses via XL-MS and Cryo-EM. The obtained data are then powerfully validated and analysed in mutational strains via infection of homologue in vivo models. The results collectively explain how E27 mimics endogenous CRL4 substrate receptors, thereby recruiting STAT2 to be targeted by CLR4 for ubiquitylation in a NEDD8-dependent manner.

      Overall this is an important study that provides convincing insights on how rodent CMVs antagonize their host interferon response by exploiting its ubiquitin-proteasome system.

      The manuscript is well written and its introduction is extraordinarily comprehensive. There are a few minor points for the authors to consider below.

      Authors Response: We thank the reviewer for this very positive assessment.

      Reviewer #2: Significance

      Reviewer #2: The work of Schwefel and colleagues combines several powerful state-of-the art techniques to dissect the mechanism of the viral protein E27 and, for the first time, provides a rational for its ability to act as STAT2 antagonist. They performed outstanding structure-function analyses of the ubiquitin system, including the first global proteomic profiling of RCMV-infected cells, setting the standard for its human counterpart as rodent CMVs are commonly used as infection models. The manuscript is highly suitable for publication in any of the journals associated with the review commons platform.

      Authors Response: Again, we thank the reviewer for these kind words and the appreciation of our work.

      Reviewer #2: CROSS-CONSULTATION COMMENTS

      Reviewer #2: This reviewer agrees that at least testing mutants in the E27 in some assays would be appropriate.

      Authors Response: As detailed in the response to Reviewer #1, we will generate RCMV-E E27 mutants targeting the Zn-binding motif by site-directed mutagenesis. An analysis of the interaction between DDB1 and these E27 mutants will be included in the revised manuscript.

      Reviewer #3: Evidence, reproducibility and clarity

      __Reviewer #3: __Le-Trilling et al. present the first proteomic analysis of RCMV-infected cells, where they identified STAT2 as one of the most heavily downregulated (and degraded) proteins. This analysis showed that RCMV mediated degradation of STAT2 is conserved in closely related species used as animal models (rat and mouse) and human, despite the intra-host adaptation of each CMV. They also identify E27 as the RCMV factor that targets STAT2 for degradation, that exhibits ~50% homology with MCMV pM27. This study also identifies a Zinc binding motif in E27 using Cryo-EM which is conserved in other CMV species and is potentially involved in antagonising Type I and III responses.

      Reviewer #3: Significance

      __Reviewer #3: __The present work provides the first proteomics analysis of RCMV infection in rat cells, comparing infected vs non-infected rat fibroblasts to access potential RCMV targets. Then, it focuses on the characterisation of RCMV E27 and its role targeting and interacting with STAT2 (plus recruiting the Cul4 complex for STAT2 degradation). Finally, it provides the Cryo-EM structure of E27 and its CMV homologues, and the structure of the complex of E27 with elements of the CUL4 complex and STAT2. This is the first time that E27 function and structure are characterised. These are all novel findings - although the mouse homologue M27 has previously been found to interact with and degrade STAT2 (published by some of the same authors in Plos pathogens in 2011, (https://doi.org/10.1371/journal.ppat.1002069). Therefore the chief novel information is the structural studies.

      The manuscript will be of interest to researchers working with human and animal herpesviruses.

      My field of expertise is in Virology, Innate Immunity and host-virus interactions from an evolutionary perspective. I do not have expertise in Cryo-EM, so I could not evaluate the methods used in the section.

      __Authors Response: __We thank the reviewer for the positive evaluation of our work and its significance.

      Reviewer #3: Major points

      __Reviewer #3: __1. The authors claim the identification of a Zinc-binding motif in the protein E27 (RCMV) using Cryo-EM, then validation of the phenotype with MCMV WT, delM27 and M27 AxAxxA. To justify the change to MCMV to perform the functional validation, they stated "MCMV M27, the closest E27 homologue, exhibits 56% and 76% amino acid sequence identity and similarity, respectively (Fig. S4B). E27 and M27 AlphaFold2 structure predictions are almost indistinguishable (RMSD of 1.195 Å, 6652 aligned atoms) (Figs. 3B, S4A), and structural alignment of these predictions demonstrated conservation of side chain positions involved in zinc-binding (Fig. 3C). Thus, M27 represents a valid model to study functional consequences of interference with the zinc coordination motif through site-directed mutagenesis, and to test the predictive power of our E27/M27 model". Although they rationalise the change to MCMV to validate the functional outcomes of the newly identified zinc binding motif with alignments and Cryo-EM data, it falls within the DDB1 binding region that is less conserved (Fig S4B). The addition of a mouse model here provides a solid result but given the aim of the paper is to provide a proper characterisation of RCMV and elucidate some inter-species adaptations, I strongly recommend the validation with E27 here given the potential impact of this motif. Rather than having to repeat this in a rat model (which would clearly be a large amount of work), this could simply be achieved by constructing the relevant deletion / mutant viruses and assessing in vitro in a relevant cell line (readout - either virus titre or luciferase assay as shown in Figure 3G/H).

      __Authors Response: __Please also see our responses to the other reviewers. Briefly, we will apply side-directed mutagenesis to alter the CxCxxC motif in E27 that binds the zinc ion, and analyse the interaction of these E27 mutants with DDB1. In this context, we would like to add that almost two thirds of E27 residues in direct contact with DDB1 are at least type-conserved in M27, and the zinc-coordinating side chains are totally conserved (Fig. 3C). Together with a predicted similar structural organization of the respective binding regions (Fig. S11), and in light of our MCMV mutagenesis results (Fig. 7), it is highly likely that the DDB1-binding mode is conserved between E27 and M27. As mentioned above, we will put this assumption to the test in the revision process.

      __Reviewer #3: __Furthermore, in Figure 2, the GF assay was performed using full-length DDB1, however CLMS was performed using DDB1 delBPB (interchange between these two proteins continues in the remainder of the paper). This should be at least justified, and preferably one or other of wt DDB1 and DDB1 delBPB used in the GF or CLMS assay where this has not yet been performed. Later on in the results section (Fig 5E), the authors use wt DDB1 while in fig 4 they used the delBPB to describe the interaction with E27 - would be relevant to have consistency across the paper and some supplementary data that could support using one or the other in each assay.

      __Authors Response: __Protein complex preparations including full length DDB1 did not yield cryo-EM reconstructions at appropriate resolution for model building, almost certainly due to the known flexibility of the DDB1 BPB, impeding proper alignment of the cryo-EM particle images. This is why we switched to DDB1ΔBPB. Importantly, the structure model including full length DDB1 (Fig. S12B) clearly demonstrates that the BPB is located on the opposite side of the E27 binding interface on DDB1 (where it is situated to flexibly connect to the CUL4 scaffold to create the ubiquitination zone around immobilised substrates [Fig. 6]). This rules out an involvement of DDB1 BPB in E27- and/or STAT2-binding processes. Several previous studies have employed DDB1ΔBPB to facilitate structure determination, and have successfully applied the resulting structural models for functional follow-up experiments in the context of complete CRL4 assemblies (Bussiere et al., 2020; Petzold et al., 2016; Slabicki et al., 2020). Nevertheless, we will repeat GF experiments with DDB1ΔBPB for consistency and include these data in the revised manuscript.

      Reviewer #3: Minor points

      __Reviewer #3: __2. Although they present sufficient detail in the methods, further details in the text should be given as to the number of repeats performed in each case, and whether the data shown is representative or based on an average of repeats (preferably the latter; if representative, the data for other repeats should be shown in supplementary information).

      Authors Response: We will add this information in the revised version of the manuscript.

      3. Description of the revisions that have already been incorporated in the transferred manuscript

      Reviewer #1: Major points

      __Reviewer #1: __Resolution of the cryoEM structure is rather low and many predictions of the manuscript are based on modeling using AlphaFold2 prediction. The authors describe their model as of "sufficient quality", however, no quality measures are included in the manuscript. At least the discussion should address limitations of the used approach.

      Authors Response: While we apologize for not sufficiently describing our quality measures, we respectfully disagree regarding the conclusion. Our resolution (3.8 Å, map 1) lies well within the 3–4 Å resolution range of the vast majority of structures deposited to the Electron Microscopy Data Bank during the last five years (https://www.emdataresource.org/statistics.html). Nevertheless, de novo modelling in this resolution regime is challenging. This is why we sought additional guidance through cross-linking mass spectrometry (XL-MS) restraints and AlphaFold2. Please also note that modelling of E27 was not based solely on the AlphaFold2 prediction. Instead, a partial model corresponding to the α-domain was manually built in map 1, guided by XL-MS information (see Methods - “Model building and refinement” and Fig. S5B, grey cartoon). This partial model proved to be in very good agreement with AlphaFold2 predictions (RMSD of 1.489 Å, 2764 aligned atoms). Only after this initial sanity check, the computational prediction was used for model completion, adjustment, and refinement.

      We now added graphical overviews of model fits in Figs. S5 and S10. Furthermore, we included detailed views of the fit of relevant side chains involved in intermolecular interaction to the experimental density (Fig. S7, S9). We also calculated and listed quality indicators of the model-to-map fit in Table S1 (correlation coefficients and model resolution based upon model-map FSC). To ensure the validity of our atomic model using an alternative method besides cryo-EM and XL-MS, we have performed site-directed mutagenesis of critical binding regions in E27, followed by in vitro reconstitution and analytical GF (Fig. S7B, C, S9B, C). The text was revised accordingly (see p10 [ll22] and p14 [ll26]).


      __Reviewer #1: __The authors identify a cryptic zinc-binding motif in E27 that is conserved in homologous proteins. For this reviewer it is not clear: is there experimental evidence for zinc binding of E27 or can the presence of zinc reliably be detected in their structural data? If not, it would be worth to confirm zinc binding.

      Authors Response: Our structural data show a tetragonal metal coordination geometry, involving three cysteine side chains and one histidine side chain, with coordination bond lengths of 2.2 Å between the histidine nitrogen and the metal ion, and of 2.4 Å between the cysteine sulfurs and the metal ion. The density feature cannot be explained by another type of side chain interaction, e.g. a disulfide bond, because this would lead to a steric clash with the remaining adjacent side chains. Based on the knowledge on metal-binding sites in proteins and metal-coordination chemistry, these characteristics indicate the presence of a structural zinc-binding site for the following reasons: (i) after magnesium, zinc is the second most prevalent metal in the Protein Data Bank (https://metalpdb.cerm.unifi.it/getSummary), however, magnesium is coordinated octahedrally by oxygen ligands (Tang and Yang, 2013); (ii) the most abundant zinc ligands are cysteine and histidine; (iii) the most abundant zinc coordination number is four ligands; (iv) the average coordination bond lengths are 2.12±0.19 Å and 2.33±0.12Å for nitrogen-zinc and sulfur-zinc interactions, respectively (Ireland and Martin, 2019; Laitaoja et al., 2013), which is in very good agreement with our structural observations. We included this argumentation in the revised manuscript (see p9 [ll21]), and added Fig. S5C for visualization.


      Reviewer #2: Minor points


      Reviewer #2: Page 2, line 3. "Here," should be inserted before "Global proteome profiling..." to highlight the work of this manuscript.

      Authors Response: We changed the text accordingly.

      Reviewer #2: Page 3, line 21. "IFNs" instead of "IFN"

      Authors Response: We changed the text accordingly.

      Reviewer #2: Page 4, lines 9,15,27. "Ubiquitin Ligases (UbL)" is not a common abbreviation and could be mistaken for Ubl (Ubiquitin-like proteins). Possible abbreviation is "E3s" for Ubiquitin E3 ligases

      Authors Response: We have amended the respective abbreviations accordingly.

      Reviewer #2: Page 4 line 25. "RBX1" is the more common term for "ROC1"

      Authors Response: This has been corrected throughout the manuscript.

      Reviewer #2: Page 5 lines 1-9. Citing of the first structure of DDB1 in complex with a viral protein is recommended. (Ti Li et al. Cell 2006)

      Authors Response: We thank the reviewer for this important suggestions and cited this landmark publication.

      Reviewer #2: Figure 1 a) STAT2 dot is cut off in second panel. I recommend highlighting STAT2 in both panels.

      We amended the figure accordingly. We furthermore additionally highlighted the “STAT2” text in both panels by increasing the font size and putting it in bold type.

      Reviewer #2: Page 7 line 17. "Cross-linking MS (CLMS)" is commonly abbreviated as (XL-MS)

      Authors Response: We changed the text accordingly.

      Reviewer #2: Figure 2 a-c) These panels could benefit from thinner lines in order to increase visibility of chromatograms and cross-links.

      Authors Response: The panels were changed accordingly.

      Reviewer #2: Figure 2 a-b) Could the authors elaborate on why STAT2 is stoichiometrically

      underrepresented in the SDS-PAGE of the E27/DDB1/STAT2 complex?

      Authors Response: We applaud Reviewer #2 for their in-depth examination. Honestly, we were also puzzled by this. Based on the cryo-EM single particle analysis, we found an explanation: We separated a major contamination in silico during 2D classification (~12% of all particles). Out of curiosity, we reconstructed a density map from these particles (now shown in Fig. S3). The map was identical to a previous cryo-EM structure of the E. coli protein ArnA (Yang et al., 2019), a notorious contaminant in E. coli Ni-NTA protein purifications (Andersen et al., 2013). ArnA migrates similar to E27 on the SDS-PAGE, the band runs just a little bit faster (compare fraction 6 [ArnA] and fractions 8/9 [E27] from the SDS-PAGE of the analytical GF run of E27 in isolation, Fig. 2A, green trace). However, in analytical GF, ArnA elutes at higher molecular weight fractions, since it forms a hexamers (Ve~10.2 ml). Incidentally, this elution volume of the ArnA hexamer almost equals the one of DDB1 or DDB1ΔBPB/DDA1/E27/STAT2 complexes. This leads to a superposition of ArnA and E27 bands in the respective SDS-PAGE lanes corresponding to GF fraction 6. Accordingly, we conclude that it is actually not STAT2 that is underrepresented, but rather E27 seems overrepresented due to SDS-PAGE band overlap with the ArnA contaminant. We have now indicated the contaminant in Fig. 2A, amended the legend, and extended Fig. S3 to indicate at which point of the cryo-EM analysis the contaminating ArnA particles were separated, and to show the ArnA model to map fit.

      In addition to this, it might be that potential STAT2 degradation products (marked by ** in Fig. 2), which seem to co-migrate with STAT2/E27 complexes, occupy FL STAT2 binding sites on E27.

      Reviewer #2: Paragraph "The E27 structure.." page 9. Placing this paragraph after the overall

      structure is recommended.

      Authors Response: Accordingly, we have now moved this section to the end of the results section.

      Reviewer #2: Figure 3 a) The grey mesh being laid over the ribbon structures is not contributing to the overall visibility. Adding a panel of the cryo-EM structure alone in cost of alphafold models is recommended.

      Figure 4a) same issue with grey mesh

      Authors Response: Thank you very much for the very good suggestions. We have removed the mesh representation, and included panels just showing the segmented cryo-EM map in the new Fig. 3A.

      Reviewer #2: c) panels could benefit from fewer amino acids being labeled/shown

      Authors Response: We understand the motives of the Reviewer. However, we would prefer to depict all relevant side chain interactions in these panels. The rearrangement of the figure, i.e. showing the overview of the interacting regions before the detailed panels, should make them more accessible (new Fig. 3B).

      __Reviewer #2: __d) may want to avoid red-green coloring to improve for colorblindness

      Authors Response: We are deeply sorry for our ignorance in this regard. We changed the colors accordingly (see new Fig. 3B, C).

      __Reviewer #2: __Figure 6a) s.a grey mesh

      Authors Response: We removed the mesh representations and included panels just showing the segmented cryo-EM density in the new Fig. 5C.


      Reviewer #2: CROSS-CONSULTATION COMMENTS

      __Reviewer #2: __A 3.8 A overall resolution map and the approach to fitting may be suitable, but it is unclear from the authors' figures whether the side-chains shown in the figures are clearly visible in the map or if they are modeled by some other approach. Side chains should ideally be visible in the maps if shown in figures, and if not, close-ups of the corresponding regions of the maps should be shown with sufficient depthcue to allow the reader to gauge how the map corresponds to the model.

      Authors Response: This is a crucial point. As mentioned in the response to Reviewer #1, major point 2, we have now included very detailed views of the fit of relevant side chains involved in intermolecular interaction to the experimental density (Fig. S7, S9).

      __Reviewer #2: __Along these lines, the figures with the mesh maps do not clearly show how well the model fits the map. This needs to be clearly visible in figures, and ideally maps and models provided to reviewers in order for the reviewers to gauge the level of accuracy of the fit.

      Authors Response: Please see our response to Reviewer #1, major point 2. Briefly, we have now included graphical overviews of model fits in Figs. S5 and S10. We also calculated and listed quality indicators of the model-to-map fit in Table S1 (correlation coefficients and model resolution based upon model-map FSC). To ensure the validity of our atomic model using an alternative method besides cryo-EM and XL-MS, we have performed site-directed mutagenesis of critical binding regions in E27, followed by in vitro reconstitution and analytical GF (Fig. S7B, C, S9B, C). The text was extended accordingly (see p10 [ll22] and p14 [ll26]).

      __Reviewer #2: __At minimum, the authors have nicely assembled proteomics and cell biological data indicating that E27 hijacks CRL4 to turn over Stat2 in rat cells in a manner paralagous to M27 hijacking in mouse cells, biophysical/structural data for a model of a CUL4-DDB1-E27-Stat2 complex, and mutagenesis of a putative zinc binding site in M27.

      I feel most of the issues raised by all 3 reviewers could be addressed in the text, with more clarity about the structural models, and better explanation for why the construct with proteins from various organisms were used for structural studies (the authors had made human DDB1 before, and it expressed well, and perhaps didn't consider to make from rat? Or this mixture expressed, purified best? Gave best quality EM data?).

      Authors Response: We thank Reviewer #2 for her/his overall assessment. As mentioned in the two cross-consultation comments before, and in the response to Reviewer #1, major point 2, we strived to provide adequate measures allowing to judge the quality of our structural models in the present updated version of the manuscript. In addition, as indicated in the response to reviewer #3, major point 2, we have now added Fig. S12 and extended the Discussion to explain and justify the use of different protein constructs.

      __Reviewer #2: __Also, the presentation of the zinc binding site should come after the overall structure. As for the use of MCMV to assess the role of the zinc binding site, placing this last in the text might allow this to flow better.

      Authors Response: Thank you very much for this suggestion. The manuscript has been restructured as recommended: details of the zinc-binding motif and the MCMV assays are now shown in Fig. 7 and described in the text just before the Discussion.



      Reviewer #3: Major points

      __Reviewer #3: __2. Given that previous data in mice showed that the E27 homologue pM27 binds a component of host Cullin4-RING UbLs (CRL4), to induce the poly-ubiquitination of STAT2, the current study also addressed if this mechanism was preserved in RCMV. Yet, they seemed to do this with E27, rnSTAT2 and hsDDB1 - Page 7 lines 1 to 3: "These results prompted us to explore the association of E27 with Rattus norvegicus (rn) STAT2 and Homo sapiens (hs) DDB1 in vitro. Importantly, 1128 of 1140 amino acids are identical between hsDDB1 and rnDDB1 (...)". They identify the residues and regions where the DDB1 is different between both species, but should provide a structure/alignment with this highlighted. In addition, DDB1 is a DNA damage protein that is annotated in the Rattus norvegicus genome. The authors should justify the assays between rnSTAT2-hsDDB1 instead of using the both proteins from rn, and present the equivalent data for rnDDB1 in the paper.

      Authors Response: Among the 12 alterations between human and rat DDB1, 4 are type-conserved (Fig. S12A). Thus, >99% of amino acids are identical or similar. We mapped all exchanges on a model of full length human DDB1 bound to E27 and the rat STAT2 CCD. None are involved in intermolecular interactions (Fig. S12B, C). Please note that due to the high conservation of DDB1 across eukaryotes, this inter-species approach has been used by us and others to study DDB1-containing complexes (e.g., the SV5V, WHX, SIV Vpx and Vpr, zebrafish DDB2, and chicken CRBN proteins have been in vitro reconstituted with human DDB1 for structural characterisation) and valid biological conclusions have been drawn from these studies (Angers et al., 2006; Banchenko et al., 2021; Fischer et al., 2014; Fischer et al., 2011; Li et al., 2006; Li et al., 2010; Schwefel et al., 2015; Schwefel et al., 2014; Wu et al., 2015).


      Reviewer #3: Minor points

      __Reviewer #3: __1. In fig 5D, the authors present the H-box alignment, where it is clear that this motif is not conserved. The lack of H-box conservation should be discussed in the results and discussion, to provide an explanation for the competition/binding observed.

      Authors Response: We respectfully disagree. There is conservation of amino acid side chains, regarding their physicochemical properties, observable in the H-box motif. Furthermore, the secondary structure is conserved. Please note, that the H-box is not our invention but rather represented a well-accepted motif known in the field, see e.g., (Li et al., 2010). We extended the discussion to cover this point (p21 [ll15]).


      __Reviewer #3: __3. The authors commence their abstract justifying the study on the grounds of the usefulness of rodent HCMV counterparts as common infection models for HCMV. They should return to this theme in the discussion - what is the usefulness of their findings with regards to HCMV (particularly given the relatively low homology between E27 and HCMV pUL27, and the alternative mechanism for STAT2 antagonism encoded by HCMV UL145)?

      Authors Response: We extended the discussion in this regard. Briefly, our data, to our knowledge for the first time, reveal that RCMV (like MCMV) exploits CRL4 to induce proteasomal degradation of STAT2. With pUL145, HCMV relies on an analogous protein. In clear contrast to HCMV, RMCV and MCMV are both amenable to in vivo experiments in small animal models. Over 40 years ago, HCMV has been called the troll of transplantation due to its grim impact on immunosuppressed individuals after transplantation surgery (Balfour, 1979). Despite tremendous efforts, HCMV still harms and kills graft recipients. While MCMV allows various experiments regarding general principles of cytomegaloviral pathogenesis and antiviral immunity, one shortcoming is that the mouse obviously is a rather small animal, preventing various chirurgical and solid organ transplantation (SOT) procedures. In clear contrast, SOT procedures that are indispensable for human medicine can be recapitulated in rat models. Thus, according to our opinion, our work lays the molecular foundation for future studies addressing the relevance of STAT2 and CMV-induced STAT2 degradation in rat SOT models.

      4. Description of analyses that authors prefer not to carry out

      -

      • *

      References

      Andersen, K.R., Leksa, N.C., and Schwartz, T.U. (2013). Optimized E. coli expression strain LOBSTR eliminates common contaminants from His-tag purification. Proteins 81, 1857-1861.

      Angers, S., Li, T., Yi, X., MacCoss, M.J., Moon, R.T., and Zheng, N. (2006). Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery. Nature 443, 590-593.

      Balfour, H.H., Jr. (1979). Cytomegalovirus: the troll of transplantation. Arch Intern Med 139, 279-280.

      Banchenko, S., Krupp, F., Gotthold, C., Burger, J., Graziadei, A., O'Reilly, F.J., Sinn, L., Ruda, O., Rappsilber, J., Spahn, C.M.T., et al. (2021). Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses. PLoS pathogens 17, e1009775.

      Bussiere, D.E., Xie, L., Srinivas, H., Shu, W., Burke, A., Be, C., Zhao, J., Godbole, A., King, D., Karki, R.G., et al. (2020). Structural basis of indisulam-mediated RBM39 recruitment to DCAF15 E3 ligase complex. Nat Chem Biol 16, 15-23.

      Fischer, E.S., Bohm, K., Lydeard, J.R., Yang, H., Stadler, M.B., Cavadini, S., Nagel, J., Serluca, F., Acker, V., Lingaraju, G.M., et al. (2014). Structure of the DDB1-CRBN E3 ubiquitin ligase in complex with thalidomide. Nature 512, 49-53.

      Fischer, E.S., Scrima, A., Bohm, K., Matsumoto, S., Lingaraju, G.M., Faty, M., Yasuda, T., Cavadini, S., Wakasugi, M., Hanaoka, F., et al. (2011). The molecular basis of CRL4DDB2/CSA ubiquitin ligase architecture, targeting, and activation. Cell 147, 1024-1039.

      Ireland, S.M., and Martin, A.C.R. (2019). ZincBind-the database of zinc binding sites. Database (Oxford) 2019.

      Laitaoja, M., Valjakka, J., and Janis, J. (2013). Zinc coordination spheres in protein structures. Inorg Chem 52, 10983-10991.

      Le-Trilling, V.T.K., and Trilling, M. (2020). Ub to no good: How cytomegaloviruses exploit the ubiquitin proteasome system. Virus Res 281, 197938.

      Li, T., Chen, X., Garbutt, K.C., Zhou, P., and Zheng, N. (2006). Structure of DDB1 in complex with a paramyxovirus V protein: viral hijack of a propeller cluster in ubiquitin ligase. Cell 124, 105-117.

      Li, T., Robert, E.I., van Breugel, P.C., Strubin, M., and Zheng, N. (2010). A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery. Nature structural & molecular biology 17, 105-111.

      Petzold, G., Fischer, E.S., and Thoma, N.H. (2016). Structural basis of lenalidomide-induced CK1alpha degradation by the CRL4(CRBN) ubiquitin ligase. Nature 532, 127-130.

      Rengachari, S., Groiss, S., Devos, J.M., Caron, E., Grandvaux, N., and Panne, D. (2018). Structural basis of STAT2 recognition by IRF9 reveals molecular insights into ISGF3 function. Proceedings of the National Academy of Sciences of the United States of America 115, E601-E609.

      Schwefel, D., Boucherit, V.C., Christodoulou, E., Walker, P.A., Stoye, J.P., Bishop, K.N., and Taylor, I.A. (2015). Molecular Determinants for Recognition of Divergent SAMHD1 Proteins by the Lentiviral Accessory Protein Vpx. Cell host & microbe 17, 489-499.

      Schwefel, D., Groom, H.C., Boucherit, V.C., Christodoulou, E., Walker, P.A., Stoye, J.P., Bishop, K.N., and Taylor, I.A. (2014). Structural basis of lentiviral subversion of a cellular protein degradation pathway. Nature 505, 234-238.

      Slabicki, M., Kozicka, Z., Petzold, G., Li, Y.D., Manojkumar, M., Bunker, R.D., Donovan, K.A., Sievers, Q.L., Koeppel, J., Suchyta, D., et al. (2020). The CDK inhibitor CR8 acts as a molecular glue degrader that depletes cyclin K. Nature 585, 293-297.

      Tang, S., and Yang, J.J. (2013). Magnesium Binding Sites in Proteins. In Encyclopedia of Metalloproteins, R.H. Kretsinger, V.N. Uversky, and E.A. Permyakov, eds. (New York, NY: Springer New York), pp. 1243-1250.

      Wu, Y., Koharudin, L.M., Mehrens, J., DeLucia, M., Byeon, C.H., Byeon, I.J., Calero, G., Ahn, J., and Gronenborn, A.M. (2015). Structural Basis of Clade-specific Engagement of SAMHD1 (Sterile alpha Motif and Histidine/Aspartate-containing Protein 1) Restriction Factors by Lentiviral Viral Protein X (Vpx) Virulence Factors. The Journal of biological chemistry 290, 17935-17945.

      Yang, M., Chen, Y.S., Ichikawa, M., Calles-Garcia, D., Basu, K., Fakih, R., Bui, K.H., and Gehring, K. (2019). Cryo-electron microscopy structures of ArnA, a key enzyme for polymyxin resistance, revealed unexpected oligomerizations and domain movements. J Struct Biol 208, 43-50.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Manuscript number: RC-2022-01528

      Corresponding author(s): Elena Taverna and Tanja Vogel

      1. General Statements [optional]

      We thank the reviewers for the comments and points they raised. We think what we have been asked is a doable task for us and we are confident we will manage to address all points in a satisfactory manner.

      2. Description of the planned revisions

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      Reviewer’s comment: The manuscript investigated the role of DOT1L during neurogenesis especially focusing on the earlier commitment from APs. Using tissue culture method with single-cell tracing, they found that the inhibition of DOT1L results in delamination of APs, and promotes neuronal differentiation. Furthermore, using single cell RNA-seq, they seek possible mechanisms and changes in cellular state, and found a new cellular state as a transient state. Among differentially expressed genes, they focused on microcephaly-related genes, and found possible links between epigenetic changes led by DOT1L inhibition and epigenetic inhibition by PRC2. Based on these findings, they suggested that DOT1L could regulate neural fate commitment through epigenetic regulation. Overall, it is well written and possible links from epigenetic to metabolic regulation are interesting. However, there are several issues across the manuscript.

      Response to Reviewer and planned revision:

      We thank the reviewer’s 1 for her/his comments and constructive criticism.

      We hope the revision plan will address the points raised by the reviewer in a satisfactory manner.

      Major issues:

      * *Reviewer’s comment: 1) It is not clear whether the degree of H3K79 methylation (or other histones) changes during development, and whether DOT1L is responsible for those changes. It is necessary to show the changes in histone modifications as well as the levels of DOT1L from APs to BPs and neurons, and to what extent the treatment of EPZ change the degree of histone methylation.

      Response to Reviewer and planned revision:

      • As for the level of DOT1L protein We tried several commercially available antibodies, but they do not work in the mouse, even after multiple attempts and optimization. So, unfortunately we will not be able to provide this piece of information.

      • As for the level of DOT1L mRNA We will provide info regarding the DOT1L mRNA level in APs, BPs and neurons by using scRNAseq data from E12, E14, E16 WT cerebral cortex.

      • As for the levels of H3K79methylation, we did not intend to claim that the histone methylation is responsible for the reported fate transition. We will edit the text to avoid any possible confusion. If it is deemed to be necessary to address the point raised by the reviewer, we do have 3 options, that we here in order of priority and ease of execution from our side.

      • immunofluorescence with an Ab against H3K79me2 using CON and EPZ-treated hemispheres.

      • FACS sort APs, BPs and neurons from CON and EPZ-treated hemispheres, followed by immunoblot for H3K79me2 to assess the H3K79me2 levels. As for the FACS sorting, we will use a combinatorial sorting in the lab on either a TUBB3-GFP or a GFP-reporter line using EOMES-driven mouse lines. This strategy has already been employed in the lab by Florio et al., 2015 and we will use it with minor modifications.
      • scCut&Tag for H3K79me2 from CON and EPZ-treated hemispheres. This option entails a collaboration with the Gonzalo Castelo-Branco lab in Sweden and might therefore require additional time to be established and carried out. Reviewer’s comment:

      Furthermore, the study mainly used pharmacological bath application. DOT1L has anti-mitotic effect, thus it is not clear whether the effect is coming from the inhibition of transmethylation activity.

      Response to Reviewer and planned revision:

      In a previous work we used a genetic model (DOT1L KO mouse) that showed microcephaly (Franz et al. 2019). For this study, we wanted to fill a gap in knowledge by understating if the DOT1L effect was mediated by its enzymatic activity. For this reason, we choose to use the pharmacological inhibition with EPZ, whose effect on DOT1L activity has been extensively reported and documented in literature (EPZ is a drug currently in phase clinical 3 studies).

      The stringent focus of this study on the pharmacological inhibition is thus a step toward understanding what specific roles DOT1L can play, both as scaffold or as enzyme.

      Here, we concentrate on the enzymatic function and the scaffolding function is beyond the scope of this specific study. We can further discuss and elaborate on the rationale behind this in the revised manuscript.

      Reviewer’s comment:

      In addition, the study assumed that the effect of EPZ is cell autonomous. However, if EPZ treatment can change the metabolic state in a cell, it would be possible that observed effects was non-cell autonomous. It would be important to address if this effect is coming in a cell-autonomous manner by other means using focal shRNA-KD by IUE.

      Response to Reviewer and planned revision:

      We did not claim that the effect of EPZ is cell autonomous, we are actually open on this point, as we consider both explanations to be potentially valid. We will edit the text to avoid any possible confusion on what we assume and what not.

      As a general consideration, it is entirely possible that the effects are non-cell autonomous. We will comment and elaborate on that in the revised manuscript.

      If the reviewer/journal considers this a point that must be addressed experimentally, then we will proceed as follows:

      • DOT1L shRNA-KD via in utero electroporation, followed by either
      • in situ hybridization for ASNS to check if ASNS transcript is increased upon DOT1L shRNA-KD compared to CON
      • FACS sorting of the positive electroporated cells (CON and DOT1L shRNA-KD), followed by qPCR to assess the levels of ASNS
      • If the reviewer wants us to check for a more downstream effect on fate, then we will immuno-stain the DOT1L shRNA-KD and CON with TUBB3 AB and/or TBR1 AB (as already done in the present version of the manuscript). Reviewer’s comment: 2) The possible changes in cell division and differentiation were found by very nice single-cell tracing system. However, changes in division modes occurring in targeted APs such as angles of mitotic division and the expression of mitotic markers were not addressed. These information is critical information to understand mechanisms underlying observed phenotype, delamination, differentiation and fate commitment.

      Response to Reviewer and planned revision:

      Previous effects of DOT1L manipulation on the mitotic spindle were observed in a previous paper, using DOT1L KO mouse (Franz et al. 2019). Considering that in our experiments we do use a pharmacological inhibition, we will address this point by quantifying the spindle angle in CON and EPZ-treated cortical hemispheres.

      We will co-stain for DAPI to visualize the DNA/chromosomes, and for phalloidin (filamentous actin counterstain) that allows for a precise visualization of the apical surface and of the cell contour, as it stains the cell cortex.

      Of note, the protocols we are referring to are already established in the lab, based on published work from the Huttner lab (Taverna et al, 2012; Kosodo et al, 2005).

      Reviewer’s comment: 3) The scRNA-seq analysis indicated interesting results, but was not fully clear to explain the observed results in histology. In fact, in single cell RNA-seq, the author claimed that cells in TTS are increased after EPZ treatment, which are more similar to APs. However, in histological data, they found that EPZ treatment increased neuronal differentiation. These data conflicts, thus I wonder whether "neurons" from histology data are actually neurons? Using several other markers simultaneously, it would be important to check the cellular state in histology upon the inhibition/KD of DOT1L.

      Response to Reviewer and planned revision:

      The reviewer’s comment is valid, and we indeed found that TTS cells are an intermediate state between APs and neurons in term of transcriptional profile. This is the reason why we called this cell cluster transient transcriptional state.

      We plan to address this point by staining for TBR1 and/or CTIP2 in CON and EPZ-treated hemispheres and to expand with this EOMES and SOX2 co-staining.

      Minor issues:

      Reviewer’s comment: Figure 1 - It is not clear delaminated cells are APs, BPs or some transient cells (Sox2+ Tubb3+??). It is important to use several cell type-specific and cell cycle markers simulnaneously to characterize cell-type specific identity of the analysed cells by staining. These applied to Fig1B,D,E,F,G,as well as Fig2,3.

      Response to Reviewer and planned revision:

      We will address this point by using a combinatorial staining scheme for several fate markers such as TUBB3, EOMES and SOX2, as suggested by the reviewer.

      Reviewer’s comment: - Please provide higher magnification images of labelled cells (Fig 1H)

      Response to Reviewer and planned revision:

      In the revised manuscript, we will provide higher magnification for the staining.

      Reviewer’s comment: - Please provide clarification on the criteria of Tis21-GFP+ signal thresholding.

      Response to Reviewer and planned revision:

      In the revised manuscript, we will provide a clarification on the criteria of Tis21-GFP+ signal thresholding.

      Reviewer’s comment: - Splitting the GFP signal between ventricular and abventricular does not convincingly support the "more basal and/or differentiated" states after EPZ treatment.

      Response to Reviewer and planned revision:

      We will provide a clarification regarding this point.

      Reviewer’s comment: - Please explain the presence of Tis21-GFP+ cells at the apical VZ.

      Response to Reviewer and planned revision:

      Tis21-GFP+ cells at the apical VZ has been extensively reported in the literature, since the first paper by Haubensak et al. regarding the generation of the Tis21-GFP+ line. In a nutshell, T Tis21-GFP+ cells are present throughout the VZ (therefore also in the apical portion) as neurogenic, Tis21-GFP positive cells are undergoing mitosis at the apical surface. Indeed, the presence of Tis-21 GFP signal have been extensively used by the Huttner lab and collaborators to score apical neurogenic mitosis. In addition, since AP undergo interkinetic nuclear migration, it follows that Tis21-GFP+ nuclei are going to be present throughout the entire VZ.

      In the revised manuscript, we will explain this point and cite additional literature.

      Reviewer’s comment: - Order the legends in same order as the bars.

      Response to Reviewer and planned revision:

      We will follow reviewers’ recommendation and order the legends accordingly.

      Reviewer’s comment: Figure 2 -Fig 2B) The difference between CON and EPZ apical contacts is not clear and does not match with the graph in Fig 2E.

      Response to Reviewer and planned revision:

      We will explain Fig. 2B in more detail and provide additional images in the revised manuscript.

      Reviewer’s comment: -Supp Fig 2 - are these injected slices cultured in control conditions? Please include this in the text and figure/figure legend

      Response to Reviewer and planned revision:

      In the revised manuscript, the text will be changed to address this point and provide clearer info.

      Reviewer’s comment: Fig 2C) The EPZ-treated DxA555+ cells exhibit morphological change of cell shape. Is this phenotype? please comment on the image shown for EPZ treatment panel.

      Response to Reviewer and planned revision:

      We thank the reviewer for having raised this point.

      The change in morphology might be a consequence of delamination and or of cell fate. In the revised manuscript, we will certainly better comment on this very relevant point and expand the discussion accordingly.

      Reviewer’s comment: Fig 2F - 2G) Data presented on EOMES+ and TUBB3+ % are counterintuitive. The authors claimed that TUBB3+ cells are increased and neuronal differentiation is promoted. However, no changes in EOMES+ are observed. What is the explanation? Did the author check the double positive cells? These could be TSS cells?

      Response to Reviewer and planned revision:

      We thank the reviewer to have raised this point.

      As envisioned by the reviewer, we suspect that the counterintuitive data might be due to TSS cell, which based on our scRNAseq data are expressing at the same time several cell type specific markers. It is possible that, since the treatment with EPZ is 24h long, cells (like the TTS cluster) have no time to completely eliminate the EOMES protein. If that were to be the case, then we would expect to still detect (as we indeed do) EOMES immunoreactivity.

      To address this point, we will:

      • analyze scRNA-seq data and check which is the extent of co-expression of Eomes and Tubb3 mRNAs in the TTS population.
      • Check for EOMES and TUBB3 double positive cells in the microinjection experiment. Reviewer’s comment: Figure 2 and Figure 3) the number of pairs analyzed for EPZ is twice as that of Con for comparison of the parameters taken into account. Please include n of each graph in the figure legend of the specific panel if not the same for all panels in that figure (i.e. for figure 3)

      Response to Reviewer and planned revision:

      We will revise the text accordingly.

      Reviewer’s comment:

      Figure 3) The data indicated that the number of daughter cell pairs in EPZ samples is almost double than Control. Is this the phenotype? More numbers of daughter cells in EPZ treated samples were observed from the same number of injections? or the number of injected cells were different?

      Response to Reviewer and planned revision:

      Due to technical reasons, we indeed performed a higher number of injections in EPZ-treated slices. We think this is the main reason behind the difference in number.

      If the reason were to be biological, one would expect to see the same trend in IUE experiments, but this is actually not the case. This does suggest/corroborate the idea that the reason behind the difference is mainly technical.

      Reviewer’s comment: Figure 4)

      • Please clarify if the single cell transcriptomic analysis has been performed only once, and if yes, how statistical testing to compare the cell proportion is carried out with only one batch. Fig 4G)

      Response to Reviewer and planned revision:

      As for the scRNAseq on microinjected cells:

      the scRNA-seq analysis was done once using cells pooled from 3 different microinjection experiments performed in 3 different days.

      As for the scRNAseq on IUE cells:

      The scRNA-seq analysis was done once using cells pooled from 2-3 different IUE experiments performed in 3 different days.

      For all scRNAseq experiments the statistical testing is achieved by intrasample comparisons according to established bioinformatics pipelines. We will better explain this point in the revised manuscript.

      Reviewer’s comment: Figure 4 and 5) - Figures are not supportive of the statement regarding APs' neurogenic potential upon DOT1L inhibition. TSS transcriptomic profile resembles more progenitors than neurons. Please comment on TSS neurogenic capacity taking into account the provided GO and RNAseq.

      Response to Reviewer and planned revision:

      We thank Reviewer 1 for raising this point, It is indeed true that TTS resemble more AP than neurons (as indicated in the Fig. S5B, C). We took that to indicate the fact that these cells are transient and therefore still maintain some AP features. Interestingly, TTS downregulate cell division markers, suggesting a restriction of proliferative potential, as one would expect for cells with an increased neurogenic potential. We will discuss this point in the revised manuscript.

      Reviewer’s comment: - Please provide GO analysis for APs and BPs.

      Response to Reviewer and planned revision:

      Following the reviewer’s suggestion, we will incorporate a more careful and in-depth analysis in the revised version of the manuscript.

      Reviewer’s comment: - Reconstruct figure 5A by listing genes in the same order in both Con and EPZ and prioritize EPZ-Con differences instead of cell-cell differences.

      Response to Reviewer and planned revision:

      We will revise Figure 5A based on the reviewer’s comment.

      Reviewer’s comment:

      Moreover, the presented genes in the heatmap is not the same in two conditions (i.e. NEUROG1 is present in EPZ but absent in Con). Please justify.

      Response to Reviewer and planned revision:

      This observation is based on different activities of transcription factor networks in the control and EPZ condition. They are not supposed to be the same as the cell states are altered and different TF are expressed and active upon the treatment in the diverse cell types. In a revised manuscript we will justify this point.

      Reviewer’s comment: Fig 5D)

      • Please explain why binding of EZH2 on the promoter of Asns is strongly reduced in comparison to a mild significant reduction of H3K79me/H3K27me3 in EPZ compared to Control.

      Response to Reviewer and planned revision:

      Several explanations are possible

      First, the variation can be due to batch effects.

      Second, the acute reduction of EZH2 might not be directly accompanied by a reduced histone mark, which is reduced either by cell division or by demethylases. The two processes of getting rid of the mark might be slower than the reduction of EZH2 presence at the respective site.

      Based on the reviewer’s comment, we will explain this point in the revised manuscript.

      • *

      Reviewer’s comment:

      Also is the changed directly medicated by DOT1L?

      Please test whether DOT1L can bind the promoter of Asns.

      Response to Reviewer and planned revision:

      To address this relevant issue we will proceed with the following protocol:

      • electroporate a tagged version of DOT1L into ESCs
      • select ESCs and differentiate them into NPC_48h.
      • treat NPC with DMSO (Con) or EPZ
      • harvest CON and EPZ-treated NPC
      • perform ChIP-qPCR DOT1L at the Asns promoter Reviewer’s comment: Please provide the expression patterns of DOT1L and Asns during neuronal differentiation.

      Response to Reviewer and planned revision:

      As for Dot1l

      Dot1l expression was shown in Franz et al 2019, by ISH from E12.5 to E18.5.

      As for Asns

      We will provide E14.5 in situ staining of Asns in the developing mouse brain using the Gene Paint database (see Figure below).

      We will also show immunostainings for ASNS at mid-neurogenesis, provided that Ab against ASNS works in the mouse.

      Other General comments:

      Reviewer’s comment: Please Indicate VZ, SVZ and CP on the side of the pictures/ with dot lines in the pictures both for primary figures and supplementary.

      Response to Reviewer and planned revision:

      We will revise the figures accordingly.

      Reviewer’s comment: - The Results and figures sometimes do not support the statement made by the authors

      Response to Reviewer and planned revision:

      We will carefully check on this and eliminate any overinterpretation or non-supported statements from the text.

      • Schemes are not informative/explanatory enough, i.e. time windows of treatment and sample collection, culture conditions details.

      Response to Reviewer and planned revision:

      We will revise the schemes to include more details. In particular, we plan to add a supplementary figure with a detailed visual description of the protocol, to match the detailed description presented in the materials and methods.

      Reviewer’s comment: - A more extensive characterization of TTS cells in terms of differentiation progression and integration would be enlightening

      Response to Reviewer and planned revision:

      In general, we are facing two main challenges while studying the TTS population: one is the lack of a specific marker gene for TTS, the other is the relatively small size of the TTS subpopulation.

      For these reasons, our ability to carry on an in-depth analysis of this cell state is limited.

      Considering the reviewer’s comment, in the revised manuscript we will expand the analysis ad characterization of the differentiation potential of TTS using RNA velocity trajectory.

      We can also expand the discussion on this point.

      Reviewer’s comment: - Picture quality can be improved, provide high magnification images.

      Response to Reviewer and planned revision:

      We will revise the figures to include higher magnification images.

      Reviewer #1 (Significance (Required)):

      Reviewer’s comment: The study could be important for the specific field in neural development. It aims to understand mutations in respective genes and brain malformation. If the link between epigenetic and metabolic changes is clearly shown, it will be interesting. However, the current manuscript is still rather descriptive, and clear mechanistic insights were not provided. The study have potentials and additional data will strength the value of study.

      Response to Reviewer and planned revision:

      We will address the direct impact of DOT1L and H3K79me2 on the Asns gene locus during the revision (see the rationale of the experimental strategy also in the revision plan above). We hope we will thus provide a mechanistic link between epigenetics and altered metabolome.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      Reviewer’s comment: Appiah et al. present a concise manuscript that provides details and possible mechanisms of their previous work (Franz et al., 2019; Ferrari et al., 2020). The study uses diverse lines of investigation to arrive at most conclusions. However, as interesting as the data is, we find that at the present state, it is not sufficient to prove that, indeed, the asparagine metabolism is regulated by DOTL1/PRC2 crosstalk. The neurogenic shift presented in the first part of the paper is not comprehensive and, therefore, not very convincing. The quality of images provided in the main and supplementary data is less than ideal. Additional data analysis and interpretation of the scRNA seq data may be needed. The authors finally conclude with rescue experiments done in culture and in-vivo, which we believe is the stand-out part of this study. Overall the manuscript has some interesting observations that are often over-interpreted with less supporting data. The manuscript reads well but requires additional data and changes in the claims/interpretation to be suited for publication.

      Response to Reviewer and planned revision:

      In the revised manuscript, we hope we will address the comments and concerns raised by the reviewer in a satisfactory manner. Comments

      Reviewer’s comment: 1) Abstract: Is this statement correct: "DOT1L inhibition led to increased neurogenesis driven by a shift from asymmetric self-renewing to symmetric neurogenic divisions of APs. AP undergoes symmetric division for self-renewal and asymmetric neurogenic divisions.

      Response to Reviewer and planned revision:

      Based on the current literature (cit. Huttner and Kriegstein), AP undergo:

      • symmetric division for proliferative division at early stages of neurogenesis
      • asymmetric self-renewing division, generating an AP and a BP at mid neurogenesis. This division is also described as neurogenic, as it produces a BP, that is a step further than AP in term of neurogenic potential.
      • symmetric consumptive division at late neurogenesis To avoid any possible confusion, we will re-phrase the sentence to include the adjective “consumptive” and specify the composition of the progeny.

      In the revised manuscript, the sentence will read as follow:

      "DOT1L inhibition led to increased neurogenesis driven by a shift of APs from asymmetric self-renewing (generating one AP and one BP) to symmetric consumptive divisions (generating two neurons)"

      Reviewer’s comment: All the data is based on treatments with EPZ (DOTL1 inhibitor), yet no information is shown to support its targeted activity in this system. A proof of principle in the chosen experimental system is missing; for instance, examining the activity or protein level of DOTL1 and decreased methylation of the target(s) is essential.

      Response to Reviewer and planned revision:

      EPZ is a well characterized drug, that has been used previously in our lab and by others as well.

      As for our lab, the information regarding the inhibitor, its activity and efficiency in inhibiting DOT1L towards H3K79me2 was shown in Franz et al. Supplementary Fig. S6 D, E.

      In the present manuscript, an additional confirmation that EPZ targets DOT1L in regard to its H3K79me2 activity is shown in Fig. 5D.

      We would refer to this information more explicitly in a revised manuscript.

      Reviewer’s comment: 2) Figure 1: The scoring of centrosomes and cilia is insufficient to conclude delamination and increase in basal fates. The effect could be on ciliogenesis or centrosome tethering to the apical end-feet of the AP, and other possible explanations for this observation also exist. The images are too small; larger images or graphic representations could be helpful in addition to the data.

      Response to Reviewer and planned revision:

      We did not intend to claim that the change in centrosome location demonstrate delamination, but only that it suggests delamination. This criterion has been extensively used as a proxy for delamination by several labs working on the cell biology of neurogenesis, such Huttner and Gotz labs. If the issue persists, we can re-phrase in a more cautious way the text referring to Figure 1 to highlight that the data only suggest delamination.

      Response to Reviewer and planned revision:

      To make a statement regarding delamination, I would like to see either the dynamics of delamination (organotypic slices images), staining with BP markers, or morphological changes of AP (staining that will reveal loss of adherence) or comparable data to support the observation. In my opinion Supp. Figure 1 is insufficient; the single image is not convincing; I would like to see 3D reconstruction and better-quality images.

      Response to Reviewer and planned revision:

      We can certainly provide better images and co-stain with relevant markers.

      We think it is beyond the scope of the manuscript embarking in live imaging as we are not studying the dynamics of delamination per se.

      Reviewer’s comment: Tis21 data (1H), again of low quality, is only a single piece of evidence and the conclusion "suggesting that the acquisition of a basal fate was paralleled by a switch to neurogenesis" is premature. I think other cell cycle exit reporters, Fucci markers, pHis, BrdU, NeuroD, or Tbr2 reporters (Li et al., 2020, (Haydar and Sestan labs)) to name a few, are necessary to establish the conclusions. The authors should show other markers such as PAX6, EOMES, or other upper-layer markers upon cell cycle exit in the SVZ/CP. These additional experiments will assist in cell fate analysis.

      Response to Reviewer and planned revision:

      We completely understand the points raised by the reviewer, and we plan to address them by co-staining with PAX6/SOX2, PH3 and/or EOMES.

      We think establishing the Fucci or EOMES mouse system is beyond the scope of the manuscript. In addition, given the present setting of all labs involved, it would be logistically unattainable (see also comments in the section below).

      We think the co-staining scheme and plan will be informative enough to satisfactory address the concerns raised by the reviewer.

      Reviewer’s comment: 2) Figure 2: The microinjection experiments are elegant; the images, however, do not complement the experiment. The images of the microinjected cells seem not to be reconstructed from z-stacked optical slices, so often, processes are not continuous (panel B, for example); therefore, it is not clear if an apical process is indeed missing or just not seen.

      Response to Reviewer and planned revision:

      The mentioned images are reconstructed from continuous Z-stacks, as we always do given the type of data. We can provide better reconstructions and/or additional images.

      Reviewer’s comment:

      The data analysis should include other parameters; BrdU staining could have given information on cell cycle exit, PAX6, SOX2, and EOMES on the location of the cells in the VZ/sVZ. The quality of images showing EOMES and TUBB3 staining is so low that it makes the reader doubt the validity of the quantifications. "Taken together, these data suggest that the inhibition of DOT1L might favor the acquisition of a neuronal over BP cell fate" This interpretation should be subjected to more investigations. It is possible that this treatment just accelerates the AP-> BP -> Neuronal fate. The author's claim needs to be backed by additional experiments or be changed.

      Response to Reviewer and planned revision:

      To address this point, we will include in the revised manuscript staining and co-staining with PAX6, SOX2 (see also response above) and provide a BrdU labeling experiment.

      Reviewer’s comment: 3) Figure 3: The experiment concept and its performance are impressive, yet the data is insufficient. The images in A that are supposed to be representative show two cells; their location is not clear, and the expression of GFP is not clear; in fact, both pairs seem to be GFP negative (not clear what is the threshold for background). Staining with anti-GFP and a second method to follow neurogenesis is necessary.

      Response to Reviewer and planned revision:

      We did use different staining methods and schemes to follow neurogenesis. As specified above, we will deepen our analysis by using additional markers, such as TBR1.

      Reviewer’s comment: 4) On page 9, lines 8-10, the authors claim that their number of cells was "sufficient" for single-cell analysis; the numbers are Response to Reviewer and planned revision:

      In the revised manuscript, we will include the analysis of how many cells are needed to identify cluster of 6 cell types in this paradigm, based for example on the algorithms developed in Treppner et al. 2021.

      Reviewer’s comment: 5) The authors use Seurat and RaceID without their appropriate citations in the first mention during the results. The authors also stop immediately after DEG analysis along with clustering. The authors could analyze their RNA-seq data with a trajectory; to say the least, the identification/characterization of TTS and neurons as Neurons I, II, and III are insufficient. There could be multiple ways to show the "fate" of cells in the isolated FACS, which the authors have missed.

      Response to Reviewer and planned revision:

      We will include the respective citations in a revised manuscript. We provide already differentiation trajectories but will include other methods, including scVelo of FateID to extend the trajectory analyses. We kindly ask the reviewer to also refer to the comments above regarding the TTs cluster characterization as part of our effort to provide a better picture of the different clusters.

      Reviewer’s comment: 6) The authors detected candidates like Fgfr3, Nr2f1, Ofd1, and Mme as part of their treated (different approaches) datasets (from their DEG analysis). They correctly cite Huang et al., 2020 but fail to give us a sense of the consequences of these gene dysregulations. The authors can also validate if these proteins are expressed in their treated cells.

      Response to Reviewer and planned revision:

      In the revised manuscript we will comment on the function of the four genes mentioned.

      In addition, we will validate the expression of these genes on protein and transcriptional level through immunostainings -provided that antibodies are working in our system- or smFISH, respectively.

      Reviewer’s comment: 7) The authors list a few GO terms (page 10, lines 1-10) and associate them with reduced proliferation; they must cite relevant studies. The authors can also add supplementary data showing which genes in their data correspond to these GO terms.

      Response to Reviewer and planned revision:

      We thank the reviewer for pointing out the missing citations.

      We of course agree on the need to add them, and we will do so in the revised manuscript.

      Reviewer’s comment: 8) On Page 11, lines 3-7, the authors describe their method to arrive at the 17 targets with TF activity from the previous analysis. Can the authors describe the method used to correlate the two? The reviewer understands this could be MEME analysis or analysis of earlier datasets of Ferrari et al. 2020. But it must be explicitly stated, and a few examples in supplementary need to be exemplified as this analysis is key to discovering the three metabolic genes.

      Response to Reviewer and planned revision:

      In the revised manuscript, we will clarify the exact analysis that resulted in the identification of the 17 target genes, using the specific tool for gene network analysis, that is based on our scRNA-seq data alone, but not on the Ferrari et al 2020 data set.

      3. Description of the revisions that have already been incorporated in the transferred manuscript

      n/a

      4. Description of analyses that authors prefer not to carry out

      Reviewer’s comment: Tis21 data (1H), again of low quality, is only a single piece of evidence and the conclusion "suggesting that the acquisition of a basal fate was paralleled by a switch to neurogenesis" is premature. I think other cell cycle exit reporters, Fucci markers, pHis, BrdU, NeuroD, or Tbr2 reporters (Li et al., 2020, (Haydar and Sestan labs)) to name a few, are necessary to establish the conclusions. The authors should show other markers such as PAX6, EOMES, or other upper-layer markers upon cell cycle exit in the SVZ/CP. These additional experiments will assist in cell fate analysis.

      Response to Reviewer and planned revision:

      As pointed out above, we think establishing the Fucci or EOMES mice system is beyond the scope of the manuscript as it will not provide more information than the ones we will obtain from systematic and extensive co-staining experiments. In addition, all labs involved are facing a logistic issue (animal house not ready yet, construction works etc) that made the importing and setting up of the colony unattainable for the next 6-10months. If the reviewer and/or the editorial board think this is a major point compromising the entire revision, we kindly ask to contact us again so that we can discuss the issue and arrive to a shared conclusion.

    1. I like to think of thoughts as streaming information, so I don’t need to tag and categorize them as we do with batched data. Instead, using time as an index and sticky notes to mark slices of info solves most of my use cases. Graph notebooks like Obsidian think of information as batched data. So you have a set of notes (samples) that you try to aggregate, categorize, and connect. Sure there’s a use case for that: I can’t imagine a company wiki presented as streaming info! But I don’t think it aids me in how I usually think. When thinking with pen and paper, I prefer managing streamed information first, then converting it into batched information later— a blog post, documentation, etc.

      There's an interesting dichotomy between streaming information and batched data here, but it isn't well delineated and doesn't add much to the discussion as a result. Perhaps distilling it down may help? There's a kernel of something useful here, but it isn't immediately apparent.

      Relation to stock and flow or the idea of the garden and the stream?

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      In recent years, the field has investigated crosstalk between cGMP and cAMP signaling (PMID: 29030485), lipid and cGMP signaling (PMID: 30742070), and calcium and cGMP signaling (PMID: 26933036, 26933037). In contrast to the Plasmodium field, which has benefited from proteomic experiments (ex: PMID 24594931, 26149123, 31075098, 30794532), second messenger crosstalk in T. gondii has been probed predominantly through genetic and pharmacological perturbations. The present manuscript compares the features of A23187- and BIPPO-stimulated phosphoproteomes at a snapshot in time. This is similar to a dataset generated by two of the authors in 2014 (PMID: 24945436), except that it now includes one BIPPO timepoint. The sub-min​​ute phosphoproteomic timecourse following A23187 treatment in WT and ∆cdpk3 parasites is novel and would seem like a useful resource.

      CDPK3-dependent sites were detected on adenylate cyclase, PI-PLC, guanylate cyclase, PDE1, and DGK1. This motivated study of lipid and cNMP levels following A23187 treatment. The four PDEs determined to have A23187-dependent phosphosites were characterized, including the two PDEs with CDPK3-dependent phosphorylation, which were found to be cGMP-specific. However, cGMP levels do not seem to differ in a CDPK3- or A23187-dependent manner. Instead, cAMP levels are elevated in ∆cdpk3 parasites. This would seem to implicate a feedback loop between CDPK3, the adenylyl cyclase, and PKA/PKG: CDPK3 activity reduces adenylyl cyclase activity, which reduces PKA activity, which increases PKG activity. The authors don't pursue this direction, and instead characterize PDE2, which does not have CDPK3-dependent phosphosites, and seems out of place in the study

      Response:

      We agree with reviewer 1 that a feedback loop between CDPK3, the adenylyl cyclase and PKA/PKG is certainly one of several possibilities (and we acknowledge this in the manuscript).

      We felt, however, that given the observation that A23187 and BIPPO treatment leads to phosphorylation of numerous PDEs (hinting at the presence of an Ca2+-regulated feedback loop), it was entirely relevant to study these in greater detail. Coupled with the A23187 egress assay on ΔPDE2 parasites - our findings suggest that PDE2 plays an important role in this signalling loop (an entirely novel finding). While PDE2 appears to exert its effects in a CDPK3-independent manner (indeed suggesting that CDPK3 might exert its effects on cAMP levels in a different fashion), this does not detract from the important finding that PDE2 is one of the (likely numerous) components that is regulated in a Ca2+-dependent feedback loop to regulate egress.

      We have modified our writing to better reflect the fact that our decision to pursue study of the PDEs was not solely CDPK3-centric.

      While we feel that our reasoning for studying the PDEs is solid, we appreciate that further clarification on the putative CDPK3-Adenylate cyclase link would make it easier for the reader to follow the rationale.

      We have not studied the direct link between CDPK3 and the Adenylate Cyclase β in more detail, as ACβ alone was shown to not play a major role in regulating lytic growth (Jia et al., 2017).

      **MAJOR COMMENTS**

      1.Some of the key conclusions are not convincing.

      The data presented in Figure 6E, F, and G and discussed in lines 647-679 are incongruent. In Figure 6E, the plaques in the PDE2+RAP image are hardly visible; how can it be that the plaques were accurately counted and determined not to differ from vehicle-treated parasites?

      Are the images in 6E truly representative? Was the order of PDE1 and PDE2 switched? The cited publication by Moss et al. 2021 (preprint) is not in agreement with this study, as stated. That preprint determined that parasites depleted of PDE2 had significantly reduced plaque number and plaque size (>95% reduction); and parasites depleted of PDE1 had a substantially reduced plaque size but a less substantial reduction in plaque number.

      Response:

      The plaques for PDE2+RAP were counted using a microscope since they are difficult to see by eye. We thank the reviewer for detecting our incorrect reference to Moss et al. (2021). This has been corrected in the text. We confirm, however, that the images in 6E are representative of what we observed and do indeed differ from what was seen by Moss et al.. We have acknowledged this clearly in the text.

      The differences cannot easily be explained other than by the different genetic systems used. Further studies of the individual PDEs will likely illuminate their role in invasion/ growth, but we feel this would be beyond the scope of this study.

      Unfortunately, the length of time required for PDE depletion (72h) is incompatible with most T. gondii cellular assays (typically performed within one lytic cycle, 40-48h). Although the authors performed the assays 3 days after initial RAP treatment, is there evidence that non-excised parasites don't grow out of the population. This should be straightforward to test: treat, wait 3 days, infect onto monolayers, wait 24-48h fix, and stain with anti-YFP and an anti-Toxoplasma counterstain. The proportion of the parasite population that had excised the PDE at the time of the cellular assays will then be known, and the reader will have a sense of how complete the observed phenotypes are. As a reader, I will regard the phenotypes with some level of skepticism due to the long depletion time, especially since a panel of PDE rapid knockdown strains (depletion in __Response:

      1. Cellular assays using KO parasites are commonly performed at the point at which protein depletion is detected. Both our western blots and plaque assay results demonstrate that, at the point of assay, there is no substantial outgrowth of non-excised parasites. The original manuscript also includes PCRs performed at the 72 hr time point (See Fig. 6B) to support this.
      2. We appreciate the reviewer’s comment re the panel of PDE KD strains. The reviewer notes that there are substantial limitations to conditional KO systems, which similarly applies to KD systems - there are notable pros and cons to each approach. When designing our strategy (pre-publication of the Moss et al., 2022), we made a deliberate decision to use conditional KO strains in light of the fact that residual protein levels in KD systems can cause significant problems, particularly for membrane proteins (all of the investigated PDEs have a transmembrane domain). Tagging of proteins with the degradation domain can have further issues, leading to protein mis-localisation, which we have experienced with several unrelated proteins in the lab.

        The authors should qualify some of their claims as preliminary or speculative, or remove them altogether.

      The claims in lines 240-260 are confusing. It seems likely that the two drug treatments have at least topological distinctions in the signaling modules, given that cGMP-triggered calcium release is thought to occur at internal stores, whereas A23187-mediated calcium influx likely occurs first at the parasite plasma membrane.The authors' proposed alternative, that treatment-specific phosphosite behavior arises from experimental limitations and "mis-alignment", is unsatisfying for the following reasons: (1) From the outset, the authors chose different time frames to compare the two treatments (15s for BIPPO vs. 50s for A23187); (2) the experiment comprises a single time point, so it does not seem appropriate to compare the kinetics of phosphoregulation. There is still value in pointing out which phosphosites appear treatment-specific under the chosen thresholds, but further claims on the basis of this single-timepoint experiment are too speculative. Lines 264-267 and 281-284 should also be tempered.

      Relatedly, graphing of the data in Figure 1G (accompanying the main text mentioned above) was confusing. Why is one axis a ratio, and the other log10 intensity? What does log10 intensity tell you without reference to the DMSO intensity? Wouldn't you want the L2FC(A23187) vs. L2FC(BIPPO) comparisons? Could you use different point colors to highlight these cases on plot 1E? Additionally, could you use a pseudocount to include peptides only identified in one treatment condition on the plot in 1E? (Especially since these sites are mentioned in lines 272-278 but are not on the plot)

      Response:

      1. The kinetics of the responses to A23187 and BIPPO are very different. This is why treatment timings are purposely different as they were selected to align pathways to a point where calcium levels peak just prior to calcium re-uptake. We make no mention of kinetic comparisons, and merely demonstrate that at the chosen timepoints, overall signalling correlation is very high. The observation that most of the sites that behave differently between conditions sit remarkably close to the threshold for differential regulation (in the treatment condition where they are not DR - see Fig. 1G) led us to speculate that many of these sites are likely on the cusp of differential regulation. While it is entirely possible that some of these differences are, in fact, treatment specific (and we clearly acknowledge this in the text), we simply state that we cannot confidently discern clear signalling features that allow us to distinguish between the two treatments. We feel that this is an entirely relevant observation given the observed preponderance of both A23187 and BIPPO-dependent DR phosphosites on proteins in the PKG signalling pathway (as current models place this upstream of Ca2+release).
      2. Log10 intensity only serves to spread the data for easier visualisation. The only comparison being made relates to the LFCs. Fig. 1Gi shows the LFC scores (x axis) for all sites regulated following A23187 treatment (for which peptides were also identified in BIPPO treatment). On this plot we have highlighted the sites that are differentially regulated following BIPPO but not A23187 treatment (with red showing the DRup and blue showing the DRdown sites). This demonstrates that many of the sites that are regulated following BIPPO but not A23187 treatment cluster close to the threshold for differential regulation in the A23187 dataset - suggesting that many of these sites are likely on the cusp of differential regulation. Fig. 1Gii shows the reverse. While we could highlight the above-mentioned sites on the plot in Fig. 1E, we do not feel that it would demonstrate our point as clearly.

      We feel that including a pseudocount on Fig. 1E for peptides lacking quantification in one treatment condition would be visually misleading as the direct correlation being made in Fig. 1E is BIPPO vs A23187 treatment. The sites mentioned in lines 272-278 in the original manuscript (now lines 268-276) are available in the supplement tables.

      3.Additional experiments would be essential to support the main claims of the paper.

      Genetic validation is necessary for the experiments performed with the PKA inhibitor H89. H89 is nonspecific even in mammalian systems (PMID: 18523239) and in this manuscript it was used at a high concentration (50 µM) The heterodimeric architecture of PKA in apicomplexans dramatically differs from the heterotetrameric enzymes characterized in metazoans (PMID: 29263246), so we don't know what the IC50 of the inhibitor is, or whether it inhibits competitively. Two inducible knockdown strains exist for PKA C1 (PMID: 29030485, 30208022). The authors could request one of these strains and construct a ∆cdpk3 in that genetic background, as was done for the PDE2 cKO strain. Estimated time: 3-4 weeks to generate strain, 2 weeks to repeat assays.

      Response:

      1. While we appreciate that H89 is not 100% specific for PKA, this is not our only line of evidence that cAMP levels are altered. We demonstrate that cAMP levels are elevated in CDPK3 KO parasites – further substantiating our finding.

      The H89 concentration used in our experiment is in keeping with/lower than the concentrations used in other Toxoplasma publications (Jia et al., 2017), and both the Toxoplasma and Plasmodium fields have shown convincingly that H89 treatment phenocopies cKD/cKO of PKA (see Jia et al., 2017; Flueck et al., 2019).

      While we agree that the genetic validation suggested by reviewer 1 would serve to further support our findings (though it would not provide further novel insights), the suggested time frame for experimental execution was not realistic. Line shipment, strain generation, subcloning and genetic validation would take substantially longer than 3-4 weeks.

      cGMP levels are found to not increase with A23187 treatment, which is at odds with a previous study (lines 524-560). The text proposes that the differences could arise from the choice of buffer: this study used an intracellular-like Endo buffer (no added calcium, high potassium), whereas Stewart et al. 2017 used an extracellular-like buffer (DMEM, which also contains mM calcium and low potassium). An alternative explanation is that 60 s of A23187 treatment does not achieve a comparable amount of calcium flux as 15 s of BIPPO treatment, and a calcium-dependent effect on cGMP levels, were it to exist, could not be observed at the final timepoint in the assay. The experiments used to determine the kinetics of calcium flux following BIPPO and A23187 treatments (Fig. 1B, C) were calibrated using Ringer's buffer, which is more similar to an extracellular buffer (mM calcium, low potassium). In this buffer, A23187 treatment would likely stimulate calcium entry from across the parasite plasma membrane, as well as across the membranes of parasite intracellular calcium stores. By contrast, A23187 treatment in Endo buffer (low calcium) would likely only stimulate calcium release from intracellular stores, not calcium entry, since the calcium concentration outside of the parasite is low. Because calcium entry no longer contributes to calcium flux arising from A23187 treatment, it is possible that the calcium fluxes of A23187-treated parasites at 60 s are "behind" BIPPO-treated parasites at 15 s. The researchers could control these experiments by *either* (i) performing the cNMP measurements on parasites resuspended in the same buffer used in Figure 1B, C (Ringer's) or (ii) measuring calcium flux of extracellular parasites in Endo buffer with BIPPO and A23187 to determine the "alignment" of calcium levels, as was done with intracellular parasites in Figure 1C. No new strains would have to be generated and the assays have already been established in the manuscript. Estimated time to perform control experiments with replicates: 2 weeks. This seems like an important control, because the interpretation of this experiment shifts the focus of the paper from feedback between calcium and cGMP signaling, which had motivated the initial phosphoproteomics comparisons, to calcium and cAMP signaling. Further, the lipidomics experiments were performed in an extracellular-like buffer, DMEM, so it's unclear why dramatically different buffers were used for the lipidomics and cNMP measurements.

      Response:

      While the initial calibration experiments to measure calcium flux were indeed performed in Ringer’s buffer, the parasites were intracellular. We therefore chose to measure cNMP concentrations of extracellular parasites syringe lysed in Endo buffer, which is better at mimicking intracellular conditions than any other described buffer.

      As the reviewer suggested, we measured the calcium flux of extracellular parasites in Endo buffer upon stimulation with either A23187 or BIPPO.

      We found that peak calcium response to BIPPO in Endo buffer was similar to that of intracellular parasites (~15 seconds post treatment) (See Supp Fig. 6A). Upon treatment with A23187, extracellular parasites in Endo buffer had a much faster response compared to their intracellular counterparts, with peak flux measured at ~25 seconds post treatment (see Supp Fig. 6B). This indeed does suggest that extracellular parasites in Endo buffer behave differently to A23187 compared to their intracellular counterparts. However, peak calcium response is still occuring within the experimental time course and is not being missed, as the reviewer worries. Moreover, since we are able to detect increased cAMP levels in A23187 treated parasites, Ca2+ flux appears sufficient to alter cNMP signalling.

      We did notice however that the intensity of the calcium flux was much weaker in Endo buffer compared to intracellular parasites (see Supp Fig. 6B). We found that this was due to the lack of host-derived Ca2+, since supplementation of Endo buffer with 1 uM CaCl2 restored the intensity of the calcium response to match that of intracellular parasites (see Supp Fig. 6C). We therefore decided to repeat our cGMP measurements, this time using extracellular parasites in Endo buffer supplemented with 1 uM CaCl2. However, we found no differences in cGMP levels in the response to ionophore under these conditions (now Supp Fig. 6D) compared to the previous experiments, so the conclusions from the previous data do not change.

      As for the lipidomics experiments, we chose to use DMEM so that our dataset could be compared with other published lipidomic datasets (Katris et al., 2020; Dass et al., 2021) where DMEM was also used as a buffer when measuring global lipid profiles of parasites.

      We now acknowledge in the paper that Endo buffer has its shortcomings, and that this could be the reason why we do not detect changes in cGMP concentrations. We do, however, believe that Endo buffer is the best alternative to intracellular parasites and is supported by its consistent use in numerous publications studying Toxoplasma signalling (McCoy et al., 2012; Stewart et al., 2017).

      Additional information is required to support the claim that PDE2 has a moderate egress defect (lines 681-687). T. gondii egress is MOI-dependent (PMID: 29030485). Although the parasite strains were used at the same MOI, there is no guarantee that the parasites successfully invaded and replicated. If parasites lacking PDE2 are defective in invasion or replication, the MOI is effectively decreased, which could explain the egress delay. Could the authors compare the MOIs (number of vacuoles per host cell nuclei) of the vehicle and RAP-treated parasites at t = 0 treatment duration to give the reader a sense of whether the MOIs are comparable?

      Response:

      Since PDE2 KO parasites have a substantial growth defect, we did notice that starting MOIs were consistently lower for the RAP-treated samples compared to the DMSO-treated samples. However, this was also the case for PDE1 KO parasites where we did not see an egress delay. We also found that the egress delay was still evident for ∆CDPK3 parasites, despite having higher starting MOIs than WT parasites in our experiments. Therefore there does not appear to be a link between starting MOIs and the egress delay.

      To be sure of our results, we also performed egress assays where we co-infected HFFs with mCherry-expressing WT parasites (WT ∆UPRT) and GFP-expressing PDE2 cKO parasites that were treated with either DMSO or RAP or ∆CDPK3 parasites. This recapitulated our previous findings, confirming the deletion of PDE2 leads to delay in A23187-mediated egress.

      4.A few references are missing to ensure reproducibility.

      The manuscript states that the kinetic lipidomics experiments were performed with established methods, but the cited publication (line 497) is a preprint. These are therefore not peer reviewed and should be described in greater detail in this manuscript, including any relevant validation.

      Response:

      We thank the reviewer for pointing this out. We have included a greater description of the methods used in the materials and methods section such that the experiment is reproducible, as per the reviewer’s suggestion. We decided to still make mention of the BioRxiv preprint since we thought it was appropriate for the reader to be informed of ongoing developments in the field.

      Please cite the release of the T. gondii proteomes used for spectrum matching (lines 972-973).

      Response:

      We have included this as per the reviewer’s suggestion.

      Please include the TMT labeling scheme so the analysis may be reproduced from the raw files.

      Response:

      We have included this as per the reviewer’s suggestion in Supp Fig. 3A.

      5.Statistical analyses should be reviewed as follows:

      Have the authors examined the possibility that some changes in phosphopeptide abundance reflect changes in protein abundance? This may be particularly relevant for comparisons involving the ∆cdpk3 strain. Did the authors collect paired unenriched proteomes from the experiments performed? Alternatively, there may be enriched peptides that did not change in abundance for many of the proteins that appear dynamically phosphorylated.

      Response:

      We did not collect unenriched proteomes from the experiments performed (although we did perform unenriched mixing checks to ensure equal loading between samples), and believe that this wasn’t a necessity for the following reasons:

      1. For within-line treatment analyses, treatment timings are so short (a maximum of 15-50s in the single timepoint experiment) that it would be unlikely to detect substantial changes in protein abundance. Moreover, these unlikely events would affect all phosphosites across a protein, and therefore be detectable.

      In our CDPK3 dependency timecourse experiments, we normalise both the WT and ∆CDPK3 strain to 0s, and measure signalling progression over time. Therefore, any difference at timepoints that are not “0” are not originating from basal differences. We also see a consistent increase/decrease in phosphosite detection across the sub-minute timecourse, further confirming that the observed changes are truly down to dynamic changes in phosphorylation and not protein levels.

      In the single timepoint CDPK3 dependency analyses (44 regulated sites identified, Data S2), we acknowledge that there could be some risk of altered starting protein abundance between lines. However, if protein abundance were responsible for the changes in phosphosite detection, we would expect all phosphosites across the protein to shift, and we do not observe this. Moreover, when we look at these CDPK3 dependent proteins and compare their phosphosite abundance in untreated WT and ∆CDPK3 lines, we find that for each protein, either all or the majority of phosphosites detected are unchanged (highlighting that there is no substantial difference in this protein’s abundance between lines). Where there are phosphosite differences between lines, these are only ever on single sites on a protein while most other sites are unchanged - implying that these are changes to basal phosphorylation states and not protein levels.

      It seems like for Figs. 3B and S5 the maximum number of clusters modeled was selected. Could the authors provide a rationale for the number of clusters selected, since it appears many of the clusters have similar profiles.

      The number of clusters is chosen automatically by the Mclust algorithm as the value that maximizes the Bayes Information Criterion (BIC). BIC in effect balances gains in model fit (increasing log-likelihood) against increasing the number of parameters (i.e. number of clusters).

      Please include figure panel(s) relating to gene ontology. Relevant information for readers to make conclusions includes p-value, fold-enrichment or gene ratio, and some sort of metric of the frequency of the GO term in the surveyed data set. See PMID: 33053376 Fig. 7 and PMID: 29724925 Fig. 6 for examples or enrichment summaries. Additionally, in the methods, specify (i) the background set, (ii) the method used for multiple test correction, (iii) the criteria constituting "enrichment", (iv) how the T. gondii genome was integrated into the analysis, (v) the class of GO terms (molecular function, biological process, or cellular component), (vi) any additional information required to reproduce the results (for example, settings modified from default).

      Response:

      We have included the additional information requested in the materials and methods.

      We purposely did not include GO figure panels as our analyses are being done across many clusters, making it very difficult to display this information cohesively. We have included all data in Tables S2-S5. These tables included all the relevant information on p-value, enrichment status, ratio in study/ratio in population, class of GO terms etc.

      The presentation of the lipidomics experiments in Figure 4A-C is confusing. First, the ∆cdpk3/WT ratio removes information about the process in WT parasites, and it's unclear why the scale centers on 100 and not 1. Second, the data in Figure S6 suggests a more modest effect than that represented in Fig. 4; is this due to day to day variability? How do the authors justify pairing WT and mutant samples as they did to generate the ratios?

      Response:

      This is a common strategy used by many metabolomics experts (Bailey et al., 2015; Dass et al., 2021; Lunghi et al., 2022). We had originally chosen to represent the data as a ratio since this form of representation helps get rid of the variability that arises between experiments and allows us to see very clear patterns which would otherwise go unnoticed. This variability arises from the amount of lipids in each sample which varies between parasites in a dish, the batch of FBS and DMEM used, and the solutions and even room temperature used to extract lipids on a given day.

      However, we agree with the reviewer that depicting the data in Figure 4A-C as a ratio of ∆CDPK3/WT parasites can be confusing, so we have now changed the graphs, plotting WT and ∆CDPK3 levels instead, and have moved the ratio of ∆CDPK3/WT to the Supplementary Figure 5.

      The significance test seems to be performed on the difference between the WT and ∆cdpk3 strains, but not relative to the DMSO treatment? Wouldn't you want to perform a repeated measures ANOVA to determine (i) if lipid levels change over time and (ii) if this trend differs in WT vs. mutant strain?

      Response:

      The reviewer correctly points out that ANOVA is often used for time courses, but we must point out that it is not always strictly appropriate since it can overlook the purpose of the individual experiment design, which in this case is, 1) to investigate the role of CDPK3 compared to the WT parental strain, and 2) specifically to find the exact point at which the DAG begins to change after stimulus to match the proteomics time course.

      Our data is clearly biassed towards earlier time points where we have 0, 5, 10, 30, 45 seconds where DAG levels are mostly unchanged compared to the single timepoint 60 seconds which shows a significant difference in DAG using our method of statistical comparison by paired two tailed t-test. Therefore, it would be unwise to use ANOVA when we really want to see when the A23187 stimulus takes effect, which appears to be after the 45 second mark. Therefore, analysing the data by ANOVA would likely provide a false negative result, where the result is non-significant but there is clearly more DAG in WT than CDPK3 after 60 seconds. T-tests are commonly used when comparing the same cell lines grown in the same conditions with a test/treatment, and in this case the test/treatment is CPDK3 present or absent (Lentini et al., 2020).

      In the main text, it would be preferable to see the data presented as the proteomics experiments were in Figure 4B and 4C, with fold changes relative to the DMSO (t = 0) treatment, separately for WT and ∆cdpk3 parasites.

      Response:

      We have now changed the way that we represent the data, plotting %mol instead of the ratio.

      Signaling lipids constitute small percentages of the overall pool (e.g. PMID: 26962945), so one might not necessarily expect to observe large changes in lipid abundance when signaling pathways are modulated. Is there any positive control that the authors could include to give readers a sense of the dynamic range? Maybe the DGK1 mutant (PMID: 26962945)?

      Response:

      DGK1 is maybe not a good example because the DGK1 KO parasites effectively “melt” from a lack of plasma membrane integrity ((Bullen et al., 2016), so this would likely be technically challenging. We don’t see the added value in including an additional mutant control since we can already see the dynamic change over time from no difference (0 seconds) to significant difference (60 seconds) between WT and CDPK3 for DAG and most other lipids. We already see a significant difference between WT and CDPK3 after 60 seconds for DAG, and we can clearly see in sub-minute timecourses the changes or not at the specific points where the A23187 is added (0-5 seconds), the parasites acclimatise, for the A23187 to take effect (10-30 seconds) and for the parasite lipid response to be visible by lipidomics (45-60 +seconds).

      Figure 4E: are the differences in [cAMP] with DMSO treatment and A23187 treatment different at any of the timepoints in the WT strain? The comparison seems to be WT/∆cdpk3 at each timepoint. Does the text (lines 562-568) need to be modified accordingly?

      Response:

      In WT (and ∆CDPK3) parasites, [cAMP] is significantly changed at 5s of A23187 treatment (relative to DMSO). We have modified our figures to include this analysis. The existing text accurately reflects this.

      Figure 6I: is the difference between PDE2 cKO/∆cdpk3 + DMSO or RAP significant?

      Response

      In our original manuscript, there was no statistical difference in [cAMP] between PDE2cKO/∆CDPK3+DMSO and PDE2cKO/∆CDPK3+DMSO+RAP, likely due to the variation between biological replicates. To overcome the issues in variability between replicates, we have now included more biological replicates (n=7). This has led to a significant difference in [cAMP] between PDE2cKO/∆CDPK3 DMSO- and RAP-treated parasites and between PDE2cKO DMSO- and RAP-treated parasites (now Fig. 6I).

      **MINOR COMMENTS**

      1.The following references should be added or amended:

      Lines 83-85: in the cited publication, relative phosphopeptide abundances of an overexpressed dominant-negative, constitutively inactive PKA mutant were compared to an overexpressed wild-type mutant. In this experimental setup, one would hypothesize that targets of PKA should be down-regulated (inactive/WT ratios). However, the mentioned phosphopeptide of PDE2 was found to be up-regulated, suggesting that it is not a direct target of PKA.

      Response:

      We thank the reviewer for spotting this error, we have now modified our wording.

      Cite TGGT1_305050, referenced as calmodulin in line 458, as TgELC2 (PMID: 26374117).

      Response:

      We have included this as per the reviewer’s suggestion.

      Cite TGGT1_295850 as apical annuli protein 2 (AAP2, PMID: 31470470).

      Response:

      We have included this as per the reviewer’s suggestion.

      Cite TGGT1_270865 (adenylyl cyclase beta, Acβ) as PMID: 29030485, 30449726.

      Response:

      We have included this as per the reviewer’s suggestion.

      Cite TGGT1_254370 (guanylyl cyclase, GC) as PMID: 30449726, 30742070.

      Response:

      We have included this as per the reviewer’s suggestion.

      Note that Lourido, Tang and David Sibley, 2012 observed that treatment with zaprinast (a PDE inhibitor) could overcome CDPK3 inhibition. The target(s) of zaprinast have not been determined and may differ from those of BIPPO (in identity and IC50). The cited study also used modified CDPK3 and CDPK1 alleles, rather than ∆cdpk3 and intact cdpk1 as used in this manuscript. That is to say, the signaling backgrounds of the parasite strains deviate in ways that are not controlled.

      Response:

      While it is true that zaprinast targets have not been unequivocally identified, zaprinast-induced egress is widely thought to be the result of PKG activation, a conclusion that is further supported by the finding that Compound 1 completely blocks zaprinast-induced egress (Lourido, Tang and David Sibley, 2012). Similarly, BIPPO-induced egress is inhibited by chemical inhibition of PKG by Compound 1 and Compound 2 (Jia et al., 2017). Moreover, like zaprinast, BIPPO has been clearly shown to partially overcome the ∆CDPK3 egress delay (Stewart et al., 2017).

      2.The following comments refer to the figures and legends:

      Part of the legend text for 1G is included under 1H.

      Response:

      This has been corrected

      Figure 1H: The legend mentions that some dots are blue, but they appear green. Please ensure that color choices conform to journal accessibility guidelines. See the following article about visualization for colorblind readers: https://www.ascb.org/science-news/how-to-make-scientific-figures-accessible-to-readers-with-color-blindness____/ . Avoid using red and green false-colored images; replace red with a magenta lookup table. Multi-colored images are only helpful for the merged image; otherwise, we discern grayscale better. Applies to Figures 1B, 5C, 6D. (Aside: anti-CAP seems an odd choice of counterstain; the variation in the staining, esp. at the apical cap, is distracting.)

      Response:

      We thank reviewer #1 for bringing this to our attention, and have modified our colour usage for all IFAs and Figures 1H and 3E.

      We chose CAP staining as the antibody is available in the laboratory and stains both the apical end (which has been shown to contain several proteins important for signalling as well as PDE9) and the parasite periphery, the location of CDPK3.

      Figure 1B: When showing a single fluorophore, please use grayscale and include an intensity scale bar, since relative values are being compared.

      Response:

      We have modified this as per the reviewer’s suggestion

      Figure 1C: it is difficult to compare the kinetics of the calcium response when the curves are plotted separately. Since the scales are the same, could the two treatments be plotted on the same axes, with different colors? Additionally, according to the legend, a red line seems to be missing in this panel.

      Response:

      Fig1C is not intended to compare kinetics, merely to show peak calcium release in each separate treatment condition. We have removed mention of a red line in the figure legend.

      Figure 2A: Either Figure S4 can be moved to accompany Figure 2A, or Figure 2A could be moved to the supplemental.

      Figure S4 has now been incorporated into Figure 2.

      Reviewer #1 (Significance (Required)):

      This manuscript would interest researchers studying signaling pathways in protozoan parasites, especially apicomplexans, as CDPK3 and PKG orthologs exist across the phylum. To my knowledge, it is the first study that has proposed a mechanism by which a calcium effector regulates cAMP levels in T. gondii. Unfortunately, the experiments fall short of testing this mechanism.

      Response:

      We thank reviewer #1 for their comments, but disagree with their assessment that the key points of the manuscript “fall short of experimental testing”.

      1. We demonstrate that, following both BIPPO and A23187 treatment, there is differential phosphorylation of numerous components traditionally believed to sit upstream of PKG activation (as well as several components within the PKG signalling pathway itself).
      2. We show that some of these sites are CDPK3 dependent, and that deletion of CDPK3 leads to changes in lipid signalling and an elevation in levels of cAMP (dysregulation of which is known to alter PKG signalling).
      3. We show that pre-treatment with a PKA inhibitor is able to largely rescue this phenotype.
      4. We demonstrate that a cAMP-specific PDE is phosphorylated following A23187 treatment (i.e. Ca2+ flux)
      5. We show that this cAMP specific PDE plays a role in A23187-mediated egress.
      6. While the latter PDE may not be directly regulated by CDPK3, these findings suggest that there are likely several Ca2+-dependent kinases that contribute to this feedback loop.

        Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      **Summary:**

      Provide a short summary of the findings and key conclusions (including methodology and model system(s) where appropriate).

      In this manuscript, Dominicus et al investigate the elusive role of calcium-dependent kinase 3 during the egress of Toxoplasma gondii. Multiple functions have already been proposed for this kinase by this group including the regulation of basal calcium levels (24945436) or of a tyrosine transporter (30402958). However, one of the most puzzling phenotypes of CDPK3 deficient tachyzoites is a marked delay in egress when parasites are stimulated with a calcium ionophore that is rescued with phosphodiesterase (PDE) inhibitors. Crosstalk between, cAMP, cGMP, lipid and calcium signalling has been previously described to be important in regulating egress (26933036, 23149386, 29030485) but the role of CDPK3 in Toxoplasma is still poorly understood.

      Here the authors first take an elegant phosphoproteomic approach to identify pathways differentially regulated upon treatment with either a PDE inhibitor (BIPPO) and a calcium ionophore (A23187) in WT and CDPK3-KO parasites. Not much difference is observed between BIPPO or A23187 stimulation which is interpreted by the authors as a regulation through a feed-back loop.

      The authors then investigate the effect of CDPK3 deletion on lipid, cGMP and cAMP levels. The identify major changes in DAG, phospholipid, FFAs, and TAG levels as well as differences in cAMP levels but not for cGMP. Chemical inhibition of PKA leads to a similar egress timing in CDPK3-KO and WT parasites upon A23187 stimulation.

      As four PDEs appeared differentially regulated in the CDPK3-KO line upon A23187, the authors investigate the requirement of the 4 PDEs in cAMP levels. They show diverse localisation of the PDEs with specificities of PDE1, 7 and 9 for cGMP and of PDE2 for cAMP. They further show that PDE1, 7 and 9 are sensitive to BIPPO. Finally, using a conditional deletion system, they show that PDE1 and 2 are important for the lytic cycle of Toxoplasma and that PDE2 shows a slightly delayed egress following A23187 stimulation.

      **Major comments:**

      -Are the key conclusions convincing?

      The title is supported by the findings presented in this study. However I am not sure to understand why the authors imply a positive feed back loop. This should be clarified in the discussion of the results.

      Response:

      We believe in a positive feedback loop as, upon A23187 treatment (resulting in a calcium flux), ΔCDPK3 parasites are able to egress, albeit in a delayed manner. This egress delay is substantially, but not completely, alleviated upon treatment with BIPPO (a PDE inhibitor known to activate the PKG signalling pathway). In conjunction with our phosphoproteomic data (where we see phosphorylation of numerous pathway components upstream of PKG upon BIPPO and A23187 treatment - both in a CDPK3 dependent and independent manner), these observations suggest that calcium-regulated proteins (CDPK3 among them) feed into the PKG pathway. As deletion of CDPK3 delays egress, it is reasonable to postulate that this feedback is one that amplifies egress signalling (i.e. is positive).

      The phosphoproteome analysis seems very strong and will be of interest for many groups working on egress. However, the key conclusion, i.e. that a substrate overlaps between PKG and CDPK3 is unlikely to explain the CDPK3 phenotype, seems premature to me in the absence of robustly identified substrates for both kinases.

      Response:

      We certainly do not fully exclude the possibility of a substrate overlap but do lean more heavily towards a feedback loop given (a) the inability to clearly detect treatment-specific signalling profiles and (b) the phospho targets observed in the A23187 and BIPPO phosphoproteomes. We have further clarified our reasoning, and overall tempered our language in the manuscript as per the reviewer’s suggestion.

      I am not sure there is a clear key conclusion from the lipidomic analysis and how it is used by the authors to build their model up. Major changes are observed but how could this be linked with CDPK3, particularly if cGMP levels are not affected?

      Response:

      Our phosphoproteomic analyses identify several CDPK3-dependent phospho sites on phospholipid signalling components (DGK1 & PI-PLC), suggesting that there is indeed altered signalling downstream of PKG. To test whether these lead to a measurable phenotype, we performed the lipidomics analysis. We did not pursue this arm of the signalling pathway any further as we postulated that the changes in the lipid signalling pathway were less likely to play a role in the feedback loop. Nevertheless, we felt that it was worthwhile to include these findings in our manuscript as they support the conclusions drawn from the phosphoproteomics - namely that lipid signalling is perturbed in CDPK3 mutants. We, or others, may follow up on this in future.

      We agree with the reviewer that it is surprising that cGMP levels remain unchanged in our experiments when we treat with A23187. Given the measurable difference in cAMP levels between WT and ΔCDPK3 parasites, we postulate that CDPK3 directly or indirectly downregulates levels of cAMP. This would, in turn, alter activity of the cAMP-dependent protein kinase PKAc. Jia et al. (2017) have shown a clear dependency on PKG for parasites to egress upon PKAc depletion, but were also unable to reliably demonstrate cGMP accumulation in intracellular parasites. Similarly, their hypothesis that dysregulated cGMP-specific PDE activity results in altered cGMP levels has not been proven (the PDE hypothesised to be involved has since been shown to be cAMP-specific).

      While it is possible that our collective inability to observe elevated cGMP levels is explained by the sensitivity limits of the assay, it is similarly possible that cAMP-mediated signalling is exerting its effects on the PKG signalling pathway in a cGMP-independent manner.

      The evidence that CDPK3 is involved in cAMP homeostasis seems strong. However, the analysis of PKA inhibition is a bit less clear. The way the data is presented makes it difficult to see whether the treatment is accelerating egress of CDPK3-KO parasites or affecting both WT and CDPK3-KO lines, including both the speed and extent of egress. This is important for the interpretation of the experiment.

      Response:

      Fig. 4F shows that there is a significant amount of premature egress in both WT and ∆CDPK3 parasites following 2 hrs of H89 pre-treatment (consistent with previous reports that downregulation of cAMP signalling stimulates premature egress). When we subsequently investigated A23187-induced egress rates of the remaining intracellular H89 pre-treated parasites (Fig. 4Gi-ii) we found that the ∆CDPK3 egress delay was largely rescued. We have moved Fig. 4F to the supplement (now Supp Fig. 5E) in order to avoid confusion between the distinct analyses shown in 4F (pre-treatment analyses) and 4G (egress experiment). These experiments provided a hint that cAMP signalling is affected, which we then validate by measuring elevated cAMP levels in CDPK3 mutant parasites.

      The biochemical characterisation of the four PDE is interesting and seems well performed. However, PDE1 was previously shown to hydrolyse both cAMP and cGMP (____https://doi.org/10.1101/2021.09.21.461320____) which raises some questions about the experimental set up. Could the authors possibly discuss why they do not observe similar selectivity? Could other PDEs in the immunoprecipitate mask PDE activity? In line with this question, it is not clear what % of "hydrolytic activity (%)" means and how it was calculated.

      The experiments describing the selectivity of BIPPO for PDE1, 7 and 9 as well as the biological requirement of the four tested PDEs are convincing.

      Response:

      We believe that the disagreement between our findings and those published by Moss and colleagues are due to the differences in experimental conditions. We performed our assays at room temperature for 1 hour with higher starting cAMP concentrations (1 uM) compared to them. They performed their assays at 37ºC for 2 hours with 10-fold lower starting cAMP concentrations (0.1 uM). We have now repeated this set of experiments using the Moss et al. conditions, and find that PDEs 1, 7 and 9 can be dual specific, while PDE2 is cAMP-specific, thereby recapitulating their findings (Now included in the revised manuscript under Supp Fig. 7B). However, we also now performed a timecourse PDE assay using our original conditions and show that the cAMP hydrolytic activity for PDE1 can only be detected following 4 hours of incubation, compared to cGMP activity that can be detected as early as 30 minutes, suggesting that it possesses predominantly cGMP activity (See Supp Fig. 7C). We therefore believe that our experimental setup is more stringent, because if one starts with a lower level of substrate and incubates for longer and at a higher temperature, even minor dual activity could make a substantial difference in cAMP levels. Our data suggests that the cAMP hydrolytic activity of PDEs 1, 7 and 9 is substantially lower than the cGMP hydrolytic activity that they display.

      We have also included a clear description of how % hydrolytic activity was calculated in the methods section.

      -Should the authors qualify some of their claims as preliminary or speculative, or remove them altogether?

      The claim that CDPK3 affects cAMP levels seems strong however the exact links between CDPK3 activity, lipid, cGMP and cAMP signalling remain unclear and it may be important to clearly state this.

      Response:

      We have modified our wording in the text to more clearly describe our current hypothesis and reasoning.

      -Would additional experiments be essential to support the claims of the paper? Request additional experiments only where necessary for the paper as it is, and do not ask authors to open new lines of experimentation.

      I think that the manuscript contains a significant amount of experiments that are of interest to scientists working on Toxoplasma egress. Requesting experiments to identify the functional link between above-mentioned pathways would be out of the scope for this work although it would considerably increase the impact of this manuscript. For example, would it be possible to test whether the CDPK3-KO line is more or less sensitive to PKG specific inhibition upon A23187 induced?

      -Are the suggested experiments realistic in terms of time and resources? It would help if you could add an estimated cost and time investment for substantial experiments.

      The above-mentioned experiment is not trivial as no specific inhibitors of PKG are available. Ensuring for specificity of the investigated phenotype would require the generation of a resistant line which would require significant work.

      __Response: __We agree that this would be an interesting experiment to further substantiate our findings. As indicated by the reviewer, however, the lack of specific inhibitors of PKG means a resistant line would likely be required to ensure specificity.

      -Are the data and the methods presented in such a way that they can be reproduced?

      It is not clear how the % of hydrolytic activity of the PDE has been calculated.

      Response: We have included a clearer description of how % hydrolytic activity was calculated in the methods section.

      -Are the experiments adequately replicated and statistical analysis adequate?

      This seems to be performed to high standards.

      **Minor comments:**

      -Specific experimental issues that are easily addressable.

      I do not have any comments related to minor experimental issues.

      -Are prior studies referenced appropriately?

      Most of the studies relevant for this work are cited. It is however not clear to me why some important players of the "PKG pathway" are not indicated in Fig 1H and Fig 3E, including for example UGO or SPARK.

      Response:

      We have modified Fig 1H and 3E to include all key players involved in the PKG pathway.

      -Are the text and figures clear and accurate?

      While all the data shown here is impressive and well analysed, I find it difficult to read the manuscript and establish links between sections of the papers. The phosphoproteome analysis is interesting and is used to orientate the reader towards a feedback mechanism rather than a substrate overlap. But why do the authors later focus on PDEs and not on AC or CNBD, as in the end, if I understand well, there is no evidence showing a link between CDPK3-dependent phosphorylation and PDE activity upon A23187 stimulation?

      Response:

      We thank reviewer#2 and appreciate their constructive feedback re the flow of the manuscript.

      Our key findings from the phosphoproteomics study were that 1) BIPPO and A23187 treatment trigger near identical signalling pathways, 2) that both A23187 and BIPPO treatment leads to phosphorylation of numerous components both upstream and downstream of PKG signalling (hinting at the presence of an Ca2+-regulated feedback loop) and 3) several of the abovementioned components are phosphorylated in a CDPK3 dependent manner.

      While several avenues of study could have been pursued from this point onwards, we chose to focus on the feedback loop in a broader sense as its existence has important implications for our general understanding of the signalling pathways that govern egress.

      We reasoned that, given the differential phosphorylation of 4 PDEs following A23187 and BIPPO treatment (none of which had been studied in detail previously), it was relevant to study these in greater detail.

      Coupled with the A23187 egress assay on PDE2 knockout parasites - our findings suggest that PDE2 plays a role in the abovementioned Ca2+ signalling loop. While PDE2 may not exert its effects in a CDPK3-dependent manner (and CDPK3 may, therefore, alter cAMP levels in a different fashion), this does not detract from the important finding that PDE2 is one of the (likely numerous) components that is regulated in a Ca2+-dependent feedback loop to facilitate rapid egress.

      We have modified our wording to better reflect our rationale for studying the PDEs irrespective of their CDPK3 phosphorylation status.

      While we feel that our reasoning for studying the PDEs is solid, we do appreciate that further clarification on the putative CDPK3-Adenylate cyclase link would elevate the manuscript substantially. However, given the data that the ACb is not playing a sole role in the control of egress, this is likely a non-trivial task and requires substantial work.

      It is also unclear how the authors link CDPK3-dependent elevated cAMP levels with the elevated basal calcium levels they previously described. This is particularly difficult to reconcile particularly in a PKG independent manner.

      Response:

      We previously postulated that elevated Ca2+ levels allowed ΔCDPK3 mutants to overcome a complete egress defect, potentially by activating other CDPKs (e.g. CDPK1). It is similarly plausible that elevated Ca2+ levels in ΔCDPK3 parasites may lead to elevated cAMP levels in order to prevent premature egress.

      As noted in our previous responses, we acknowledge that our inability to detect cGMP is surprising. However, given the clarity of our cAMP findings, and the phosphoproteomic evidence to suggest that various components in the PKG signalling pathway are affected, we postulate that we are either unable to reliably detect cGMP due to sensitivity issues, or that cAMP is exerting its regulation on the PKG pathway in a cGMP-independent manner. As noted previously, while the link between cAMP and PKG signalling has been demonstrated by Jia et al., it is not entirely clear how this is mediated.

      The presentation of the lipidomic analysis is also not really clear to me. Why do the authors show the global changes in phospholipids and not a more detailed analysis?

      Response:

      We performed a detailed phospholipid profile of WT and ∆CDPK3 parasites under normal culture conditions. However, due to the sheer quantity of parasites required for this detailed analysis, we were unable to measure individual phospholipid species in our A23187 timecourse. We therefore opted to measure global changes following A23187 stimulation.

      As the authors focus on the PI-PLC pathway, could they detail the dynamics of phosphoinositides? I understand that lipid levels are affected in the mutant but I am not sure to understand how the authors interpret these massive changes in relationship with the function of CDPK3 and the observed phenotypes.

      Response:

      Our phosphoproteomic analyses identified several CDPK3-dependent phospho sites on phospholipid signalling components (DGK1 & PI-PLC), suggesting that (in keeping with all of our other data), there is altered signalling downstream of PKG. To test whether these changes lead to a measurable phenotype, we performed the lipidomics analysis. Following stimulation with A23187, we found a delayed production of DAG in ∆CDPK3 parasites compared to WT parasites. Since DAG is required for the production of PA, which in turn is required for microneme secretion, our finding can explain why microneme secretion is delayed in ∆CDPK3 parasites, as previously reported (Lourido, Tang and David Sibley, 2012; McCoy et al., 2012).

      We did not follow this arm of the signalling pathway any further as we postulated that the changes in the lipid signalling pathway were less likely to play a role in the feedback loop. Nevertheless, we felt that it was worthwhile to include these findings in our manuscript as they support the conclusions drawn from the phosphoproteomics - namely that lipid signalling is perturbed in CDPK3 mutants. We, or others, may follow up on this in future.

      Finally, the characterisation of the PDEs is an impressive piece of work but the functional link with CDPK3 is relatively unclear. It would also be important to clearly discuss the differences with previous results presented in this this preprint: https://doi.org/10.1101/2021.09.21.461320____.

      My understanding is while the authors aim at investigating the role of CDPK3 in A23187 induced egress, the main finding related to CDPK3 is a defect in cAMP homeostasis that is not linked to A23187. Similarly, the requirements of PDE2 in cAMP homeostasis and egress is indirectly linked to CDPK3. Altogether I think that important results are presented here but divided into three main and distinct sections: the phosphoproteomic survey, the lipidomic and cAMP level investigation, and the characterisation of the four PDEs. However, the link between each section is relatively weak and the way the results are presented is somehow misleading or confusing.

      Response:

      As mentioned in a previous response, we chose to study PDEs in greater detail because of our observation that both A23187 and BIPPO treatments lead to their phosphorylation (hinting at the presence of a Ca2+regulated feedback loop). We were particularly intrigued to study the cAMP specific PDE, as CDPK3 KO parasites suggested that cAMP may play a role in the Ca2+ feedback mechanism. As PDE2 may not be directly regulated by CDPK3, Ca2+ appears to exert its feedback effects in numerous ways. We have modified our wording to better reflect our rationale for studying the PDEs irrespective of their CDPK3 phosphorylation status.

      -Do you have suggestions that would help the authors improve the presentation of their data and conclusions?

      This is a very long manuscript written for specialists of this signalling pathway and I would suggest the authors to emphasise more the important results and also clearly state where links are still missing. This is obviously a complex pathway and one cannot elucidate it easily in a single manuscript.

      Response:

      We have included an additional summary in our conclusions to better illustrate our findings and clarify any missing links.

      Reviewer #2 (Significance (Required)):

      -Describe the nature and significance of the advance (e.g. conceptual, technical, clinical) for the field.

      This is a technically remarkable paper using a broad range of analyses performed to a high standard.

      -Place the work in the context of the existing literature (provide references, where appropriate).

      The cross-talk between cAMP, cGMP and calcium signalling is well described in Toxoplasma and related parasites. Here the authors show that, in Toxoplasma, CDPK3 is part of this complex signalling network. One of the most important finding within this context is the role of CDPK3 in cAMP homeostasis. With this in mind, I would change the last sentence of the abstract to "In summary we uncover a feedback loop that enhances signalling during egress and links CDPK3 with several signalling pathways together."

      Response:

      In light of feedback received from several reviewers, we have made our wording less CDPK3 centric - as our findings relate in part to CDPK3 and, in a broader sense, to a Ca2+ driven feedback loop.

      The genetic and biochemical analyses of the four PDEs are remarkable and highlight consistencies and inconsistencies with recently published work that would be important to discuss and will be of interest for the field.

      __Response: __We thank reviewer#2 and agree that the PDE findings are of significant importance to the field.

      While I understand the studied signalling pathway is complex, I think it would be important to better describe the current model of the authors. In the discussion, the authors indicate that "the published data is not currently supported by a model that fits most experimental results." I would suggest to clarify this statement and discuss whether their work helps to reunite, correct or improve previous models.

      __Response: __We have expanded on the abovementioned statement to clarify that the presence of a feedback loop is a major pillar of knowledge required for the complete interpretation of existing signalling data.

      Could the authors also speculate about a potential role of PDE/CDPK3 in host cell invasion as cAMP signalling has be shown to be important for this process (30208022 and 29030485)?

      __Response: __Existing literature (Jia et al., 2017) suggests that perturbations to cAMP signalling play a very minor role in invasion since parasites where either ACα or ACβ are deleted show no impairment in invasion levels. We currently do not have substantial data on invasion, and are not sure that pursuing this is valuable given the minor phenotypes observed in other studies.

      -State what audience might be interested in and influenced by the reported findings.

      This paper is of great interest to groups working on the regulation of egress in Toxoplasma gondii and other related apicomplexan pathogens.

      -Define your field of expertise with a few keywords to help the authors contextualize your point of view. Indicate if there are any parts of the paper that you do not have sufficient expertise to evaluate.

      I am working on the cell biology of apicomplexan parasites.

      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      **Summary:**

      Dominicus et al aimed to identify the intersecting components of calcium, cyclic nucleotides (cAMP, cGMP) and lipid signaling through phosphoproteomic, knockout and biochemical assays in an intracellular parasite, Toxoplasma gondii, particularly when its acutely-infectious tachyzoite stage exits the host cells. A series of experimental strategies were applied to identify potential substrates of calcium-dependent protein kinase 3 (CDPK3), which has previously been reported to control the tachyzoite egress. According to earlier studies (PMID: 23226109, 24945436, 5418062, 26544049, 30402958), CDPK3 regulated the parasite exit through multiple phosphorylation events. Here, authors identified differentially-regulated (DR) phosphorylation sites by comparing the parasite samples after treatment with a calcium ionophore (A23178) and a PDE inhibitor (BIPPO), both of which are known to induce artificial egress (induced egress as opposed to natural egress). When the DCDPK3 mutant was treated with A23187, its delayed egress phenotype did not change, whereas BIPPO restored the egress to the level of the parental (termed as WT) strain, probably by activating PKG.

      The gene ontology enrichment of the up-regulated clusters revealed many probable CDPK3-dependent DR sites involved in cyclic nucleotide signaling (PDE1, PDE2, PDE7, PDE9, guanylate and adenylate cyclases, cyclic nucleotide-binding protein or CNBP) as well as lipid signaling (PI-PLC, DGK1). Authors suggest lipid signaling as one of the factors altered in the CDPK3 mutant, albeit lipidomics (PC, PI, PS, PT, PA, PE, SM) showed no significant change in phospholipids. To reveal how the four PDEs indicated above contribute to the cAMP and cGMP-mediated egress, they examined their biological significance by knockout/knockdown and enzyme activity assays. Authors claim that PDE1,7,9 proteins are cGMP-specific while PDE2 is cAMP-specific, and BIPPO treatment can inhibit PDE1-cGMP and PDE7-cGMP, but not PDE9-cGMP. Given the complexity, the manuscript is well structured, and most experiments were carefully designed. Undoubtedly, there is a significant amount of work that underlies this manuscript; however, from a conceptual viewpoint, the manuscript does not offer significant advancement over the current knowledge without functional validation of phosphoproteomics data (see below). A large body of work preceding this manuscript has indicated the crosstalk of cAMP, cGMP, calcium and lipid signaling cascades. This work provides a further refinement of the existing model In a methodical sense, the work uses established assays, some of which require revisiting to reach robust conclusions and avoid misinterpretation. The article is quite interesting from a throughput screening point of view, but it clearly lacks the appropriate endorsement of the hits.The authors accept that identifying the phosphorylation of a protein does not imply a functional role, which is a major drawback as there is no experimental support for any phosphorylation site of the protein identified through phosphoproteomics. In terms of the mechanism, it is not clear whether and how lipid turnover and cAMP-PKA signaling control the egress phenotype (lack of a validated model at the end of this study).

      Response:

      We thank reviewer #3 for their comments, but respectfully disagree with their assessment that the work presented does not advance current knowledge.

      1. We demonstrate that, following both BIPPO and A23187 treatment, there is differential phosphorylation of numerous components traditionally believed to sit upstream of PKG activation (as well as numerous components within the PKG signalling pathway itself). While it may have been inferred from previous studies that A23187 and BIPPO signalling intersect, this has never been unequivocally demonstrated - nor has a feedback loop ever been shown.

      We provide a novel A23187-driven phosphoproteome timecourse that further bolsters the model of a Ca2+-driven feedback loop.

      We show that deletion of CDPK3 leads to a delay in DAG production upon stimulation with A23187.

      We show that some of the abovementioned sites are CDPK3 dependent, and that deletion of CDPK3 leads to elevated levels of cAMP (dysregulation of which is known to alter PKG signalling).

      We show that pre-treatment with a PKA inhibitor is able to largely rescue this phenotype.

      We demonstrate that a cAMP-specific PDE is phosphorylated following A23187 treatment (i.e. Ca2+ flux)

      We show that this cAMP specific PDE plays a role in egress.

      While the latter PDE may not be directly regulated by CDPK3, these findings suggest that there are likely several Ca2+-dependent kinases that contribute to this feedback loop.

      We also firmly disagree with the reviewer’s assertion that without phosphosite characterisation, we have no support for our model. Following treatment with A23187 (and BIPPO), we clearly show broad, systemic changes (both CDPK3 dependent and independent) across signalling pathways previously deemed to sit upstream of calcium flux. Given the vast number of proteins involved in these signalling pathways, and the multitude of differentially regulated phosphosites identified on each of them, it is highly likely that the signalling effects we observe are combinatorial. Accordingly, we believe that mutating individual sites on individual proteins would be a very costly endeavour which is unlikely to substantially advance our understanding of signalling during egress. Moreover, introducing multiple point mutations in a given protein to ablate phosphorylation may lead to protein misfolding and would therefore not be informative. One of the key aims of this study was to assess how egress signalling pathways are interconnected, and we believe we have been able to show strong support for a Ca2+-driven feedback mechanism in which both CDPK3 and PDE2 play a role through the regulation of cAMP.

      While we agree with the reviewer’s statement that a large body of work preceding this manuscript has indicated the crosstalk of cAMP, cGMP, calcium and lipid signalling cascades, a feedback loop has not previously been shown. We believe that this finding is absolutely central to facilitate the complete interpretation of existing signalling data. Furthermore, no previous studies have gone to this level of detail in either proteomics or lipidomics to analyse the calcium signal pathway in any apicomplexan parasite. We argue that the novelty in our manuscript is that it is a carefully orchestrated study that advances our understanding of the signalling network over time with subcellular precision. The kinetics of signalling is not well understood and we believe that our study is likely the first to include both proteomic and lipidomic analyses over a timecourse during the acute lytic cycle stage of the disease. In doing so, we found evidence for a feedback loop that controls the signalling network spatiotemporally, and we characterise elements of this feedback in the same study.

      **Major Comments:**

      Based on the findings reported here there is little doubt that BIPPO and A23187-induced signaling intersect with each other, as very much expected from previous studies. The authors selected the 50s and 15s post-treatment timing of A23187 and BIPPO, respectively for collecting phosphoproteomics samples. At these time points, which were shown to peak cytosolic Ca2+, parasites were still intracellular (Line #171). How did authors make sure to stimulate the entire signaling cascade adequately, particularly when parasites do not egress within the selected time window? There is significant variability between phosphosite intensities of replicates (Line #186), which may also be attributed to insufficient triggers for the egress across independent experiments. This work must be supported by in vitro egress assays with the chosen incubation periods of BIPPO and ionophore treatment (show the induced % egress of tachyzoites in the 50s and 15s).

      Response:

      1. We appreciate that the reviewer acknowledges that our data clearly shows that BIPPO and A23187-induced signalling intersect. While this may have been expected from previous studies, this has not previously been shown - and is therefore valuable to the field. Specifically, the fact that A23187-treatment leads to phosphorylation of targets normally deemed to sit upstream of calcium release is entirely novel and adds a substantial layer of information to our understanding of how these signalling pathways work together.

      Treatments were purposely selected to align pathways to a point where calcium levels peak just prior to calcium reuptake. At these chosen timepoints, we clearly show that overall signalling correlation is very high. We know from our egress assays using identical treatment concentrations (Fig. 2C), that the stimulations used are sufficient to result in complete egress. We are simply comparing signalling pathways at points prior to egress.

      As mentioned in point 2, we show convincingly that the treatments used are sufficient to trigger complete egress. As detailed clearly in the text, we believe that these variations in intensities between replicates are due to slight differences in timing between experiments (this is inevitable given the very rapid progression of signalling, and the difficulty of replicating exact sub-minute treatment timings). We demonstrate that the reporter intensities associated with DR sites correlate well across replicates (Supp Fig. 3C), suggesting that despite some replicate variability, the overall trends across replicates is very much consistent. This allows us to confidently average scores to provide values that are representative of a site’s phosphorylation state at the timepoint of interest.

      The reviewer’s suggestion that we should demonstrate % egress at the 50s and 15s treatment timepoints is obsolete - we state clearly in the text that parasites have not egressed at these timepoints. Our egress assays (Fig. 2C) further support this.

      The authors discuss that CDPK3 controls the cAMP level and PKA through activation of one or more yet-to-be-identified PDEs(s). cAMP could probably also be regulated by an adenylate cyclase, ACbeta that was found to have CDPK3-dependent phosphorylation sites. If CDPK3 is indeed a regulator of cAMP through the activation of PDEs or ACbeta, it would be expected that the deletion of CDPK3 would perturb the cAMP level, resulting in dysregulation of PKAc1 subunit, which in turn would dysregulate cGMP-specific PDEs (PMID: 29030485) and thereby PKG. All these connections need to explain in a more clear manner with experimental support (what is positive and what is negatively regulated by C____DPK3).

      Response:

      1. We do not firmly state that CDPK3 regulates cAMP by phosphorylation of a PDE - this is one of the possibilities addressed. We acknowledge the possibility that this could also be via the adenylate cyclase (see line 792).

      PMID: 29030485 demonstrates clearly a link between cAMP signalling and PKG signalling, but does not demonstrate how this is mediated. The authors postulate that a cGMP-specific PDE is dysregulated given their observation that PDE2 is differentially phosphorylated in a constitutively inactive PKA mutant, however this was not validated experimentally. We and others (Moss et al., 2022), however, demonstrate that PDE2 is cAMP-specific. This suggests that the model built by PMID: 29030485 requires revisiting. We acknowledge clearly in the text that Jia et al. have shown a link between cAMP and PKG signalling, and hypothesise that CDPK3’s modulation of cAMP levels may affect this (this is in keeping with our phosphoproteomic data).

      Moreover, the egress defect is not due to a low influx of calcium in the cytosol because when the ionophore A23187 was added to the CDPK3 mutant, its phenotype was not recovered. Rather, the defect may be due to the low or null activity of PKG that would activate PI4K to generate IP3 and DAG. The latter would be used as a substrate by DGK to generate PA that is involved in the secretion of micronemes and Toxoplasma egress. In this context, authors should evaluate the role of CDPK3 in the secretion of micronemes that is directly related to the egress of the parasite.

      1. We agree with the reviewer on their point about calcium influx, and have already acknowledged in the text that the feedback loop does not control release of Ca2+ from internal stores as disruption of CDPK3 does not lead to a delay in Ca2+

      We agree, and clearly address in the text, that the egress defect could be due to altered PKG/phospholipid pathway signalling.

      (Lourido, Tang and David Sibley, 2012; McCoy et al., 2012) have both previously shown that microneme secretion is regulated by CDPK3. We therefore do not deem it necessary to repeat this experiment, but have made clearer mention of their findings in our writing.

      When the Dcdpk3 mutant with BIPPO treatment was evaluated, it was observed that the parasite recovered the egress phenotype. It is concluded that CDPK3 could probably regulate the activity of cGMP-specific PDEs. CDPK3 could (in)activate them, or it could act on other proteins indirectly regulating the activity of these PDEs. Upon inactivation of PDEs, an increase in the cGMP level would activate PKG, which will, in turn, promote egress. From the data, it is not clear whether any phosphorylation by CDPK3 would activate or inactivate PDEs, and if so, then how (directly or indirectly). To reach unambiguous interpretation, authors should perform additional assays.

      Response:

      As mentioned previously, given the abundance of differentially regulated phosphosites, we do not believe that mutating individual sites on individual proteins is a worthwhile or realistic pursuit.

      We clearly show systematic A23187-mediated phosphorylation of key signalling components in the PKA/PKG/PI-PLC/phospholipid signalling cascade, and demonstrate that several of these are CDPK3-dependent. We demonstrate that CDPK3 alters cAMP levels (and that the ∆CDPK3 egress delay in A23187 treated parasites is largely rescued following pre-treatment with a PKA inhibitor). We similarly demonstrate that A23187 treatment leads to phosphorylation of numerous PDEs, including the cAMP specific PDE2, and show that PDE2 knockout parasites show an egress delay following A23187 treatment. While PDE2 may not be directly regulated by CDPK3 (suggesting other Ca2+ kinases are also involved), these findings collectively demonstrate the existence of a calcium-regulated feedback loop, in which CDPK3 and PDE2 play a role (by regulating cAMP).

      We acknowledge that we have not untangled every element of this feedback loop, and do not believe that it would be realistic to do so in a single study given the number of sites phosphorylated and pathways involved. We do believe, however, that we have shown clearly that the feedback loop exists - this in itself is entirely novel, and of significant importance to the field.

      On a similar note, a possible experiment that can be done to improve the work would be to treat the CDPK3 mutant with BIPPO in conjunction with a calcium chelator (BAPTA-AM) to reveal, which proteins are phosphorylated prior to activation of the calcium-mediated cascades?

      Response:

      We agree that this would be an interesting experiment to carry out but would involve significant work. This could be pursued in another paper or project but is beyond the scope of this work.

      The manuscript claims that PDE1, PDE7, PDE9 are cGMP specific, and BIPPO inhibits only cGMP-specific PDEs. All assays are performed with 1-10 micromolar cAMP and cGMP for 1h. There is no data showing the time, protein and substrate dependence. Given the suboptimal enzyme assays, authors should re-do them as suggested here. (1) Repeat the pulldown assay with a higher number of parasites (50-100 million) and measure the protein concentration. (2) Set up the PDE assay with saturating amount of cAMP and cGMP, which is critical if the PDE1,7,9 have a higher Km Value for cAMP (means lower affinity) compared to cGMP. An adequate amount of substrate and protein allows the reaction to reach the Vmax. Once you have re-determined the substrate specificity (revise Fig 5D), you should retest BIPPO (Fig 5E) in the presence of cAMP and cGMP. It is very likely that you would find the same result as PDE9 and PfPDEβ (BIPPO can inhibit both cAMP and cGMP-specific PDE), as described previously

      We have repeated our assay using the exact same conditions outlined by Moss et al. This involved using a similar number of parasites, a longer incubation time of 2 hours at a higher temperature (37ºC) and with a lower starting concentration of cAMP (0.1 uM). We demonstrate that we are able to recapitulate both the Moss et al. and Vo et al. (see Supp Fig. 7B). However, we noticed that these reactions were not carried out with saturating cAMP/cGMP concentrations, since all reactions had reached 100% completion at the end of the assay whereby all substrate was hydrolysed. We therefore believe that based on our original assay, as well as the new PDE1 timecourse that we have performed (Supp Fig. 7C), that PDEs 1, 7 and 9 display predominantly cGMP hydrolysing activity, with moderate cAMP hydrolysing activity.

      We also repeated the BIPPO inhibition assay using the Moss et al. conditions, and still observe that the cGMP activity of PDE1 is the most potently inhibited of all 4 PDEs. We also see moderate inhibition of the cAMP activities of PDE1 and PDE9, suggesting that cAMP hydrolytic activity can also be inhibited. Interestingly, the cGMP hydrolytic activities of PDEs 7 & 9, which were previously inhibited using our original assay conditions, no longer appear to be inhibited. This is likely due to the longer incubation time, which masks the reduced activities of these two PDEs following treatment with BIPPO.

      The authors did not identify any PKG substrate, which is quite surprising as cAMP signaling itself could impact cGMP. Authors should show if they were able to observe enhanced cGMP levels in BIPPO-treated sample (which is expected to stimulate cGMP-specific PDEs). The author mention their inability to measure cGMP level but have they analyzed cGMP in the positive control (BIPPO-treated parasite line)? Why have they focused only on CDPK3 mutant, whereas in their phosphoproteomic data they could see other CDPKs too? It could be that other CDPK-mediated signaling differs and need PKA/PKG for activation.

      In the title, the authors have mentioned that there is a positive feedback loop between calcium release, cyclic nucleotide and lipid signaling, which is quite an extrapolation as there is no clear experimental data supporting such a positive feedback loop so the author should change the title of the paper.

      Response:

      1. As addressed in our previous response to the reviewer, PMID: 29030485 demonstrates clearly a link between cAMP signalling and PKG signalling, but does not confirm how this is mediated. The authors surmise that a cGMP-specific PDE is dysregulated (although the PDE hypothesised to be involved has since been shown to be cAMP-specific), but are similarly unable to detect changes in cGMP levels. This suggests that their model may be incomplete.

      The BIPPO treatment experiment suggested by the reviewer was already included in the original manuscript (see Fig. 4D in original manuscript, now Fig. 4E). With BIPPO treatment we are able to detect changes in cGMP levels.

      We did not deem it to be within the scope of this study to study every single other CDPK. We chose to study CDPK3, as its egress phenotype was of particular interest given its partial rescue following BIPPO treatment. We reasoned that its study may lead us to identify the signalling pathway that links BIPPO and A23187 induced signalling.

      As addressed in greater detail in our response to reviewer #2, the fact that the feedback loop appears to stimulate egress implies that it is positive.

      **Minor Comments:**

      Materials & Methods

      Explanation of parameters is not clear (Line #360-367). Phosphoproteomics with A23187 (8 micromolar) treatment in CDPK3-KO and WT, for 15, 30 and 60s at 37{degree sign}C incubation with DMSO control. Simultaneously passing the DR and CDPK3 dependency thresholds: CDPK3-dependent phosphorylation

      __Response: __We have modified the wording to make this clearer as per the reviewer’s suggestion.

      Line #368: At which WT-A23187 timepoint did the authors identify 2408 DR-up phosphosites (15s, 30s or 60s)? Or consistently in all? It should be clarified?

      __Response: __As already stated in the manuscript (see line 366 in original manuscript, now line 1047), phosphorylation sites were considered differentially regulated if at any given timepoint their log2FC surpassed the DR threshold.

      A23187 treatment of the CDPK3-KO mutant significantly increased the cAMP levels at 5 sec post-treatment, but BIPPO did not show any change. The authors concluded that BIPPO presumably does not inhibit cAMP-specific PDEs. However, the dual-specific PDEs are known to be inhibited by BIPPO, as shown recently (____https://www.biorxiv.org/content/10.1101/2021.09.21.461320v1____). Authors do confirm that BIPPO-treatment can inhibit hydrolytic activity of PfPDEbeta for cAMP as well as cGMP (Line #612). Besides, it was shown in Fig 5E that BIPPO can partially though not significantly block cAMP-specific PDE2. The statements and data conflict each other under different subtitles and need to be reconciled. Elevation of basal cAMP level in the CDPK3 mutant indicates the perturbation of cAMP signaling, however BIPPO data requires additional supportive experiments to conclude its relation with cAMP or dual-specific PDE.

      Response:

      1. The manuscript to which the reviewer refers does not use BIPPO in any of their experiments. They show that continuous treatment with zaprinast blocks parasite growth in a plaque assay, but do not test whether zaprinast specifically blocks the activity of any of the PDEs.

      Having repeated the PDE assay using the Moss et al. conditions (as outlined above), we are now able to recapitulate their findings, showing that PDEs 1, 7 and 9 can display dual hydrolytic activity while PDE2 is cAMP specific. As explained further above, we believe that our original set of experiments are more stringent than the Moss *et al. * To confirm this, we also performed an additional experiment, incubating PDE1 for varying amounts of time using our original conditions (1 uM cAMP or 10 uM cGMP, at room temperature). This revealed that PDE1 is much more efficient at hydrolysing cGMP, and only begins to display cAMP hydrolysing capacity after 4 hours of incubation.

      We also measured the inhibitory capacity of BIPPO on the PDEs using the Moss *et al. * During the longer incubation time, it seems that BIPPO is unable to inhibit PDEs 7 and 9, while with the more stringent conditions it was able to inhibit both PDEs. We reasoned that since BIPPO is unable to inhibit these PDEs fully, the residual activity over the longer incubation period would compensate for the inhibition, eventually leading to 100% hydrolysis of the cNMPs. We also see that while the cGMP hydrolysing capacity of PDE1 is completely inhibited, its cAMP hydrolysing capacity is only partially inhibited. These findings and the fact that PDE2 is not inhibited by BIPPO are in line with our experiments where we measured [cAMP] and showed that treatment with BIPPO did not lead to alterations in [cAMP].

      The method used to determine the substrate specificity of PDE 1,2,7 and 9 resulted in the hydrolytic activity of PDE2 towards cAMP, while the remaining 3 were determined as cGMP-specific. However, PDE1 and PDE9 have been reported as being dual-specific (Moss et al, 2021; Vo et al, 2020), which questions the reliability of the preferred method to characterize substrate specificity by the authors. It is also suggested to use another ELISA-based kit to double check the results.

      Response:

      As outlined above, we have repeated the assay using the conditions described by Moss et al. (lower starting concentrations of cAMP, 2 hour incubation period at 37ºC) and find that we are able to recapitulate the results of both Moss et al. and Vo et al.. However, using the Moss et al. conditions, the PDEs have hydrolysed 100% of the cyclic nucleotide, suggesting that these conditions are less stringent than the ones we used originally using higher starting concentrations of cAMP and incubating for 1 hour only at room temperature. With enzymatic assays it is always important to perform them at saturating conditions (as already suggested by the reviewer) and therefore we believe that our original conditions are more stringent than the results using the Moss et al. conditions.

      Line #607-608: Authors found PDE9 less sensitive to BIPPO-treatment and concluded PDE2 as refractory to BIPPO inhibition; however, the reduction level of activity seems similar as seen in PDE9-BIPPO treated sample? This strong statement should be replaced with a mild explanation.

      __Response: __We have tempered our wording as per the reviewer’s suggestion

      Figures and legends:

      The introductory model in Fig S1 is difficult to understand and ambiguous despite having it discussed in the text. For example, CDPK1 is placed, but only mentioned at the beginning, and the role of other CDPKs is not clear. In addition, the arrows in IP3 and PKG are confusing. The location of guanylate and adenylate cyclase is wrong, and so on... The figure should include only the egress-related signaling components to curate it. The illustration of host cell in orange color must be at the right side of the figure in connection with the apical pole of the parasite (not on the top). Figure legend should also be rearranged accordingly and citations of the underlying components should be included (see below).

      __Response: __We have modified Supp Fig. 1 as per the suggestions of reviewer#2 and #3. We have now modified the localisations of the proteins and have also removed the lines showing the cross talk between pathways. We have also highlighted to the reader that this is only a model and may not represent the true localisations of the proteins, despite our best efforts.

      In Figure 5D, would you please provide the western blot analysis of samples before and after pulling down to demonstrate the success of your immunoprecipitation assay. Mention the protein concentration in your PDE enzyme assay. Please refer to the M&M comments above to re-do the enzyme assays.

      Response:

      We have now included western blots for the pull downs of PDEs 1, 2, 7 and 9 (Supp Fig. 7A). We chose not to measure protein concentrations of samples since all experiments were performed using the same starting parasite numbers, and we do not see large differences in activities between biological replicates of the PDEs.

      Figure legend 1C: Line #194: There is no red-dotted line shown in graph! Correct it!

      __Response: __We have modified this.

      Figure 4Gi-ii: Shouldn't it be labelled i: H89-treatment and ii: A23178, respectively instead of DMSO and H89? (based on the text Line #579).

      __Response: __Our labelling of Fig. 4Gi-ii is correct as panel i parasites were pre-treated with DMSO, while panel ii parasites were pre-treated with H89. Subsequent egress assays on both parasites were then performed using A23187.

      We have modified the figures to include mention of A23187 on the X axis, and modified the figure legend to clarify pre-treatment was performed with DMSO and H89 respectively.

      Bibliography:

      Line #57 and 58: Citations must be selected properly! Carruthers and Sibley 1999 revealed the impact of Ca2+ on the microneme secretion within the context of host cell attachment and invasion, not egress as indicated in the manuscript! Similar case is also valid for the reference Wiersma et al 2004; since the roles of cyclic nucleotides were suggested for motility and invasion. Also notable in the fact that several citations describing the localization, regulation and physiological importance of cAMP and cGMP signaling mediators (PMID: 30449726 , 31235476 , 30992368 , 32191852 , 25555060 , 29030485 ) are either completely omitted or not appropriately cited in the introduction and discussion sections.

      Response:

      We have modified the citations as per the reviewer’s suggestions. We now cite Endo et al., 1987 for the first use of A23187 as an egress trigger, and Lourido, Tang and David Sibley, 2012 for the role of cGMP signalling in egress. We also cite all the GC papers when we make first mention of the GC. We have also removed the Howard et al., 2015 citation (PMID: 25555060) when referring to the fact that BIPPO/zaprinast can rescue the egress delay of ∆CDPK3 parasites.

      Grammar/Language

      Line #31: After "cAMP levels" use comma

      Response:

      We have modified this.

      36: Sentence is not clear. Does conditional deletion of all four PDEs support their important roles? If so, the role in egress of the parasite?

      Response:

      We have clarified our wording as per the reviewer’s suggestion. We state that PDEs 1 and 2 display an important role in growth since deletion of either these PDEs leads to reduced plaque growth. We have not investigated exactly what stage of the lytic cycle this is.

      40: "is a group involving" instead of "are"

      Response:

      We found no mention of “a group involving” in our original manuscript at line 40 or anywhere else in the manuscript, so we are unsure what the reviewer is referring to.

      108: isn't it "discharge of Ca++ from organelle stores to cytosol"?

      __Response: __We thank the reviewer for spotting this error. We have now modified this sentence.

      120: "was" instead of "were"

      __Response: __Since the situation we are referencing is hypothetical, then ‘were’ is the correct tense.

      Reviewer #3 (Significance (Required)):

      There is a significant amount of work that underlies this manuscript; however, from a conceptual viewpoint, the manuscript does not offer significant advancement over the current knowledge without functional validation of phosphoproteomics data. In terms of the mechanism, it is not clear whether and how lipid turnover and cAMP-PKA signaling control the egress phenotype (lack of a validated model at the end of this study).In a methodical sense, the work uses established assays, some of which require revisiting to reach robust conclusions and avoid misinterpretation.

      Compare to existing published knowledge

      A large body of work preceding this manuscript has indicated the crosstalk of cAMP, cGMP, calcium and lipid signaling cascades. This work provides a further refinement of the existing model. The article is quite interesting from a throughput screening point of view, but it clearly lacks the appropriate endorsement of the hits.

      Response:

      Please refer to our first response to reviewer #3 for our full rebuttal to these points. We respectfully disagree with the assessment that the work presented does not advance current knowledge.

      Audience

      Field specific (Apicomplexan Parasitology)

      Expertise

      Molecular Parasitology

      References

      Bailey, A. P. et al. (2015) ‘Antioxidant Role for Lipid Droplets in a Stem Cell Niche of Drosophila’, Cell. The Authors, 163(2), pp. 340–353. doi: 10.1016/j.cell.2015.09.020.

      Bullen, H. E. et al. (2016) ‘Phosphatidic Acid-Mediated Signaling Regulates Microneme Secretion in Toxoplasma Article Phosphatidic Acid-Mediated Signaling Regulates Microneme Secretion in Toxoplasma’, Cell Host & Microbe, pp. 349–360. doi: 10.1016/j.chom.2016.02.006.

      Dass, S. et al. (2021) ‘Toxoplasma LIPIN is essential in channeling host lipid fluxes through membrane biogenesis and lipid storage’, Nature Communications. Springer US, 12(1). doi: 10.1038/s41467-021-22956-w.

      Endo, T. et al. (1987) ‘Effects of Extracellular Potassium on Acid Release and Motility Initiation in Toxoplasma gondii’, The Journal of Protozoology, 34(3), pp. 291–295. doi: 10.1111/j.1550-7408.1987.tb03177.x.

      Flueck, C. et al. (2019) Phosphodiesterase beta is the master regulator of camp signalling during malaria parasite invasion, PLoS Biology. doi: 10.1371/journal.pbio.3000154.

      Howard, B. L. et al. (2015) ‘Identification of potent phosphodiesterase inhibitors that demonstrate cyclic nucleotide-dependent functions in apicomplexan parasites’, ACS Chemical Biology, 10(4), pp. 1145–1154. doi: 10.1021/cb501004q.

      Jia, Y. et al. (2017) ‘ Crosstalk between PKA and PKG controls pH ‐dependent host cell egress of Toxoplasma gondii ’, The EMBO Journal, 36(21), pp. 3250–3267. doi: 10.15252/embj.201796794.

      Katris, N. J. et al. (2020) ‘Rapid kinetics of lipid second messengers controlled by a cGMP signalling network coordinates apical complex functions in Toxoplasma tachyzoites’, bioRxiv. doi: 10.1101/2020.06.19.160341.

      Lentini, J. M. et al. (2020) ‘DALRD3 encodes a protein mutated in epileptic encephalopathy that targets arginine tRNAs for 3-methylcytosine modification’, Nature Communications. Springer US, 11(1). doi: 10.1038/s41467-020-16321-6.

      Lourido, S., Tang, K. and David Sibley, L. (2012) ‘Distinct signalling pathways control Toxoplasma egress and host-cell invasion’, EMBO Journal. Nature Publishing Group, 31(24), pp. 4524–4534. doi: 10.1038/emboj.2012.299.

      Lunghi, M. et al. (2022) ‘Pantothenate biosynthesis is critical for chronic infection by the neurotropic parasite Toxoplasma gondii’, Nature Communications. Springer US, 13(1). doi: 10.1038/s41467-022-27996-4.

      McCoy, J. M. et al. (2012) ‘TgCDPK3 Regulates Calcium-Dependent Egress of Toxoplasma gondii from Host Cells’, PLoS Pathogens, 8(12). doi: 10.1371/journal.ppat.1003066.

      Moss, W. J. et al. (2022) ‘Functional Analysis of the Expanded Phosphodiesterase Gene Family in Toxoplasma gondii Tachyzoites’, mSphere. American Society for Microbiology, 7(1). doi: 10.1128/msphere.00793-21.

      Stewart, R. J. et al. (2017) ‘Analysis of Ca2+ mediated signaling regulating Toxoplasma infectivity reveals complex relationships between key molecules’, Cellular Microbiology, 19(4). doi: 10.1111/cmi.12685.

      Vo, K. C. et al. (2020) ‘The protozoan parasite Toxoplasma gondii encodes a gamut of phosphodiesterases during its lytic cycle in human cells’, Computational and Structural Biotechnology Journal. The Author(s), 18, pp. 3861–3876. doi: 10.1016/j.csbj.2020.11.024.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary:

      Provide a short summary of the findings and key conclusions (including methodology and model system(s) where appropriate).

      In this manuscript, Dominicus et al investigate the elusive role of calcium-dependent kinase 3 during the egress of Toxoplasma gondii. Multiple functions have already been proposed for this kinase by this group including the regulation of basal calcium levels (24945436) or of a tyrosine transporter (30402958). However, one of the most puzzling phenotypes of CDPK3 deficient tachyzoites is a marked delay in egress when parasites are stimulated with a calcium ionophore that is rescued with phosphodiesterase (PDE) inhibitors. Crosstalk between, cAMP, cGMP, lipid and calcium signalling has been previously described to be important in regulating egress (26933036, 23149386, 29030485) but the role of CDPK3 in Toxoplasma is still poorly understood.

      Here the authors first take an elegant phosphoproteomic approach to identify pathways differentially regulated upon treatment with either a PDE inhibitor (BIPPO) and a calcium ionophore (A23187) in WT and CDPK3-KO parasites. Not much difference is observed between BIPPO or A23187 stimulation which is interpreted by the authors as a regulation through a feed-back loop. The authors then investigate the effect of CDPK3 deletion on lipid, cGMP and cAMP levels. The identify major changes in DAG, phospholipid, FFAs, and TAG levels as well as differences in cAMP levels but not for cGMP. Chemical inhibition of PKA leads to a similar egress timing in CDPK3-KO and WT parasites upon A23187 stimulation.

      As four PDEs appeared differentially regulated in the CDPK3-KO line upon A23187, the authors investigate the requirement of the 4 PDEs in cAMP levels. They show diverse localisation of the PDEs with specificities of PDE1, 7 and 9 for cGMP and of PDE2 for cAMP. They further show that PDE1, 7 and 9 are sensitive to BIPPO. Finally, using a conditional deletion system, they show that PDE1 and 2 are important for the lytic cycle of Toxoplasma and that PDE2 shows a slightly delayed egress following A23187 stimulation.

      Major comments:

      -Are the key conclusions convincing?

      The title is supported by the findings presented in this study. However I am not sure to understand why the authors imply a positive feed back loop. This should be clarified in the discussion of the results. The phosphoproteome analysis seems very strong and will be of interest for many groups working on egress. However, the key conclusion, i.e. that a substrate overlaps between PKG and CDPK3 is unlikely to explain the CDPK3 phenotype, seems premature to me in the absence of robustly identified substrates for both kinases.

      I am not sure there is a clear key conclusion from the lipidomic analysis and how it is used by the authors to build their model up. Major changes are observed but how could this be linked with CDPK3, particularly if cGMP levels are not affected?

      The evidence that CDPK3 is involved in cAMP homeostasis seems strong. However, the analysis of PKA inhibition is a bit less clear. The way the data is presented makes it difficult to see whether the treatment is accelerating egress of CDPK3-KO parasites or affecting both WT and CDPK3-KO lines, including both the speed and extent of egress. This is important for the interpretation of the experiment.

      The biochemical characterisation of the four PDE is interesting and seems well performed. However, PDE1 was previously shown to hydrolyse both cAMP and cGMP (https://doi.org/10.1101/2021.09.21.461320) which raises some questions about the experimental set up. Could the authors possibly discuss why they do not observe similar selectivity? Could other PDEs in the immunoprecipitate mask PDE activity? In line with this question, it is not clear what % of "hydrolytic activity (%)" means and how it was calculated. The experiments describing the selectivity of BIPPO for PDE1, 7 and 9 as well as the biological requirement of the four tested PDEs are convincing.

      -Should the authors qualify some of their claims as preliminary or speculative, or remove them altogether?

      The claim that CDPK3 affects cAMP levels seems strong however the exact links between CDPK3 activity, lipid, cGMP and cAMP signalling remain unclear and it may be important to clearly state this.

      -Would additional experiments be essential to support the claims of the paper? Request additional experiments only where necessary for the paper as it is, and do not ask authors to open new lines of experimentation.

      I think that the manuscript contains a significant amount of experiments that are of interest to scientists working on Toxoplasma egress. Requesting experiments to identify the functional link between above-mentioned pathways would be out of the scope for this work although it would considerably increase the impact of this manuscript. For example, would it be possible to test whether the CDPK3-KO line is more or less sensitive to PKG specific inhibition upon A23187 induced?

      -Are the suggested experiments realistic in terms of time and resources? It would help if you could add an estimated cost and time investment for substantial experiments.

      The above-mentioned experiment is not trivial as no specific inhibitors of PKG are available. Ensuring for specificity of the investigated phenotype would require the generation of a resistant line which would require significant work.

      -Are the data and the methods presented in such a way that they can be reproduced?

      It is not clear how the % of hydrolytic activity of the PDE has been calculated.

      -Are the experiments adequately replicated and statistical analysis adequate?

      This seems to be performed to high standards.

      Minor comments:

      -Specific experimental issues that are easily addressable.

      I do not have any comments related to minor experimental issues.

      -Are prior studies referenced appropriately?

      Most of the studies relevant for this work are cited. It is however not clear to me why some important players of the "PKG pathway" are not indicated in Fig 1H and Fig 3E, including for example UGO or SPARK.

      -Are the text and figures clear and accurate?

      While all the data shown here is impressive and well analysed, I find it difficult to read the manuscript and establish links between sections of the papers. The phosphoproteome analysis is interesting and is used to orientate the reader towards a feedback mechanism rather than a substrate overlap. But why do the authors later focus on PDEs and not on AC or CNBD, as in the end, if I understand well, there is no evidence showing a link between CDPK3-dependent phosphorylation and PDE activity upon A23187 stimulation? It is also unclear how the authors link CDPK3-dependent elevated cAMP levels with the elevated basal calcium levels they previously described. This is particularly difficult to reconcile particularly in a PKG independent manner.

      The presentation of the lipidomic analysis is also not really clear to me. Why do the authors show the global changes in phospholipids and not a more detailed analysis? As the authors focus on the PI-PLC pathway, could they detail the dynamics of phosphoinositides? I understand that lipid levels are affected in the mutant but I am not sure to understand how the authors interpret these massive changes in relationship with the function of CDPK3 and the observed phenotypes.

      Finally, the characterisation of the PDEs is an impressive piece of work but the functional link with CDPK3 is relatively unclear. It would also be important to clearly discuss the differences with previous results presented in this this preprint: https://doi.org/10.1101/2021.09.21.461320. My understanding is while the authors aim at investigating the role of CDPK3 in A23187 induced egress, the main finding related to CDPK3 is a defect in cAMP homeostasis that is not linked to A23187. Similarly, the requirements of PDE2 in cAMP homeostasis and egress is indirectly linked to CDPK3. Altogether I think that important results are presented here but divided into three main and distinct sections: the phosphoproteomic survey, the lipidomic and cAMP level investigation, and the characterisation of the four PDEs. However, the link between each section is relatively weak and the way the results are presented is somehow misleading or confusing.

      -Do you have suggestions that would help the authors improve the presentation of their data and conclusions?

      This is a very long manuscript written for specialists of this signalling pathway and I would suggest the authors to emphasise more the important results and also clearly state where links are still missing. This is obviously a complex pathway and one cannot elucidate it easily in a single manuscript.

      Significance

      -Describe the nature and significance of the advance (e.g. conceptual, technical, clinical) for the field.

      This is a technically remarkable paper using a broad range of analyses performed to a high standard.

      -Place the work in the context of the existing literature (provide references, where appropriate).

      The cross-talk between cAMP, cGMP and calcium signalling is well described in Toxoplasma and related parasites. Here the authors show that, in Toxoplasma, CDPK3 is part of this complex signalling network. One of the most important finding within this context is the role of CDPK3 in cAMP homeostasis. With this in mind, I would change the last sentence of the abstract to "In summary we uncover a feedback loop that enhances signalling during egress and links CDPK3 with several signalling pathways together."

      The genetic and biochemical analyses of the four PDEs are remarkable and highlight consistencies and inconsistencies with recently published work that would be important to discuss and will be of interest for the field.

      While I understand the studied signalling pathway is complex, I think it would be important to better describe the current model of the authors. In the discussion, the authors indicate that "the published data is not currently supported by a model that fits most experimental results." I would suggest to clarify this statement and discuss whether their work helps to reunite, correct or improve previous models.

      Could the authors also speculate about a potential role of PDE/CDPK3 in host cell invasion as cAMP signalling has be shown to be important for this process (30208022 and 29030485)?

      -State what audience might be interested in and influenced by the reported findings.

      This paper is of great interest to groups working on the regulation of egress in Toxoplasma gondii and other related apicomplexan pathogens.

      -Define your field of expertise with a few keywords to help the authors contextualize your point of view. Indicate if there are any parts of the paper that you do not have sufficient expertise to evaluate.

      I am working on the cell biology of apicomplexan parasites.

    1. ```js / Adapted from: https://github.com/openannotation/annotator/blob/v1.2.x/src/plugin/document.coffee Annotator v1.2.10 https://github.com/openannotation/annotator Copyright 2015, the Annotator project contributors. Dual licensed under the MIT and GPLv3 licenses. https://github.com/openannotation/annotator/blob/master/LICENSE /

      /* * nb. The DocumentMetadata type is renamed to avoid a conflict with the * DocumentMetadata class below. * * @typedef {import('../../types/annotator').DocumentMetadata} Metadata /

      import { normalizeURI } from '../util/url';

      /* * @typedef Link * @prop {string} link.href * @prop {string} [link.rel] * @prop {string} [link.type] /

      /* * Extension of the Metadata type with non-optional fields for dc, eprints etc. * * @typedef HTMLDocumentMetadata * @prop {string} title * @prop {Link[]} link * @prop {Record<string, string[]>} dc * @prop {Record<string, string[]>} eprints * @prop {Record<string, string[]>} facebook * @prop {Record<string, string[]>} highwire * @prop {Record<string, string[]>} prism * @prop {Record<string, string[]>} twitter * @prop {string} [favicon] * @prop {string} [documentFingerprint] /

      / * HTMLMetadata reads metadata/links from the current HTML document. */ export class HTMLMetadata { / * @param {object} [options] * @param {Document} [options.document] */ constructor(options = {}) { this.document = options.document || document; }

      /* * Returns the primary URI for the document being annotated * * @return {string} / uri() { let uri = decodeURIComponent(this._getDocumentHref());

      // Use the `link[rel=canonical]` element's href as the URL if present.
      const links = this._getLinks();
      for (let link of links) {
        if (link.rel === 'canonical') {
          uri = link.href;
        }
      }
      
      return uri;
      

      }

      / * Return metadata for the current page. * * @return {HTMLDocumentMetadata} */ getDocumentMetadata() { / @type {HTMLDocumentMetadata} */ const metadata = { title: document.title, link: [],

        dc: this._getMetaTags('name', 'dc.'),
        eprints: this._getMetaTags('name', 'eprints.'),
        facebook: this._getMetaTags('property', 'og:'),
        highwire: this._getMetaTags('name', 'citation_'),
        prism: this._getMetaTags('name', 'prism.'),
        twitter: this._getMetaTags('name', 'twitter:'),
      };
      
      const favicon = this._getFavicon();
      if (favicon) {
        metadata.favicon = favicon;
      }
      
      metadata.title = this._getTitle(metadata);
      metadata.link = this._getLinks(metadata);
      
      const dcLink = metadata.link.find(link => link.href.startsWith('urn:x-dc'));
      if (dcLink) {
        metadata.documentFingerprint = dcLink.href;
      }
      
      return metadata;
      

      }

      / * Return an array of all the content values of <meta> tags on the page * where the value of the attribute begins with <prefix>. * * @param {string} attribute * @param {string} prefix - it is interpreted as a regex * @return {Record<string,string[]>} */ _getMetaTags(attribute, prefix) { / @type {Record<string,string[]>} */ const tags = {}; for (let meta of Array.from(this.document.querySelectorAll('meta'))) { const name = meta.getAttribute(attribute); const { content } = meta; if (name && content) { const match = name.match(RegExp(^${prefix}(.+)$, 'i')); if (match) { const key = match[1].toLowerCase(); if (tags[key]) { tags[key].push(content); } else { tags[key] = [content]; } } } } return tags; }

      /* @param {HTMLDocumentMetadata} metadata / _getTitle(metadata) { if (metadata.highwire.title) { return metadata.highwire.title[0]; } else if (metadata.eprints.title) { return metadata.eprints.title[0]; } else if (metadata.prism.title) { return metadata.prism.title[0]; } else if (metadata.facebook.title) { return metadata.facebook.title[0]; } else if (metadata.twitter.title) { return metadata.twitter.title[0]; } else if (metadata.dc.title) { return metadata.dc.title[0]; } else { return this.document.title; } }

      / * Get document URIs from <link> and <meta> elements on the page. * * @param {Pick<HTMLDocumentMetadata, 'highwire'|'dc'>} [metadata] - * Dublin Core and Highwire metadata parsed from <meta> tags. * @return {Link[]} */ _getLinks(metadata = { dc: {}, highwire: {} }) { / @type {Link[]} */ const links = [{ href: this._getDocumentHref() }];

      // Extract links from `<link>` tags with certain `rel` values.
      const linkElements = Array.from(this.document.querySelectorAll('link'));
      for (let link of linkElements) {
        if (
          !['alternate', 'canonical', 'bookmark', 'shortlink'].includes(link.rel)
        ) {
          continue;
        }
      
        if (link.rel === 'alternate') {
          // Ignore RSS feed links.
          if (link.type && link.type.match(/^application\/(rss|atom)\+xml/)) {
            continue;
          }
          // Ignore alternate languages.
          if (link.hreflang) {
            continue;
          }
        }
      
        try {
          const href = this._absoluteUrl(link.href);
          links.push({ href, rel: link.rel, type: link.type });
        } catch (e) {
          // Ignore URIs which cannot be parsed.
        }
      }
      
      // Look for links in scholar metadata
      for (let name of Object.keys(metadata.highwire)) {
        const values = metadata.highwire[name];
        if (name === 'pdf_url') {
          for (let url of values) {
            try {
              links.push({
                href: this._absoluteUrl(url),
                type: 'application/pdf',
              });
            } catch (e) {
              // Ignore URIs which cannot be parsed.
            }
          }
        }
      
        // Kind of a hack to express DOI identifiers as links but it's a
        // convenient place to look them up later, and somewhat sane since
        // they don't have a type.
        if (name === 'doi') {
          for (let doi of values) {
            if (doi.slice(0, 4) !== 'doi:') {
              doi = `doi:${doi}`;
            }
            links.push({ href: doi });
          }
        }
      }
      
      // Look for links in Dublin Core data
      for (let name of Object.keys(metadata.dc)) {
        const values = metadata.dc[name];
        if (name === 'identifier') {
          for (let id of values) {
            if (id.slice(0, 4) === 'doi:') {
              links.push({ href: id });
            }
          }
        }
      }
      
      // Look for a link to identify the resource in Dublin Core metadata
      const dcRelationValues = metadata.dc['relation.ispartof'];
      const dcIdentifierValues = metadata.dc.identifier;
      if (dcRelationValues && dcIdentifierValues) {
        const dcUrnRelationComponent =
          dcRelationValues[dcRelationValues.length - 1];
        const dcUrnIdentifierComponent =
          dcIdentifierValues[dcIdentifierValues.length - 1];
        const dcUrn =
          'urn:x-dc:' +
          encodeURIComponent(dcUrnRelationComponent) +
          '/' +
          encodeURIComponent(dcUrnIdentifierComponent);
        links.push({ href: dcUrn });
      }
      
      return links;
      

      }

      _getFavicon() { let favicon = null; for (let link of Array.from(this.document.querySelectorAll('link'))) { if (['shortcut icon', 'icon'].includes(link.rel)) { try { favicon = this._absoluteUrl(link.href); } catch (e) { // Ignore URIs which cannot be parsed. } } } return favicon; }

      /* * Convert a possibly relative URI to an absolute one. This will throw an * exception if the URL cannot be parsed. * * @param {string} url / _absoluteUrl(url) { return normalizeURI(url, this.document.baseURI); }

      // Get the true URI record when it's masked via a different protocol. // This happens when an href is set with a uri using the 'blob:' protocol // but the document can set a different uri through a <base> tag. _getDocumentHref() { const { href } = this.document.location; const allowedSchemes = ['http:', 'https:', 'file:'];

      // Use the current document location if it has a recognized scheme.
      const scheme = new URL(href).protocol;
      if (allowedSchemes.includes(scheme)) {
        return href;
      }
      
      // Otherwise, try using the location specified by the <base> element.
      if (
        this.document.baseURI &&
        allowedSchemes.includes(new URL(this.document.baseURI).protocol)
      ) {
        return this.document.baseURI;
      }
      
      // Fall back to returning the document URI, even though the scheme is not
      // in the allowed list.
      return href;
      

      } } ```

    1. https://cyberzettel.com/chris-aldrich-and-his-research-on-digital-public-zettelkasten/

      This looks exciting!

      You've also nudged me to convert my burgeoning broader top level tag of "note taking" into a full fledged category (https://boffosocko.com/category/note-taking/) which shortly will contain not only the material on zettelkasten but commonplace books and other related areas.

      Usually once a tag has more than a couple hundred entries, it's time to convert it to a category. This one was long overdue.

    1. Reviewer #2 (Public Review):

      These studies investigated the identity of cells that migrate in response to stroke from the stem cell niche, the subventricular zone (SVZ). They also showed that these cells are important in the repair processes following cortical ischemia as mice who had stem cells ablated or had age-associated reduced progenitor number had less improvement in a motor task. Finally, they identify the mechanism for this progenitor-driven repair as both synaptic plasticity and angiogenesis following ischemia that is driven by the production of trophic factors most notably VEGF. The major strengths of the paper are the use of multiple promoters to drive the lineage tracing fluorescent marker. In addition to the traditional NesinCre-ER mice with a tdTomato tag, they use an Ascl-1Cre-ER mice which is in fewer progenitors but is more specific to neural progenitors and not upregulated in activated astrocytes to support their findings that the majority of migrating cells are progenitors. To further support this finding they also show the majority of cells do not express the mature astrocyte marker S100beta. The neural stem cell ablation model is the well-established GFAP-TK mouse model which uses ganciclovir to ablate neural progenitors and most importantly they show that it is working for them which increases the rigor of the study. The mechanistic studies are convincing because not only do they use a cortical window and two-photon microscopy to measure changes in the synapsis and vasculature over time but they also do gain and loss of function studies to support that VEGF is a major driver of the reparative response.

    1. 会触发: channel.basicNack(tag, false, true);, 这样会告诉rabbitmq该消息消费失败, 需要重新入队

      重试次数跟max-attempts的配置有关,并且因为网络等原因,会导致重试次数高于设定次数, 例子:图中设置为2次,实际执行4次

    1. We want to tag only a portion of the image thus the motivation of the annotation must be tagging the body of the annotation must be TextualBody containing a text describing what we see in that portion of the X-Ray image, hence the format of the annotation must be text/plain.

      Split into two sentences. I think I would write it this way:

      We want to tag only a portion of the image and thus the motivation of the Annotation must be tagging. The body of the annotation must be a TextualBody — with a format of text/plain — that contains the text of our annotation.

    1. Reviewer #3 (Public Review):

      Wong et al. developed a new versatile approach with a robust signal to track protein dynamics by inserting a tag into the endogenous loci and different properties of fluorescent dyes for conjugation. Using this approach, the authors monitor the trafficking of Fluorescent dye and Halo-tagged GluA1 with time-lapse imaging and found that neuronal stimulation induces GluA1 accumulation surrounding stimulated synapses on dendritic shafts and actin polymerization at synapses and dendrites. Furthermore, combining with pharmacological manipulations of actin polymerization or myosin activity, the authors found that actin polymerization facilitates exocytosis of GluA1 near activated synapses. The new approach may provide broad impacts upon appropriate control experiments, and the practical application of this approach to GluA1 trafficking upon neuronal activation is significant. However, there are several weaknesses, including confirmation of activity of the tagged receptors and receptor specificity mimicking endogenous LTP machinery. If the receptor tagged by the new robust approach reflects endogenous machinery, this approach will provide a big opportunity to the community as a versatile method to visualize a protein not visualized previously.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reply to the reviewers

      1. General Statements

      It is the common view of all three reviewers that we have not utilized adequate in vitro/biochemical evidence to support the idea that SATB1 protein undergoes liquid-liquid phase separation. We do agree with the reviewers that our manuscript lacks biochemical evidence to support such notion. Though we find it quite interesting and we would like to suggest for the first time in the field of chromatin organization and function, based upon the action of SATB1, that this protein does exist in at least two polypeptide isoforms (764 and 795 amino acids long) which display different phase separation propensity and therefore confer different actions in regulating the (patho)physiological properties of a murine T cell.

      Every single research group that works on SATB1, considered so far only a single protein isoform, that is, the shorter isoform of 764 amino acids and no tools, such as isoform-specific antibodies have been developed to discriminate the two isoforms and thus being able to assign unique functions to each isoform. We do understand that such a report, suggesting the presence of two protein isoforms, with potentially quite diverse functions, would question (not necessarily by the authors of this manuscript, since no such comment is included in our manuscript) the conclusions drawn in the literature assigning all biochemical properties to a single, short isoform of SATB1. Moreover, all the genetically modified mice that have been analyzed so far (including our group), deleted both Satb1 isoforms. Our future research approaches should, from now on, consider unraveling the isoform-specific functions of SATB1 and their involvement in physiology and disease. This could also deem useful to explain the quite diverse, both positive and negative effects of SATB1 in transcription regulation. Another major objection of the reviewers was that we should provide cumulative supporting evidence for the existence of the long SATB1 isoform, or at least evaluate the specificity of our custom-made antibody.

      Taking under consideration the aforementioned constructive criticism of the three reviewers we would like to perform (most of the suggested experiments have already been performed) additional experiments to support our claims in the manuscript. These experiments are described below as a point-by-point reply to each point raised by the reviewers.

      In line with the aforementioned rationale, we propose the title of our manuscript to change into “Two SATB1 isoforms display different phase separation propensity”, if our manuscript is considered for publication.

      1. Description of the planned revisions

      **Reviewer #1**:

      4) Lack of in vitro reconstitution experiments with purified long and short SATB1

      **PLANNED EXPERIMENT #1**

      We do realize this shortcoming of our work. We have to note that purifying recombinant SATB1 protein is quite a challenging task, yet we 1. cloned both Satb1 cDNAs for the long and short isoforms, 2. we successfully expressed both proteins in great quantity and quality and we are willing to perform these experiments if our work is considered for publication.

      This proposed experiment has also been requested by Reviewers #2 and #3.

      **Reviewer #2**:

      1. Moreover, an important and direct experiment would be to clone the long isoform in a suitable vector and overexpress in the cell line (as done for the canonical isoform in Supp Fig 1a). This would unequivocally show the efficacy of the antibody and thus the following usage of the same for various assays.

      **PLANNED EXPERIMENT #2**

      This is a great suggestion. We have cloned the long and short Satb1 cDNAs in pEGFP-C1 vector. We will transfect these plasmids in NIH 3T3 fibroblasts and we will perform Western blot analysis, utilizing the antibody raised against the extra 31 amino acids long peptide present only in the long SATB1 isoform, for the following samples: 1. NIH-3T3 whole cell protein extracts, 2. protein extracts from NIH 3T3 fibroblasts transiently transfected with the pEGFP-C1 plasmid, 3. protein extracts from NIH 3T3 fibroblasts transiently transfected with the pEGFP-long_Satb1_ plasmid and 4. protein extracts from NIH 3T3 fibroblasts transiently transfected with the pEGFP-short_Satb1_ plasmid.

      This experiment will consist another proof regarding the specificity of the antibody raised against the extra 31 amino acids long peptide present only in the long SATB1 isoform.

      **Minor comments:**

      1. On pg 6, related to Figure 1, the authors mention 'It should also be noted that when investigating the SATB1 protein levels, we have to bear in mind that the antibodies targeting the N-terminus of SATB1 protein cannot discriminate between the short and long isoforms'. The authors reason that their sizes are too close. It is indeed possible, and widely studied in biochemistry to assess various factors on protein migration (such as PTMs). The authors should validate this aspect (as it is important as per their premise) and perform separation based on charge as well and also use a commercial antibody to validate the same.

      (Experiments already performed)

      We have adapted the text so that it does not imply that the two isoforms cannot be separated by size. This part in lines 102-107 then reads: “It should also be noted that when investigating the SATB1 protein levels, we have to bear in mind that the antibodies targeting the N-terminus of SATB1 protein cannot discriminate between the short and long isoforms, thus we can only compare the amount of the long SATB1 isoform to the total SATB1 protein levels in vivo conditions. To overcome this limitation and to specifically validate the presence of the long SATB1 protein isoform in primary murine T cells, we designed a serial immunodepletion-based experiment (Fig. 1e, Supplementary Fig. 1a).”

      Moreover, in the revised version of the manuscript we now provide a number of additional proofs supporting the presence of the long isoform and also the specificity of the long isoform-specific antibody. As evident in the text cited above, in the revised Fig. 1e,f and revised Supplementary Fig. 1a,b; we present two immunodepletion experiments which should alone address the Reviewer’s concerns. Moreover, we added Supplementary Fig. 1c; demonstrating that the long isoform-specific antibody does not detect any protein in cells with conditionally depleted SATB1 (Satb1_fl/fl_Cd4-Cre+), supporting its specificity. The custom-made and publicly available antibodies targeting all SATB1 isoforms were also verified in Supplementary Fig. 1d. Moreover, the long isoform and all isoform antibodies display similar localization in the nucleus (Supplementary Fig. 1e; their co-localization based on super-resolution microscopy is also quantified in Supplementary Fig. 5a).

      In our accompanying revised manuscript Zelenka et al., 2022 (https://doi.org/10.1101/2021.07.09.451769), we will provide yet another piece of evidence, consisting of bacterially expressed short and long SATB1 protein isoforms detected by western blot using either the long isoform-specific or the non-selective all SATB1 isoform antibodies.

      **PLANNED EXPERIMENT #3**

      Although we think that in the revised version of the manuscript, we have provided enough proof about the existence of the long isoform in primary murine thymocytes we would like to try the following approach as suggested by this Reviewer.

      The pI of the two SATB1 isoform is quite similar. The pI of the short SATB1 isoform is 6.09 and for the long SATB1 isoform is 6.18. We will perform 2D PAGE coupled to Western blotting utilizing the antibodies detecting the long and all SATB1 isoforms. Given the fact that both isoforms are post-translationally modified to a various degree, it will be extremely difficult to discriminate between the long and short unmodified versus the long and short post-translationally modified proteins especially in the absence of a specific antibody only for the short isoform.

      **Reviewer #3**

      1. Hexanediol is another assay frequently used in phase-separation studies. However, hexanediol has many deleterious effects on the cell, even at a fraction of the concentration normally used in phase-separation studies. Authors should show controls of cell viability, control proteins that do not phase-separate, etc. See https://www.jbc.org/article/S0021-9258(21)00027-2/fulltext.

      Secondly, hexanediol treatment should cause phase-separated protein aggregates to disperse. It is difficult to determine from the images whether or not the aggregates actually disperse or there is just less protein. In any case, small aggregates remain even after treatment, and this appears different from most other hexanediol experiments reported in the literature where the signals become more dispersed and uniform. This is likely because the samples are fixed.

      One of the main features of using hexanediol in phase-separation is to show that upon washout, LLPS aggregates can reform. Because the cells are fixed, the critical aspect of this assay is not performed. A washout and LLPS recovery would control for cell viability issues described above and would provide the opportunity to show that total SATB1 protein levels did not change, but its distribution did, which is the essence of this assay in the context of LLPS. This review from the Tjian group is very informative and may be a good resource:

      http://genesdev.cshlp.org/content/33/23-24/1619

      In line with our reply to point #1 of this Reviewer (page 26 of this document), we should again emphasize that we utilized the hexanediol treatment in primary murine developing T cells as this is the only way to investigate the properties of SATB1 speckles under physiological conditions. This also explains why some small insoluble structure remains after the hexanediol treatment. Note that under physiological conditions, there is a contribution of several protein variants (such as differential PTMs) out of which some will tend to form more stable structures while others could undergo LLPS. It is not clear how the washout experiment could be applied in the primary cell conditions that include cell fixation as the heterogeneity and big variation among cells would make such data analysis highly unreliable.

      **PLANNED EXPERIMENT #1**

      As we answered to point #4 of Reviewer 1 (page 2), we propose the following experiment. Although the purification of recombinant SATB1 protein is quite a challenging task, yet we 1. cloned both Satb1 cDNAs for the long and short isoforms, 2. we successfully expressed both proteins in great quantity and quality and we are willing to perform in vitro reconstitution experiments if our work is considered for publication.

      1. The major difference between the long and short isoform of SATB1 is the 31aa segment within the IDR. However the authors find that neither the long or short isoform SATB1 forms LLPS aggregates, and the IDR alone forms aggregates in the cytoplasm (Fig5) but they do not respond to Cry2 light activation. When forced to localize to the nucleus, it does not form aggregates as well (Fig6). The short isoform also did not form any aggregates. These results seem to argue against any isoform specific phase-separation. This experiment seems critical for the story, yet it does not support their overall conclusions. The authors might consider using a different cell line or perhaps do an in vitro assay using purified protein.

      I am not certain what to make of the cytoplasmic aggregation, which appears to not form upon localization to the nucleus. Because of this, it is difficult to place weight on the significance of the S635A mutation and the role that a phosphorylation of SATB1 contributes to phase-separation, let alone function There are many additional points of concern, but the ones listed above are perhaps the most significant in terms of the overall conclusions of the paper.

      In Fig. 5c we show that the full length long SATB1 isoform often aggregates unlike the short isoform. These data are accompanied with the results for the IDR region, where the situation is even more obvious (Fig. 5f,g). However, in the latter, we have to bear in mind the absence of the multivalent N-terminal part of the protein which seems to be essential for the overall phase behavior of the protein as indicated in Fig. 4b,c.

      **PLANNED EXPERIMENT #1**

      To further support LLPS of SATB1, we are considering performing the following in vitro experiment, as we answered to point #4 of Reviewer 1 (page 2). Although the purification of recombinant SATB1 protein is quite a challenging task, yet we 1. cloned both Satb1 cDNAs for the long and short isoforms, 2. we successfully expressed both proteins in great quantity and quality and we are willing to perform in vitro reconstitution experiments if our work is considered for publication.

      1. Description of the revisions that have already been incorporated in the transferred manuscript

      **Reviewer #1 (Evidence, reproducibility and clarity)**:

      This paper looks at an important nuclear matrix protein SATB1, which is a well known global chromatin organizer and help chromatin loop attach to the nuclear matrix. The paper starts with identification of novel short and long form of SATB1. Both the isoform consist of a prion like low complexity domains, but the long isoform additionally contain an extra EPF domain next the Prion like low complexity domain. The paper reports that in murine cells the long isoform is 3-4 fold more abundant than the short isoform. By using STED microscopy they show SATB1 foci lie next to transcription sites in the nucleus. They conclude by looking at the spherical shape of the SATB1 foci and the susceptibility of SATB1 staining after 1,6 hexanediol treatment that SATB1 forms the small foci in the nucleus due to LLPS. The authors also use RAMAN spectroscopy to conclude a change in nuclear chemical space in absence of SATB1 but without much explanation about which chemical bond or nuclear sub structure change correspond to the change in principal component analysis from Raman spectroscopy. The authors use the light inducible aggregation cry2 tag with the PrD domain of SATB1 and compare it with the Cry2-FUS-LC domain to conclude that the SATB1 LC domain can undergo LLPS. The authors hint at involvement of RNA and also DNA in the LLPS of the SATB1 but without going into any detail. Reviewer: The paper reports that in murine cells the long isoform is 3-4 fold more abundant than the short isoform.

      Actually, in page 5 (lines 94-96) of the manuscript we write: “We confirmed that in murine thymocytes the steady state mRNA levels of the short Satb1 transcripts were about 3-5 fold more abundant compared to the steady state mRNA levels of the long Satb1 transcripts (Fig. 1d).” Although the steady state mRNA levels of the long isoform are less abundant compared to the shorter isoforms, the long isoform protein levels are almost comparable to the short isoform as deduced based on immunofluorescence experiments. Moreover, Using our two immunodepletion experiments we quantified the difference, estimating the long isoform being 1.5× to 2.62× less abundant than the short isoform (Fig. 1f and Supplementary Fig. 1b; compare lanes 2 & 3 at the lower panel). • Regarding the RAMAN spectroscopy experiments please see Minor Comment #1 of this Reviewer (page 10).

      The key conclusions of the paper are- A) SATB1 undergoes LLPS. But this conclusion is drawn after correlative experiments as detailed below-

      This conclusion is indeed made based on correlative experiments only for the primary murine T cells, which do not allow for any targeted experiments. However, the use of in vitro cell lines allowed us to validate these findings using the optogenetic approaches, utilizing additional experimentation.

      1) observation of spherical punctae by STED-which could also seem spherical due to their small size. The resolution limit achieved by the STED microscopy used in this paper is not determined or mentioned clearly.

      In the revised version of the manuscript, we have specified the resolution of our systems, for STED in Lines 745-746: ”This system enables super-resolution imaging with 35 nm lateral and 130 nm axial resolution.” and for SIM in Lines 759-761: “Images were acquired over the majority of the cell volume in z-dimension with 15 raw images per plane (five phases, three angles), providing ~120-135 nm lateral and ~340-350 nm axial resolution for 488/568 nm lasers, respectively.” The size of the observed speckles is thus above the resolution limit with sizes ranging between 40-80 nm.

      The resolution of our systems is routinely verified by the following methods: The resolution of our OMX (SIM-3D) system was tested using ARGO-SIM slide containing a pattern of 36 µm long lines with gradually increasing spacing ranging from (left to right) 0 to 390 nm, with a step of 30 nm (Fig. 1 below). Our SIM system was able to clearly resolve two lines separated by 120 nm.

      2) No live cell FRAP experiment with fluorescent SATB1 long or short isoform to show that these foci are liquid like

      We did perform FRAP experiments for the SATB1 N-terminus optogenetic construct as demonstrated in Fig. 4f. We did not perform FRAP in the primary murine T cells as this is not technically feasible without creating a new mouse line with fluorescently labeled protein. In the revised version of the manuscript, we additionally performed FRAP experiments for the full length short and long isoform of SATB1 labeled with EGFP and transfected into the NIH-3T3 cell line (Supplementary Figure 6f).

      5) LLPS is strongly coupled to the cellular concentration of the proteins. Authors should quantify the cellular concentration of the long and short isoform in the cells.

      We did consider protein concentration in our analyses of optogenetic constructs in Fig. 4b,d,e and Supplementary Fig. 6a,b,c. Quantifying the physiological cellular concentration of short and long SATB1 protein isoforms in primary T cells is impossible due to the inherent inability to discriminate between the isoforms by two antibodies, in the absence of Satb1 isoform-specific knockout mice.

      However, an approximation of the cellular concentration can be obtained from our immunodepletion experiments. On top of the original immunodepletion experiment that we now present in Supplementary Fig. 1a,b; in the revised version of the manuscript we have repeated the experiment in Fig. 1e,f. Comparison of the two bands for the long and short SATB1 isoforms in the lower panel of the western blot figures suggest that the long SATB1 isoform protein levels are 1.5× to 2.62× less abundant than the short isoform, according to the original and new immunodepletion experiment, respectively. This is now also included in the main text in Lines 110-116: “This experiment can also be used for approximation of the cellular protein levels of SATB1 isoforms in primary murine thymocytes. Comparison of the two bands for long (lane 2) and short SATB1 (lane 3) isoform in the lower panel of Fig. 1f and Supplementary Fig. 1b, suggests that the long SATB1 isoform protein levels may be about 1.5× to 2.62× less abundant than the short isoform, according to the two replicates of our immunodepletion experiment, respectively.”

      Major conclusion B)- SATB1 regulates transcription and splicing.

      This was also shown previously and in this paper they show the close proximity of the transcription site and SATB1 foci by microscopy. Hexanediol treatment which lead to loss of colocalization between FU foci and SATB1 is also taken as an evidence in regulation of transcription is not right as the transcription foci itself can be dissolved using 1,6 Hexanediol. Although the rate of transcription is not measured quantitatively.

      As mentioned in comment #3 (page 29) of this Reviewer, unfortunately there is no better tool to investigate these questions in primary cells than using microscopy approaches in conjunction with hexanediol treatment. However, we should also note that there is an accompanying manuscript from our group that is currently being under revision in another journal (preprint available: Zelenka et al., 2021; https://doi.org/10.1101/2021.07.09.451769). In the preprint manuscript, we showed that: 1. the long SATB1 isoform binding sites have increased chromatin accessibility than what expected by chance (Fig. 3b), 2. there is a drop in chromatin accessibility at SATB1 binding sites in Satb1 cKO mouse (Fig. 3c) and 3. this drop in chromatin accessibility is especially evident at the transcription start sites of genes (Supplementary Fig. 1i)

      We believe that, together these data suggest a direct involvement of SATB1 in transcription regulation. Also note the vast transcriptional deregulation that occurs in Satb1 cKO T cells, affecting the expression of nearly 2000 genes (Fig. 2f, this revised manuscript). That is why we believe that the co-localization analysis, using super-resolution microscopy, presented in Fig. 2c and quantified in Fig. 3g, represents a nice additional support to our claims. Moreover, in the revised version of the manuscript we now present a positive correlation between SATB1 binding and deregulation of splicing (Supplementary Fig. 4d) which also supports its direct involvement in the regulation of transcriptional and co-transcriptional processes.

      In the revised version of the manuscript we have made this clear in Lines 182-194: “Satb1 cKO animals display severely impaired T cell development associated with largely deregulated transcriptional programs as previously documented19,37,38. In our accompanying manuscript19, we have demonstrated that long SATB1 isoform-specific binding sites (GSE17344619) were associated with increased chromatin accessibility compared to randomly shuffled binding sites (i.e. what expected by chance), with a visible drop in chromatin accessibility in Satb1 cKO. Moreover, the drop in chromatin accessibility was especially evident at the transcription start site of genes, suggesting that the long SATB1 isoform is directly involved in transcriptional regulation. Consistent with these findings and with SATB1’s nuclear localization at sites of active transcription, we identified a vast transcriptional deregulation in Satb1 cKO with 1,641 (922 down-regulated, 719 up-regulated) differentially expressed genes (Fig. 2f). Specific examples of transcriptionally deregulated genes underlying SATB1-dependent regulation are provided in our accompanying manuscript19. Additionally, there were 2,014 genes with altered splicing efficiency (Supplementary Fig. 4d-e; Supplementary File 3-4). We should also note that the extent of splicing deregulation was directly correlated with long SATB1 isoform binding (Supplementary Fig. 4d).”

      Major conclusion C)-Post transcriptional modification is important for SATB1 function.

      This point is just barely touched upon in the last figure of the paper

      We would not call the identification of the novel phosphorylation site as a main conclusion of our manuscript. Though, it is already known that posttranslational modifications of SATB1 are important for its function as they can function as a molecular switch rendering SATB1 into either an activator or a repressor (Kumar et al., 2006; https://doi.org/10.1016/j.molcel.2006.03.010).

      In the revised manuscript, we support the effect of serine phosphorylation on the DNA binding capacity of SATB1 by another experiment. We have performed DNA affinity purification experiments utilizing primary thymocyte nuclear extracts treated with phosphatase (Supplementary Fig. 7b). We found that SATB1’s capacity to bind DNA (RHS6 hypersensitive site of the TH2 LCR) is lost upon treatment with phosphatase (Supplementary Fig. 7c). These results are in line with the data presented in Supplementary Fig. 7d, indicating the lost ability of SATB1 to bind DNA upon mutating the discovered phosphorylation site S635. Given the importance of posttranslational modifications of proteins on LLPS, we found it relevant to include it in our manuscript. Even more so, when we identified SATB1 aggregation, upon mutation of this phospho site (Fig. 6d).

      Overall I find that the major conclusion-point A and B, is based on very indirect experiments and needs much more convincing data and the role of SATB1 LLPS in cells should be demonstrated more rigorously. And conclusion C is barely described and needs a lot more cell biological and genetic evidence.

      One of the major assets of our work is that most of our data are based on the analysis of primary murine T cells and thus investigating the biological roles of the endogenous SATB1 protein, under physiological conditions. We apologize that we did not make it clear to this Reviewer, that our system has certain inherent limitations due to the utilization of primary cells.

      I do not recommend publishing the paper in current state. The story needs much more experiment to convincingly prove the major conclusions. Further, the MS needs more careful thinking and presentation to make it streamlined.

      We hope that in the revised version we have significantly improved the quality of our manuscript by implementing the suggested changes.

      Minor comments: One of the major flaw of the paper is the use too many techniques without proper explanation. E.g. use of STED and RAMAN microscopy need controls and explanation on what is being quantified. The use of Raman microscopy to quantify the nuclear environment of nucleus is not related to the chromatin organization or LLPS of SATB1 at all. And no information is provided at all which aspect of nuclear organization is being measured in Raman and what it means for the LLPS of SATB1.

      We do provide quite a thorough explanation of Raman spectroscopy and the underlying quantification in Lines 224-231: “we employed Raman spectroscopy, a non-invasive label-free approach, which is able to detect changes in chemical bonding. Raman spectroscopy was already used in many biological studies, such as to predict global transcriptomic profiles from living cells42, and also in research of protein LLPS and aggregation43–47. Thus we reasoned that it may also be used to study phase separation in primary T cells. We measured Raman spectra in primary thymocytes derived from both WT and Satb1 cKO animals and compared them with spectra from cells upon 1,6-hexanediol treatment. Principal component analysis of the resulting Raman spectra clustered the treated and non-treated Satb1 cKO cells together, while the WT cells clustered separately (Fig. 3h).” We also do provide controls as the method was performed on both treated and untreated WT and Satb1 cKO cells.

      Regarding the RAMAN spectroscopy experiments we now provide more information on the changes of chemical bonds altered between wild type and Satb1 cKO thymocytes. Following principal component analysis, we have extracted the two main principal components that were used for the clustering of our data. The differences are presented in Supplementary Fig. 5d.

      We do realize that RAMAN spectroscopy, although a quite novel approach utilized to study LLPS, has not been used to study LLPS in live cells. If deemed proper we are willing to avoid presenting these results in this manuscript.

      Similarly for Hexanediol treatment, duration of treatment is missing. Hexanediol can also dissolve the liquid like transcription foci. And hence a decrease in correlation between SATB1 foci and FU foci cannot be taken as a measure of SATB1 foci connection to transcription alone

      The duration of hexanediol treatment was 5 minutes as presented in Line 724 and in the revised version of the manuscript also in Lines 1206-1207. We should also note that additionally, we performed experiments with different hexanediol concentrations and timing varying from 1 minute to 10 minutes with results consistent with the data presented.

      It is not very clear how many times the STED or Raman microscopy is done on how many samples and biological replicates. Similarly for RNA sequencing number of samples and description of controls are missing. Also if the sequencing data is made publicly available is not clear.

      Data availability is clearly stated in Lines 506-509: “RNA-seq experiments and SATB1 binding sites are deposited in Gene Expression Omnibus database under accession number GSE173470 and GSE173446, respectively. The other datasets generated and/or analyzed during the current study are available upon request.”

      The Reviewer’s token is “wjwtmeeeppovzqx”.

      RNA sequencing was performed in a biological triplicate for each genotype as stated in the GEO repository and now also in Line 566 of the revised manuscript.

      In Lines 180-181, we also state that it was performed on Satb1 cKO animals and WT mice as a control: “we performed stranded-total-RNA-seq experiments in wild type (WT) and Satb1fl/flCd4-Cre+ (Satb1 cKO) murine thymocytes”.

      In Lines 739-740, we now also state that all imaging approaches were performed on at least two biological replicates (different mice) and please also note the fact that all findings were based on data from both STED and 3D-SIM methods, allowing to minimize detection of artifacts. In the Raman spectroscopy figure, each point represents measurements from an individual cell and for each condition we used 2-5 biological replicates (Lines 831-832 & Line 1169).

      Similarly, in Lines 129-132 we provided a quite detailed description of differences between STED and 3D-SIM, even though these techniques are not that rare as Raman spectroscopy in biology research.

      Additional control is needed to report the resolution limit of Superresolution techniques-STED and 3D-SIM systems used by them.

      We have already provided this information in our reply to comment #1 of this Reviewer (pages 6-7): In the revised version of the manuscript, we have specified the resolution of our systems, for STED in Lines 745-746: ”This system enables super-resolution imaging with 35 nm lateral and 130 nm axial resolution.” and for SIM in Lines 759-761: “Images were acquired over the majority of the cell volume in z-dimension with 15 raw images per plane (five phases, three angles), providing ~120-135 nm lateral and ~340-350 nm axial resolution for 488/568 nm lasers, respectively.” The resolution of our systems is routinely verified by the following methods: The resolution of our OMX (SIM-3D) system was tested using ARGO-SIM slide containing a pattern of 36 µm long lines with gradually increasing spacing ranging from (left to right) 0 to 390 nm, with a step of 30 nm (Fig. 1 below). Our SIM system was able to clearly resolve two lines separated by 120 nm.

      Would be very helpful if the zonation was plotted for the FluoroUridine (FU) also to show that Zone1 (heterochromatin) is completely depleted of FU, and is present in other regions.

      In the revised version of the manuscript, we performed the suggested analysis and in Supplementary Fig. 3a we now show that indeed FU is significantly less localized to Zone 1 (heterochromatin) and has the most abundant localization in Zones 3 and 4, similar to the localization of SATB1 protein, as demonstrated in Fig. 2b.

      Scale bar needed figure 3d

      In the revised version of the manuscript, we included scale bars which are both 0.5 µm (line 1213).

      Perfectly rounded SATB1 foci- this does not mean LLPS. For LLPs measurement, protein condensate dynamics measurement by FRAP or fusion experiments is required. What is the size of condensates? and cellular concentration of SATB1? Will SATB1 undergo LLPS in vitro at similar concentrations? does SATB1 interact with DNA or RNA to undergo LLPS ?

      We toned down this sentence which now reads: “Here we demonstrated its connection to transcription and found that it forms spherical speckles (Fig. 1g), markedly resembling phase separated transcriptional condensates. (Lines 200-202)”.

      Moreover, as explained in earlier replies to comments of this Reviewer, we cannot perform FRAP on primary murine T cells without generating a new mouse line. We did, however, use FRAP and other in vitro approaches including visualization of droplet fusion in ex vivo experiments utilizing cell lines. Moreover, we are willing to demonstrate the LLPS properties of SATB1 on in vitro purified SATB1 protein as indicated in the suggested experiment of Point#4 (page 2).

      After careful reading of the MS I conclude that the main conclusions of the paper are very preliminary and need much more detailed experiments. So does not qualify to get published at all at this stage.

      **Reviewer #1 (Significance)**:

      The present manuscript tries to connect the phase separation of SATB1 to understanding the mechanism of SATB1 function in cells. One of the major hallmarks of phase separation is dynamic, liquid-like behaviour and in absence of these measurements, it is very difficult to say that the current manuscript has made any contribution to showing that SATB1 can phase separate.

      The presence of 2 isoforms of SATB1 is a novel finding and the paper could have focused more on this. E.g. elucidate expression of the isoform during thymocyte development and maturation.

      As a reviewer my expertise are cell biology experiments, microscopy, in vitro reconstitution assays, RNA binding proteins, RNA and RBP condensate formation. And I feel that the reconstitution experiments are an important tool for understanding phase behaviour of proteins and also to gauge if this behaviour can occur or not in cellular concentration and conditions.

      I do not have sufficient expertise in Raman microscopy and hence the information provided in the MS on this part was not enough to understand the experiment and conclusions drawn from it.

      **Reviewer #2 (Evidence, reproducibility and clarity)**:

      The authors have reported the existence of a 'long' SATB1 isoform which also undergoes LLPS. The authors tried to draw multiple comparisons and pointed out distinction between phase properties of SATB1 isoforms. The authors also touch upon two functional roles of SATB1. Although a wide array of assays are used, the data presented and hence the manuscript makes multiple transitions into disparate hypotheses without diving deep into a single hypothesis. As a result, the connections drawn are unclear, and do not converge at best. The authors have used number of techniques, however, the results do not support their conclusions and they appear hastily drawn. It is not clear why the authors jump from one context to the other, discussing LLPS first, then transcription, splicing, post-translational modification and finally cancer. The link between all of these isn't clear and not fully supported by data. It appears that the authors wish to focus on Satb1's physiological role in development, hence the data on breast cancer is confusing. Thus, this work suffers from multiple pitfalls. Specific comments are given below:

      Major comments 1. Importantly, in Fig 1d, there is no statistics shown. There is no mention of number of replicates as well in the legends. Proper statistical evaluation is critical for interpreting this result.

      Please note that Fig. 1d only serves as a control to the sequencing experiment in Fig. 1b. In Line 566, we now state that for the RNA-seq: “A biological triplicate was used for each genotype.” To validate these data, we further designed a RT-qPCR experiment which was performed on three technical replicates from a male and female mouse. We now state this in Line 636. For the low number of samples, statistical tests are not accurate but we still added t test into the figure Fig. 1d and specified it also in the figure legend in Line 1169-1170.

      1. Figure 1f presents one of the weakest evidences in the manuscript. There are a number of corrections needed. Firstly, being their major and only validation figure for their custom antibody, the immunoblot is not clean, bands are fuzzy. Importantly, as the authors claim that the antibody is highly specific to 'long' SATB1, after the IP there should be only a single band (like input) of Satb1 long. But that does not seem to be the case, rather an array of bands are visible below (lane 2 top panel). This could easily mean that the shorter isoforms or non-specific protein bands are also pulled down with the 'long' form specific antibody. Therefore, raising a critical concern regarding the specificity of the antibody.

      • The long antibody was raised in mice inoculated with the extra peptide present in the long isoform only. Therefore, the capacity of this antibody precipitating the shorter isoforms, which do not express the sequence of the extra peptide (EP, Figure 1a) in not possible. • We have repeated the immunodepletion experiment and we now provide the results in Fig. 1f and Supplementary Fig. 1b. The western blot in Fig. 1f is now cleaner and supports quite convincingly the presence of a long SATB1 isoform. Given the lack of isoform-specific knockouts which we could utilize to immunoprecipitate or detect the different isoforms in a single cell (or cell population), the utilized approach of immunodepletion and subsequent western blotting is the approach we thought of implementing. • As shown in Fig. 1f and Supplementary Figure 1b, the long isoform SATB1 antibody has the capacity to recognize the long isoform in murine thymocyte protein extracts but not the short SATB1 isoform (please compare lane 3 in the two western blots utilizing either the antibody for the long isoform -top panel - or the antibody that detects both isoforms (lower panel). • We have performed Immunofluorescence experiments utilizing the antibody detecting the long SATB1 isoform in thymocytes isolated from either C57BL/6 or Satb1 cKO mice. The antibody is specific to the SATB1 protein since there is no signal in immunofluorescence experiments utilizing the knockout cells (Supplementary Figure 1c). • We have performed Immunofluorescence experiments utilizing thymocytes and the antibody detecting the long SATB1 or a commercially available antibody detecting all SATB1 isoforms. The pattern of SATB1 subnuclear localization is similar for both antibodies (Supplementary Figure 1e). • In our accompanying revised manuscript Zelenka et al., 2022 (https://doi.org/10.1101/2021.07.09.451769), we provide yet another piece of evidence, consisting of bacterially expressed short and long SATB1 protein isoforms detected by western blot using either the long isoform-specific or the non-selective all SATB1 isoforms antibodies. • Regarding the additional bands detected in the immunoprecipitation experiment presented in the original Supplementary Figure 1b (lane 2), it is not surprising that additional bands appear in a sample of protein extracts that is used for several hours for the immunoprecipitation experiments, while the “input” sample simply denotes protein extract that is frozen at -80oC right after the preparation of protein extracts until use. It is well-established that SATB1 is the target of proteases which might as well be active during the immunoprecipitation steps (2 consecutive immunoprecipitation steps take place). Therefore, the immunoprecipitated material cannot necessarily be a copy of the input material displaying a single protein band even if protease inhibitors are included in the buffers.

      Taken together the experiments described here we showed that the antibody raised against the extra 31 aa long peptide, present only in the long SATB1 isoform, is specific for this isoform.

      1. Related to Fig. 2 a, the authors state on Pg 5, '....the euchromatin and interchromatin regions (zones 3 & 4, Fig. 2a, b).' Although the DAPI correlation seems clear, there is no mention on how they reached the above said correlation. They should at least show a parallel speckle staining for HP1 or signature modification such as H3K4me9 STEDs for making supporting such a claim. DAPI alone is not sufficient. The authors should rectify the text thoroughly for many such interpretations without validation/reference or provide relevant data.

      This is a great suggestion we have again taken under consideration and we added the following experiments and the appropriate changes in the revised version of our manuscript. • We modified the text and added a reference to Miron et al., 2020 (https://doi.org/10.1126/sciadv.aba8811) supporting our claims regarding SATB1 localization in relation to DAPI staining. • We have also added new microscopy images for HP1, H3K4me3 and fibrillarin staining and quantified the localization of FU-stained sites of active transcription in nuclear zones, to further support our claims. • This whole modified part in Lines 139-167 then reads: “ “The quantification of SATB1 speckles in four nuclear zones, derived based on the relative intensity of DAPI staining, highlighted the localization of SATB1 mainly to the regions with medium to low DAPI staining (zones 3 & 4, Fig. 2a, b). A similar distribution of the SATB1 signal could also be seen from the fluorocytogram of the pixel-based colocalization analysis between the SATB1 and DAPI signals (Supplementary Fig. 2a). SATB1’s preference to localize outside heterochromatin regions was supported by its negative correlation with HP1β staining (Supplementary Fig. 2b). Localization of SATB1 speckles detected by antibodies targeting all SATB1 isoforms and/or only the long SATB1 isoform, revealed a significant difference in the heterochromatin areas (zone 1, Fig. 2b), where the long isoform was less frequently present (see also Fig. 2a and Fig. 3c). Although, this could indicate a potential difference in localization between the two isoforms, due to the inherent difficulty to distinguish the two based on antibody staining, we refrain to draw any conclusions. The prevailing localization of SATB1 corresponded with the localization of RNA-associated and nuclear scaffold factors, architectural proteins such as CTCF and cohesin, and generally features associated with euchromatin and active transcription32. This was also supported by colocalization of SATB1 with H3K4me3 histone mark (Supplementary Fig. 2c), which is known to be associated with transcriptionally active/poised chromatin. Given the localization of SATB1 to the nuclear zones with estimated transcriptional activity32 (Fig. 2b, zone 3), we investigated the potential association between SATB1 and transcription. We unraveled the localization of SATB1 isoforms and the sites of active transcription labeled with 5-fluorouridine. Sites of active transcription displayed a significant enrichment in the nuclear zones 3 & 4 (Supplementary Fig. 3a), similar to SATB1. As detected by fibrillarin staining, SATB1 also colocalized with nucleoli which are associated with active transcription and RNA presence (Supplementary Fig. 3b). Moreover, we found that the SATB1 signal was found in close proximity to nascent transcripts as detected by the STED microscopy (Fig. 2c). Similarly, the 3D-SIM approach indicated that even SATB1 speckles that appeared not to be in proximity with FU-labeled sites in one z-stack, were found in proximity in another z-stack (Supplementary Fig. 3c). Additionally, a pixel-based colocalization of SATB1 and sites of active transcription is quantified later in the text in Fig. 3g, supporting their colocalization.”

      1. The authors mention, '...of the different SATB1 isoforms, uncovered by the use of the two different antibodies, relied in the heterochromatin areas (zone 1), where the long isoform was less frequently...' There is no supporting figure number mentioned. The authors need to show a zone-by-zone comparison images for 'all iso' vs 'long' iso of SATB1. Just to reiterate, there is a need for a heterochromatin mark to unambiguously call out the distinction.

      We should remind that there is an inherent difficulty to accurately compare localization of short and long SATB1 isoforms in primary cells, especially due to the lack of Satb1 isoform-specific knockout mice. There is no way to detect only the short isoform in these primary cells as there are only antibodies targeting the long or all SATB1 isoforms. Therefore, we cannot set up additional experiments probing these questions.

      In line with this, in the revised version of the manuscript, we toned down our statements regarding the differential localization of the two isoforms in primary cells. We only refer to it as an indication and we support it by adding references to the relevant figures. This part now reads: “Localization of SATB1 speckles detected by antibodies targeting all SATB1 isoforms and/or only the long SATB1 isoform, revealed a significant difference in the heterochromatin areas (zone 1, Fig. 2b), where the long isoform was less frequently present (see also Fig. 2a and Fig. 3c). Although, this could indicate a potential difference in localization between the two isoforms, due to the inherent difficulty to distinguish the two based on antibody staining, we refrain to draw any conclusions. (Lines 145-150)”

      1. On the same lines, '....Given the localization of SATB1 to the nuclear zones with estimated transcriptional activity (Fig. 2b, zone 3)....' How was the region labelled as transcriptionally active? For the statistical analysis of speckle count for the two antibodies' staining, the claim posited is a bit bigger. This could simply be true for that cell. The authors thus need to statistically analyse the speckle counts for multiple cells. This needs to be done for all imaging statistics done in multiple figures throughout the manuscript.

      As mentioned in our reply to the two previous comments of this Reviewer, transcriptional activity in relation to the nuclear zonation is well established in the literature. To make this clear, we have now added the reference to Miron et al., 2020 (https://doi.org/10.1126/sciadv.aba8811) supporting our claims and additionally we have also included HP1, H3K4me3 and fibrillarin staining and quantification of FU signal in the nuclear zones. Moreover, it is not clear to which particular cell the comment refers to. The presented dots in Fig. 2b represent individual cells and the relative proportions of speckles in each nuclear zone are plotted on the y axis. In the revised version of the manuscript, we added into the figure the number of cells scored and we adapted the figure legend so that it is absolutely clear that we have analyzed multiple cells:

      “Nuclei of primary murine thymocytes were categorized into four zones based on the intensity of DAPI staining and SATB1 speckles in each zone were counted. Images used represented a middle z-stack from the 3D-SIM experiments. The graph depicts the differences between the long and all SATB1 isoforms’ zonal localization in nuclei of primary murine thymocytes. (Lines 1189-1193)”

      1. For figure 2c. the authors have used 5 Fluorouridine for nascent RNA speckles. 5FU is known to have a spread signal type (with strong association to nucleolus as well). This is not the case for the image presented 2c. The authors should resolve this by showing different sets of images.

      Developing and naive T cells are very unique in terms of their metabolic features and thus they should not be directly compared with other cell types. Therefore, we would not expect to see such a spread FU pattern as previously shown for other cell types. Having said that, we could not find any reference publication that utilized super-resolution microscopy to detect localization of FU-stained sites of active transcription in developing primary T cells. However, we performed additional immunofluorescence experiments to demonstrate the colocalization or its lack between SATB1 and HP1 (Supplementary Fig. 2b), H3K4me3 (Supplementary Fig. 2c) and fibrillarin (Supplementary Fig. 3b). Moreover, we provide additional regions of SATB1 and FU staining in Supplementary Fig. 3c. The modified text reads:

      “We unraveled the localization of SATB1 isoforms and the sites of active transcription labeled with 5-fluorouridine. Sites of active transcription displayed a significant enrichment in the nuclear zones 3 & 4 (Supplementary Fig. 3a), similar to SATB1. As detected by fibrillarin staining, SATB1 also colocalized with nucleoli which are associated with active transcription and RNA presence (Supplementary Fig. 3b). Moreover, we found that the SATB1 signal was found in close proximity to nascent transcripts as detected by the STED microscopy (Fig. 2c). Similarly, the 3D-SIM approach indicated that even SATB1 speckles that appeared not to be in proximity with FU-labeled sites in one z-stack, were found in proximity in another z-stack (Supplementary Fig. 3c). Additionally, a pixel-based colocalization of SATB1 and sites of active transcription is quantified later in the text in Fig. 3g, supporting their colocalization. (Lines 157-167)”

      1. Fig 2 d., the authors have suddenly jumped solely to 'all iso' Satb1 here for IP MS. Is there a reason for that? The authors either need to do this with 'long iso' antibody or remove the analysis from the manuscript as it does not add to their primary aim of the manuscript. Also, the authors have only selectively talked about two clusters? What about chromatin related proteins? It is quite intuitive to have highest enrichment of these given previous literature and even IP MS data by other groups. Thus, it is necessary to revise this thoroughly or remove it.

      We appreciate the acknowledgment by the Reviewer that our IP-MS data identified anticipated factors. In the revised version of the manuscript we modified the underlying text to accommodate references to these former findings revealing interactions between SATB1 and chromatin modifying complexes: “Apart from subunits of chromatin modifying complexes that were also detected in previous reports25,33–36, unbiased k-means clustering of the significantly enriched SATB1 interactors revealed two major clusters consisting mostly of proteins involved in transcription (blue cluster 1; Fig. 2d and Supplementary Fig. 4c) and splicing (yellow cluster 2; Fig. 2d and Supplementary Fig. 4c). (Lines 170-174)”

      Please note that many subunits of chromatin modifying and chromatin-related complexes are in fact characterized as transcription-related factors, therefore our statements are not in disagreement with the former findings. Note also that we provide Supplementary File 1 & 2 with comprehensive description of our IP-MS data for the readers’ convenience. Please also note that we are the first group to report on the existence of the long isoform. Therefore, we find it absolutely reasonable to perform IP-MS experiment for all SATB1 isoforms which can then be used for a comparison with other publicly available datasets. We believe that there is no contradiction in this experimental setup in relation to the rest of the manuscript. We discuss the two major clusters simply because they are the two major clusters identified as indicated in Fig. 2d. Additionally, in Supplementary Fig. 4c, we provide a comprehensive description of all significantly enriched interactors including their cluster annotation and thus anyone can investigate the data if needed.

      1. In relation to Fig. 2f, the authors have not mentioned any of the previously published work on Satb1 CD4 specific KO, not even the RNA seq studies the other groups have reported under the same condition. Only an unpublished reference of their own (preprint) is cited. It is imperative to show how much their data corroborates with other published studies. Additionally, what is the binding site status of dysregulated genes?

      In the revised version of the manuscript, we have included the references to other studies using the same Satb1 conditional knockout. Moreover, we have clarified the relationship between SATB1 binding and gene transcription. The modified part in Lines 182-194 now reads: “Satb1 cKO animals display severely impaired T cell development associated with largely deregulated transcriptional programs as previously documented19,37,38. In our accompanying manuscript19, we have demonstrated that long SATB1 isoform specific binding sites (GSE17344619) were associated with increased chromatin accessibility compared to randomly shuffled binding sites (i.e. what expected by chance), with a visible drop in chromatin accessibility in Satb1 cKO. Moreover, the drop in chromatin accessibility was especially evident at the transcription start site of genes, suggesting that the long SATB1 isoform is directly involved in transcriptional regulation. Consistent with these findings and with SATB1’s nuclear localization at sites of active transcription, we identified a vast transcriptional deregulation in Satb1 cKO with 1,641 (922 down-regulated, 719 up-regulated) differentially expressed genes (Fig. 2f). Specific examples of transcriptionally deregulated genes underlying SATB1-dependent regulation are provided in our accompanying manuscript19. Additionally, there were 2,014 genes with altered splicing efficiency (Supplementary Fig. 4d-e; Supplementary File 3-4). We should also note that the extent of splicing deregulation was directly correlated with long SATB1 isoform binding (Supplementary Fig. 4d).”

      1. In context of Figure 3a and b, the authors write .'...The long SATB1 isoform speckles evinced such sensitivity as demonstrated by a titration series with increasing concentrations of 1,6-hexanediol treatment followed...' Whereas it is apparent from the image at least that overall numbers of individual speckles are instead increased at both 2 and 5%. There is although a clear spreading of restricted speckles compared to the controls. The authors should revise their figures to substantiate the associated text. Furthermore, there needs to be 'all iso' SATB1 3D SIM imaging and not just quantitation for comparison. This is also true for panel c in order to demonstrate the effect.

      In the revised Fig. 3a we provide new images which better reflect the underlying data analysis. Moreover, in Fig. 3c and Fig. 3d we provide an additional comparison between SATB1 all isoforms and long isoform staining and their changes upon hexanediol treatment, detected by both the 3D-SIM and STED approaches. It is true that upon treatment, there tend to be more speckles, however these are much smaller as they are gradually being dissolved. Depending on the treatment duration, the cells are swollen which is reflected in increased spreading of speckles. Nevertheless, the nuclear size was considered in all the quantification analyses. We believe that the new images provide better evidence of SATB1’s sensitivity to hexanediol treatment.

      1. Fig. 3 d also does not clearly demonstrate what the authors have claimed '...hexanediol treatment highly decreased colocalization between...' The figure shows at best decreased signal intensity for both SATB1 and FU. We suggest that the authors should give a statistical analysis as well for the colocalization points between the two using multiple source images. Lastly, the two images shown (control and treated), there seems to be a clearly visible magnification difference. The authors should clarify this.

      • In the revised version of the manuscript in Figure 3d, we have provided scale bars, which are both 0.5 µm (line 1213). The difference observed by this Reviewer is actually the main reason why we provided this image. Figure 3d demonstrates that upon hexanediol treatment, the speckles are mostly missing or significantly reduced in size, for both FU and SATB1 staining. • Moreover, the suggested statistical analysis is also provided – in Figure 3e. In Figure 3e, we performed pixel-based colocalization analysis which is a method that allows both quantification and statistical comparison of colocalization between two factors and between different conditions. Please note especially the decreased colocalization between long SATB1 isoform and FU-stained sites of active transcription in the left graph, which is in agreement with our claims in the manuscript. • Moreover, our data are compared to a negative control, i.e. 90 degrees rotated samples, which is a common method in colocalization experiments as described for example in Dunn et al., 2011 (https://doi.org/10.1152/ajpcell.00462.2010). • Additionally, we provide Costes’ P values which are based on randomly scrambling the blocks of pixels (instead of individual pixels, because each pixel’s intensity is correlated with its neighboring pixels) in one image, and then measuring the correlation of this image with the other (unscrambled) image. Please see Costes et al., 2004 (https://doi.org/10.1529%2Fbiophysj.103.038422) for more details.

      1. Figure 3f. The authors show the PC plot for Raman spectroscopy for phase behaviour due to Satb1. The experiment and its related text seems misinterpreted; the authors write...' ese bonds were probably enriched for weak interactions responsible for LLPS that are susceptible to hexanediol treatment. This shifted the cluster of WT treated cells towards the Satb1 cKO cells. However, the remaining covalent bonds differentiated the WT samples from Satb1 cKO cells......' whereas the clusters are clearly far away in 3D for both WT and KO while being closer to their respective treatments. Which is also intuitive given the sensitivity of Raman spectroscopy. Thus, it is more likely to be treatment effect and KO effect as separate. Treatment of WT leads to KO like spectra is far-fetched. Thus, the authors need to show separate PCs and modify their text thoroughly.

      We do not present any 3D graph hence it is not clear what the Reviewer refers to. Please also note that as stated in Lines 817-818, we used a customized Raman Spectrometer. Therefore, this approach allowed us to measure Raman spectra at cellular and even sub-cellular levels. For example, solely by utilizing Raman spectroscopy, we can now distinguish euchromatin and heterochromatin, methylated and unmethylated DNA and RNA, etc. This, together with other reports, such as Kobayashi-Kirschvink et al., 2018 (https://doi.org/10.1016/j.cels.2018.05.015) and Kobayashi-Kirschvink et al., 2022 (https://doi.org/10.1101/2021.11.30.470655), indicate a potential use of Raman in biological research. In our manuscript, we used this method as a supplementary approach, however we do find it noteworthy. We should also emphasize that in the revised Raman spectroscopy Fig. 3h, each point represents measurements from an individual cell and for each condition we used 2-5 biological replicates (Lines 831-832 & Lines 1225-1226). We specifically refer to the principal component 1 (PC1) that differentiates the samples. Therefore, there are certain spectra (representing certain chemical bonding) that allowed us to differentiate between WT and Satb1 cKO. The same type of bonding was then affected when WT samples were treated with hexanediol and we also had controls to rule out the impact of hexanediol on the resulting spectra.

      1. In Fig 4. b, The authors have shown the propensity of SATB1 N terminus to phase separate using different optodroplet constructs. Although the imaging is clear, why are the regions selected not uniform when comparing various constructs?

      We have selected images that would best represent each category. Please note that this was live cell imaging of photo-responsive constructs, thus there are many limitations regarding the area selection. Very often, even the brief time of bright light exposure to localize cells may trigger protein clustering. Upon disassembly, every new light exposure of the same cell then triggers much faster assembly which skews the overall results. It is therefore desired to work fast, while neglecting selection of equally sized cells. Moreover, it is not clear how would the proposed change improve the quality of our manuscript.

      1. Figure 5a, the disassembly should be shown for 'long' SATB1 as well. On pg 13, the authors write '....cytoplasmic protein aggregation has been previously described for proteins containing poly-Q domains and PrLDs..' no reference given.

      • In the revised version of the manuscript, we present the assembly and disassembly for both short and long full length SATB1 optogenetic constructs. To increase clarity, we present the behavior of the short and long isoforms as two separate images in Figure 5a and Figure 5b, respectively. • Moreover, we provided references to the statement regarding aggregation of PrLD and poly-Q-containing proteins in Lines 305-309, which now reads: ”Since protein aggregation has been previously described for proteins containing poly-Q domains and PrLDs8,11,38,39, we next generated truncated SATB1 constructs encoding two of its IDR regions, the PrLD and poly-Q domain and in the case of the long SATB1 isoform also the extra peptide neighboring the poly-Q domain (Fig. 1a and 4a).”

      1. Fig. 5d, Is there an amino-acid specific reasoning to support the authors claim of the phase behaviour due to extra peptide? They need to show a proper control with equal extra (unrelated) peptide to show the specificity. Are the shorter isoform aggregates responsive to light?

      • We have referred to the amino acid composition bias in Fig. 5c. In the revised version of the manuscript, we made this clear by showing the composition bias in the new revised Fig. 5e. The related part of the main text then reads: “Computational analysis, using the algorithm catGRANULE37, of the protein sequence for both murine SATB1 isoforms indicated a higher propensity of the long SATB1 isoform to undergo LLPS with a propensity score of 0.390, compared to 0.379 for the short isoform (Fig. 5d). This difference was dependent on the extra peptide of the long isoform. Out of the 31 amino acids comprising the murine extra peptide, there are six prolines, five serines and three glycines – all of which contribute to the low complexity of the peptide region3 (Fig. 5e).” (Lines 298-304) • Moreover, we should note that the low complexity extra peptide of the long SATB1 isoform directly extends the PrLD and IDR regions as indicated in Fig. 4a and which we now directly state in Lines 304-305: “Moreover, the extra peptide of the long SATB1 isoform directly extends the PrLD and IDR regions as indicated in the Fig. 4a.” • We show in Fig. 4, that the N terminus of SATB1 undergoes LLPS. Since this part of SATB1 is shared by both isoforms, it is reasonable to assume that both isoforms would undergo LLPS. This is also in line with the observed photo-responsiveness of both short and long full length SATB1 isoforms in CRY2 optogenetic constructs in revised Fig. 5a,b, and similar FRAP results for both short and long full length SATB1 isoform constructs transiently transfected in NIH-3T3 cells in the revised Supplementary Fig. 6f. However, the main reason why we think that the difference in LLPS propensity between the isoforms is important is because the long isoform is more prone to aggregate compared to the short isoform, as documented in Fig 5c,f,g and Supplementary Fig. 5f.

      1. Fig 6c., It is important that authors show the data for NLS+short iso data as well to prove their hypothesis.

      As shown in original Figure 5d, the long SATB1 isoform undergoes cytoplasmic aggregation, unlike the short SATB1 isoform (as shown in the same Figure). Therefore, an image of the NLS + short isoform would not be related to our hypothesis. Actually, we wanted to reverse the long SATB1 isoform’s relocation, from the aggregated form in the cytoplasm into the nucleus. Nevertheless, to show the complete picture, in the revised version of the manuscript in Figure 6c, we now provide data for both short and long SATB1 isoforms.

      1. Fig 6d., The authors claim that mutating a specific P site changes the phase behaviour of the 'short iso'. Does it also increase for the long isoform? The authors need to confirm this in order to verify the effect of a single P site outside of oligomerization domain. ...' phosphorylation status; when phosphorylated it remains diffused, whereas unphosphorylated SATB1 is localized to PML bodies....' This being an important premise, thus should be moved to the results text.

      In the revised version of the manuscript, we moved the part regarding PML in the results section, as suggested by the Reviewer. Moreover, we included additional experiments probing the impact of association between PML and two SATB1 full length isoforms on their dynamics. The modified section in Lines 357-368 now reads: “In relation to this, a functional association between SATB1 and PML bodies was already described in Jurkat cells64. We should note that PML bodies represent an example of phase separated nuclear bodies65 associated with SATB1. Targeting of SATB1 into PML bodies depends on its phosphorylation status; when phosphorylated it remains diffused, whereas unphosphorylated SATB1 is localized to PML bodies66. This is in line with the phase separation model as well as with our results from S635A mutated SATB1, which has a phosphorylation blockade promoting its phase transitions and inducing aggregation. To further test whether SATB1 dynamics are affected by its association with PML, we co-transfected short and long full length SATB1 isoforms with PML isoform IV. The dynamics of long SATB1 isoform was affected more dramatically by the association with PML than the short isoform (Supplementary Fig. 7e), which again supports a differential behavior of the two SATB1 isoforms.”

      Moreover, given the localization of the discussed phosphorylation site in the DNA binding region of SATB1 we did test its impact on DNA binding as documented in the revised Supplementary Fig. 7d. Additionally, as we have noted in our answer in Major Comment C of this reviewer, to further support the effect of serine phosphorylation on the DNA binding capacity of SATB1 we have performed DNA affinity purification experiments utilizing primary thymocyte nuclear extracts treated with phosphatase (Supplementary Fig. 7b) We found that SATB1’s capacity to bind DNA (RHS6 hypersensitive site of the TH2 LCR) is lost upon treatment with phosphatase (Supplementary Fig. 7c).

      1. Pg 16,. The authors have tried to explain multiple things (concepts of self-regulation, accessibility) which is quite tangential. There is no inference to Fig 6f., which is showing the opposite to what the authors had postulated. This portion should either be removed or explained with a rationale. The writing also needs to be revised thoroughly in this section. Similarly, the discussion should also be modified.

      The rationale for the original Fig. 6f (revised Fig. 6g) was described in great detail in Lines 330-343 of the original manuscript. It is not clear why the Reviewer assumes that it shows the opposite to our hypothesis. As we explained, the increased accessibility allows faster read-through by RNA polymerase, and thus the exon with higher accessibility is more likely to be skipped. The exact relationship is shown in the revised Fig. 6g where the increased accessibility is associated with the expression of the short isoform, whereas the long isoform expression needs lower chromatin accessibility which allows the splicing machinery to act on the specific exon to be included. We reason that these findings are important and relevant because: 1) we suggest a potential regulatory mechanism for the SATB1 isoforms production. This is highly relevant to this manuscript given the fact that this is the first report on the existence of the long SATB1 isoform, and 2) the differential production of the long/short SATB1 isoforms has a potential relevance to breast cancer prognosis. In the revised version of the manuscript we added Fig. 6f, which now indicates the differential chromatin accessibility in human breast cancer patients and accordingly the expression of the long SATB1 isoform are associated with worse patient prognosis as indicated in Fig. 6h and Supplementary Fig. 8a,b. In the revised version of the manuscript, we substantially modified the text in Lines 374-408, to make the relevance of all these conclusions clear. The modified text now reads: “Therefore, we reasoned that a more plausible hypothesis would be based on the regulation of alternative splicing. In our accompanying manuscript19, we have reported that the long SATB1 isoform DNA binding sites display increased chromatin accessibility than what expected by chance (Fig. 3b in 19), and chromatin accessibility at long SATB1 isoform binding sites is reduced in Satb1 cKO (Fig. 3c in 19), collectively indicating that long SATB1 isoform binding promotes increased chromatin accessibility. We identified a binding site specific to the long SATB1 isoform19 right at the extra exon of the long isoform (Fig. 6e). Moreover, the study of alternative splicing based on our RNA-seq analysis revealed a deregulation in the usage of the extra exon of the long Satb1 isoform (the only Satb1 exon affected) in Satb1 cKO cells (deltaPsi = 0.12, probability = 0.974; Supplementary File 4). These data suggest that SATB1 itself is able to control the levels of the short and long Satb1 isoforms. A possible mechanism controlling the alternative splicing of Satb1 gene is based on its kinetic coupling with transcription. Several studies indicated how histone acetylation and generally increased chromatin accessibility may lead to exon skipping, due to enhanced RNA polymerase II elongation48,49. Thus the increased chromatin accessibility promoted by long SATB1 isoform binding at the extra exon of the long isoform, would increase RNA polymerase II read-through leading to decreased time available to splice-in the extra exon and thus favoring the production of the short SATB1 isoform in a negative feedback loop manner. This potential regulatory mechanism of SATB1 isoform production is supported by the increased usage of the extra exon in the absence of SATB1 in Satb1 cKO (Supplementary File 4). To further address this, we utilized the TCGA breast cancer dataset (BRCA) as a cell type expressing SATB150. ATAC-seq experiments for a series of human patients with aggressive breast cancer51 revealed differences in chromatin accessibility at the extra exon of the SATB1 gene (Fig. 6f). In line with the “kinetic coupling” model of alternative splicing, the increased chromatin accessibility at the extra exon (allowing faster read-through by RNA polymerase) was positively correlated with the expression of the short SATB1 isoform and slightly negatively correlated with the expression of the long SATB1 isoform (Fig. 6f). Moreover, we investigated whether the differential expression of SATB1 isoforms was associated with poor disease prognosis. Worse pathological stages of breast cancer and expression of SATB1 isoforms displayed a positive correlation for the long isoform but not for the short isoform (Fig. 6g and Supplementary Fig. 6c). This was further supported by worse survival of patients with increased levels of long SATB1 isoform and low levels of estrogen receptor (Supplementary Fig. 6d). Overall, these observations not only supported the existence of the long SATB1 isoform in humans, but they also shed light at the potential link between the regulation of SATB1 isoforms production and their involvement in pathological conditions.”

      1. The authors should not draw conclusions based on any data which is not shown '....ed differences in chromatin accessibility at the extra exon of the SATB1 gene (data not shown), suggesting its potential involvement in alternative splicing regulation according to the "kinetic coupling" model...'. This has led to overspeculation and needs correction.

      In the revised version of the manuscript, we included the ATAC-seq data from human breast cancer patients in the revised Fig. 6f. The legend of this figure now reads: “Human TCGA breast cancer (BRCA) patient-specific ATAC-seq peaks51 span the extra exon (EE: extra exon; labeled in green) of the long SATB1 isoform. Note the differential chromatin accessibility in seven selected patients, emphasizing the heterogeneity of SATB1 chromatin accessibility in cancer. Chromatin accessibility at the promoter of the housekeeping gene DNMT1 is shown as a control. (Lines 1281-1285)” Accordingly, we have also modified the main text: “ATAC-seq experiments for a series of human patients with aggressive breast cancer68 revealed differences in chromatin accessibility at the extra exon of the SATB1 gene (Fig. 6f). In line with the “kinetic coupling” model of alternative splicing, the increased chromatin accessibility at the extra exon (allowing faster read-through by RNA polymerase) was positively correlated with the expression of the short SATB1 isoform and slightly negatively correlated with expression of the long SATB1 isoform (Fig. 6g).” (Lines 395-339)”

      Minor comments: 1. On pg 4, the authors state 'Here, we utilized primary murine T cells, in which we have identified two full-length SATB1 protein isoforms.' Whereas only one 'long' isoform is identified and the other is the canonical version. The authors should correct the statement.

      In the revised version of the manuscript, we modified this statement as follows: ”In this work, we utilized primary developing murine T cells, in which we have identified a novel full-length long SATB1 isoform and compared it to the canonical “short” SATB1 isoform.” (Lines 64-66)”

      1. Fig. 1 a , Is there a specific reason to generate a custom-made antibody for 'all' SATB1, using similar regions that are already commercially available. This becomes redundant otherwise, because there is no apparent difference in detection compared to the commercial one (Suppl. Fig 1a). Antibody generation strategy (1a) should be moved to supplementary. Additionally, authors have obtained the custom antibodies from a commercial source, therefore, the text should reflect the same alongside relevant details.

      The custom-made SATB1 antibody targeting the amino-terminal region of the protein has been developed in order to be utilized for detecting the native form of the protein. Unlike commercially available antibodies raised against either short peptides or denatured forms of the protein we have utilized the native form of the amino-terminal part of the protein for raising this antibody. To be honest, this antibody has been raised in order to be utilized in ChIP-seq experiments since no commercially available antibody is of high quality for this approach. Moreover, the original Figure 1a was utilized in order to provide an overview of the SATB1 protein structure which is highly relevant to understand its biophysical properties and not for presenting the strategy for raising a custom-made antibody for SATB1.

      1. Fig 3e: what is the control used here? In their Pearson correlation analysis, there seem to be significant reduction in control sets as well upon treatment. This needs to be clarified.

      We used scans rotated by 90° which served as a negative control, as stated in Line 769: “SATB1 scans rotated by 90° served as a negative control for the colocalization with FU.” Note that this is a commonly used control in colocalization experiments as described for example in Dunn et al., 2011 (https://doi.org/10.1152/ajpcell.00462.2010).

      Additionally, we provide Costes’ P values which are based on randomly scrambling the blocks of pixels (instead of individual pixels, because each pixel’s intensity is correlated with its neighboring pixels) in one image, and then measuring the correlation of this image with the other (unscrambled) image. Please see Costes et al., 2004 (https://doi.org/10.1529%2Fbiophysj.103.038422) for more details. Moreover, it was actually anticipated to see a decrease in colocalization upon hexanediol treatment even in the negative control, as hexanediol significantly reduces both SATB1 and FU speckles as established in Fig. 3a-d.

      1. Pg 10, the authors claim that '..., thus we reasoned that it may also be used to study phase separation...' But there have been numerous reports starting from 2018, which have utilized this technique in corelation to phase behaviour (albeit individual proteins). The authors should include proper citations as they are extending an idea from the same field to their specific need.

      In the revised version of the manuscript, we included relevant citations to support the use of Raman spectroscopy in LLPS research: “Raman spectroscopy was already used in many biological studies, such as to predict global transcriptomic profiles from living cells42, and also in research of protein LLPS and aggregation43–47. Thus we reasoned that it may also be used to study phase separation in primary T cells.” (Lines 225-228)”

      1. For Fig 5b, there should be a comparative image for 'short' isoform.

      In the revised Figure 5c we have included a comparative image for the short SATB1 isoform.

      1. In the context of Figure 5c, the authors claim ...' Note also the higher LLPS propensity of the human long SATB1 isoform compared to the murine SATB1...' Why suddenly human and mouse comparisons are drawn? This figure should be moved to supplementary.

      The comparison between the human and mouse SATB1 isoforms has been implemented because it is relevant for our claims regarding the increased SATB1 aggregation in human cells in relation to the revised Fig. 6f,g,h and Supplementary Fig. 6c,d. This is also discussed in Lines 479-482, which read: “This is particularly important given the higher LLPS propensity of the human long SATB1 isoform compared to the murine SATB1 (Fig. 5d). Therefore, human cells could be more susceptible to the formation of aggregated SATB1 structures which could be associated with physiological defects.”

      **Reviewer #3 (Evidence, reproducibility and clarity):**

      Zelenka et al., focus on a T cell genome-organizing protein, SATB1, to show that SATB1 undergoes liquid liquid phase-separation (LLPS), and distinct isoforms confer different LLPS-related biophysical properties. They generate a long-isoform specific antibody and conduct several experiments to test for LLPS and compare LLPS properties between the long-isoform relative to the whole SATB1 protein population. Given that SATB1 plays important roles in T cell development and in cancer, interrogating SATB1 biophysical properties is an important question. However, there are multiple problems with the experimental setup and data that weaken their support of the conclusions. I will detail some of the major issues below:

      Regarding phase-separation There are several assays to determine whether a protein undergoes LLPS. 1. One of the first the authors address is the spherocity or roundness. Indeed, formation of spherical droplets is one evidence of the liquid nature of a protein. However, the authors use fixed preparations (which can introduce artifacts), not free-floating protein, and determine roundness by showing a 2D image. Roundness should take into account the diffraction-limits of fluorescent imaging, as many structures can be imaged to appear round by the detector. There are quantifiable measurements that can be taken on 3D images to show roundness. This would best be shown using non-fixed protein.

      • We thank this Reviewer for several insightful comments. Although, we agree with most of them, we should highlight the main goal of our manuscript, i.e. to investigate the SATB1 protein with an emphasis on its physiological roles in primary developing murine T cells. We highlight this already in the introduction in Line 64 “In this work, we utilized primary developing murine T cells,...” and mainly also in the respective part of the result section: “To probe differences in phase separation in mouse primary cells, without any intervention to SATB1 structure and expression, we first utilized 1,6-hexanediol treatment, which was previously shown to dissolve the liquid-like droplets34.(Lines 203-205)”

      • We believe that this is a very important aspect of our study that should not be overlooked. The majority of proteins perhaps behave differently under physiological and in vitro conditions. However, due to the extensive post-translational modifications affecting the properties of SATB1, its completely different localization patterns between primary developing T cells and other cell types but especially cell lines and many other aspects, it was of utmost importance to focus our research on primary T cells. Unfortunately, this was accompanied with multiple difficulties, such as that we have to use fixed cells as this is the only way to visualize SATB1 in these cells. Alternatively, one could create a new mouse line expressing a fluorescently tagged SATB1 protein, but this is beyond the scope of our work.

      • However, we should also note that many LLPS-related studies do not pay any focus on primary physiological functions of proteins and they simply focus on the investigation of protein’s artificial behavior in in vitro conditions. Having said that, we too extended our experiments in primary cells to the ex vivo studies in cell lines to further support our claims. In these experiments, we utilized live cell imaging in Fig. 4-6, quantified the spherocity in Supplementary Fig. 6, showed the ability of speckles to coalesce in Fig. 4c and also used FRAP in Fig. 4f and also in the revised version of the manuscript in Supplementary Figure 6f. Moreover, we should note that most of these experiments were designed and performed during 2017 and 2018 conforming with the standards. We are well aware of the progress in the field and impact of fixation on LLPS, as described in Irgen-Gioro et al., 2022 (https://doi.org/10.1101/2022.05.06.490956), but after over seven months of review process in another journal we also believe that these aspects should be considered not to delay further progress of the SATB1 field.

      Regarding the isoform specificity of SATB1 biophysical properties 1. The authors generate a long isoform-specific antibody. However, the western blot is not convincing that this is indeed specific to the long isoform as there is a rather large smear. Can this be improved with antibody preabsorption? Since this is a key reagent for the manuscript, improvement in antibody quality is essential.

      The custom-made antibody for the long isoform has been raised against the unique 31 amino acids long peptide present in the long SATB1 isoform. The polyclonal serum has undergone affinity chromatography utilizing the immobilized peptide (antigen) to purify the antibody. In the revised version of the manuscript we have included another immunodepletion experiment with cleaner bands (Fig. 1f). Moreover, please read our answer to Major comment #2 of Reviewer 1 that follows: • The long antibody was raised in mice inoculated with the extra peptide present in the long isoform only. Therefore, the capacity of this antibody precipitating the shorter isoforms, which do not express the sequence of the extra peptide (EP, Figure 1a) in not possible.

      • We have repeated the immunodepletion experiment and we now provide the results in Fig. 1f and Supplementary Fig. 1b. The western blot in Fig. 1f is now cleaner and supports quite convincingly the presence of a long SATB1 isoform. Given the lack of isoform-specific knockouts which we could utilize to immunoprecipitate or detect the different isoforms in a single cell (or cell population), the utilized approach of immunodepletion and subsequent western blotting is the approach we thought of implementing.

      • As shown in Fig. 1f and Supplementary Figure 1b, the long isoform SATB1 antibody has the capacity to recognize the long isoform in murine thymocyte protein extracts but not the short SATB1 isoform (please compare lane 3 in the two western blots utilizing either the antibody for the long isoform -top panel - or the antibody that detects both isoforms (lower panel).

      • We have performed Immunofluorescence experiments utilizing the antibody detecting the long SATB1 isoform in thymocytes isolated from either C57BL/6 or Satb1 cKO mice. The antibody is specific to the SATB1 protein since there is no signal in immunofluorescence experiments utilizing the knockout cells (Supplementary Figure 1c).

      • We have performed Immunofluorescence experiments utilizing thymocytes and the antibody detecting the long SATB1 or a commercially available antibody detecting all SATB1 isoforms. The pattern of SATB1 subnuclear localization is similar for both antibodies (Supplementary Figure 1e).

      • In our accompanying revised manuscript Zelenka et al., 2022 (https://doi.org/10.1101/2021.07.09.451769), we provide yet another piece of evidence, consisting of bacterially expressed short and long SATB1 protein isoforms detected by western blot using either the long isoform-specific or the non-selective all SATB1 isoforms antibodies.

      • Regarding the additional bands detected in the immunoprecipitation experiment presented in the original Supplementary Figure 1b (lane 2), it is not surprising that additional bands appear in a sample of protein extracts that is used for several hours for the immunoprecipitation experiments, while the “input” sample simply denotes protein extract that is frozen at -80oC right after the preparation of protein extracts until use. It is well-established that SATB1 is the target of proteases which might as well be active during the immunoprecipitation steps (2 consecutive immunoprecipitation steps take place). Therefore, the immunoprecipitated material cannot necessarily be a copy of the input material displaying a single protein band even if protease inhibitors are included in the buffers.

      Taken together the experiments described here we showed that the antibody raised against the extra 31 aa long peptide, present only in the long SATB1 isoform, is specific for this isoform.

      1. Fig 4 Optodroplet experiment appears to show that the N-terminus of SATB1 can undergo LLPS. The results of this assay show that SATB1 has a domain that can undergo phase-separation in isolation, but it does not show that the protein itself is a phase-separating protein. The FRAP assay methods are not provided by the authors, but this is important, as continued light activation means proteins are continuously forming aggregates, and the bleaching for FRAP should be balanced with the levels of Cry2 activation. A very good description of the methods is described in the original Optodroplet paper: https://www.sciencedirect.com/science/article/pii/S009286741631666X?via%3Dihub#sec4

      We should note that we did follow the FRAP protocol provided by the recommended study Shin et al., 2017 (https://doi.org/10.1016/j.cell.2016.11.054). Indeed, these experiments are very tricky to perform and interpret, as every cell expresses slightly different amounts of protein which is directly associated with the different speed of optoDroplet formation, and thus its propensity to aggregate upon overactivation. On the other hand, there need to be continuous activation during the FRAP experiment as the lack of activation laser would result in fast disassembly of the optoDroplets, counteracting the FRAP results. Moreover, the optoDroplets actively move around the cell in all dimensions which makes the accurate measurement of signal intensity really challenging, even with an adjusted pinhole. Therefore, we do not think that FRAP is the best approach to examine the behavior of optoDroplets.

      Either way, we have now described the detailed FRAP protocol in Lines 889-898, which read: “For the FRAP experiments, cells were first globally activated by 488 nm Argon laser illumination (alongside with DPSS 561 nm laser illumination for mCherry detection) every 2 s for 180 s to reach a desirable supersaturation depth. Immediately after termination of the activation phase, light-induced clusters were bleached with a spot of ∼1.5 μm in diameter. The scanning speed was set to 1,000 Hz, bidirectionally (0.54 s / scan) and every time a selected point was photobleached for 300 ms. Fluorescence recovery was monitored in a series of 180 images while maintaining identical activation conditions used to induce clustering. Bleach point mean values were background subtracted and corrected for fluorescence loss using the intensity values from the entire cell. The data were then normalized to mean pre-bleach intensity and fitted with exponential recovery curve in Fiji or in frapplot package in R.”

      1. Description of analyses that authors prefer not to carry out

      **Reviewer #1**:

      Can they use the all and long isoform antibodies together, then subtract the signal from long isoform to conclude about the localization of the shorth isoform ?

      We thank the Reviewer for the suggestion, though given the differential efficiency of antibodies and other limitations of imaging experiments, we do not find the suggested experiment to have a potential to improve the quality of our manuscript. However, we should note that we have performed a pixel-based colocalization experiment between the signal detected by all isoform and long isoform SATB1 antibodies. Fluorocytogram of the pixel-based colocalization, based on 3D-SIM data is provided on the left, with quantified colocalization on the right of the revised Supplementary Fig. 5a.

      3) Lack of better staining with antibody against the long and short SATB1 isoforms after treatment with 1,6 Hexanediol. 1,6 Hexanediol treatment can change many other chromatin associated proteins to which SATB1 can be bound to indirectly. This experiment can

      We do understand the controversy and difficulties of experiments using 1,6-hexanediol treatment. However, we have to note that there is no better approach available for the investigation of LLPS in our primary murine T cells. We did use alternative approaches in ex vivo experiments, utilizing cell lines to validate our hypothesis without the involvement of 1,6-hexanediol.

      **Reviewer #2**:

      1. The authors mention, '...of the different SATB1 isoforms, uncovered by the use of the two different antibodies, relied in the heterochromatin areas (zone 1), where the long isoform was less frequently...' There is no supporting figure number mentioned. The authors need to show a zone-by-zone comparison images for 'all iso' vs 'long' iso of SATB1. Just to reiterate, there is a need for a heterochromatin mark to unambiguously call out the distinction.

      We should remind that there is an inherent difficulty to accurately compare localization of short and long SATB1 isoforms in primary cells, especially due to the lack of Satb1 isoform-specific knockout mice. There is no way to detect only the short isoform in these primary cells as there are only antibodies targeting the long or all SATB1 isoforms. Therefore, we cannot set up additional experiments probing these questions.

      In line with this, in the revised version of the manuscript, we toned down our statements regarding the differential localization of the two isoforms in primary cells. We only refer to it as an indication and we support it by adding references to the relevant figures. This part now reads: “Localization of SATB1 speckles detected by antibodies targeting all SATB1 isoforms and/or only the long SATB1 isoform, revealed a significant difference in the heterochromatin areas (zone 1, Fig. 2b), where the long isoform was less frequently present (see also Fig. 2a and Fig. 3c). Although, this could indicate a potential difference in localization between the two isoforms, due to the inherent difficulty to distinguish the two based on antibody staining, we refrain to draw any conclusions. (Lines 145-150)”

      1. Fig. 6a, The authors wished to see the effect of RNA on Satb1 nuclear localization. This is not related to the main theme of the paper, thus should be moved to supplementary (true for b as well). Importantly, the experiments should be performed with total cells to show the divergence of localization (like the paper the authors referred to) instead of matrix for clarity.

      • We did not wish to see the effect of RNA on SATB1 localization. In fact, there is a long history of SATB1 research that is inherently linked with the concept of nuclear matrix, a putative nuclear structure which is highly associated with nuclear RNAs. SATB1 was described many times as a nuclear matrix protein (https://doi.org/10.1016/0092-8674(92)90432-c; https://doi.org/10.1128/mcb.14.3.1852-1860.1994; https://doi.org/10.1074/jbc.272.17.11463; https://doi.org/10.1128/mcb.17.9.5275; https://doi.org/10.1021/bi971444j; https://doi.org/10.1083/jcb.141.2.335; https://doi.org/10.1101/gad.14.5.521; https://doi.org/10.1038/ng1146).

      • Moreover, our data discussed in comments 4-7 of this Reviewer, such as i. the localization of SATB1 to the nuclear zones associated with RNA and nuclear scaffold factors (Fig. 2b, Supplementary Fig. 1c), ii. colocalization of SATB1 with actively transcribed RNAs (Fig. 2c, Fig. 3g, Supplementary Fig. 2a, Supplementary Fig. 2c), iii. including its association with nucleoli (Supplementary Fig. 3b), and also iv. its computationally predicted interaction with Xist lncRNA (Agostini et al., 2013; https://doi.org/10.1093/nar/gks968) as a notable factor of nuclear matrix, all suggest that the interaction between RNA and SATB1 is plausible and potentially relevant for its function and/or at least its subnuclear localization. It is relevant even more so, when considering numerous reports on the ability of RNA-binding, poly-Q and PrLD-containing proteins to undergo LLPS https://doi.org/10.1016/j.molcel.2015.08.018; https://doi.org/10.1042/bcj20160499; https://doi.org/10.1016/j.cell.2018.03.002; https://doi.org/10.1016/j.cell.2018.06.006; https://doi.org/10.1093/nar/gkaa681), including RNAs specifically regulating LLPS behavior, especially for poly-Q and PrLD-containing proteins, such as SATB1 (https://doi.org/10.1126/science.aar7366; https://doi.org/10.1126/science.aar7432; https://doi.org/10.1016/j.ceb.2019.03.007; https://doi.org/10.1038/s41598-020-57994-9; https://doi.org/10.1016/j.molcel.2015.09.017; https://doi.org/10.1038/s41598-019-48883-x; https://doi.org/10.1038/s41467-019-11241-6).

      • It should also be noted that SAF and various hnRNPs, as the most prominent proteins of nuclear matrix were many times reported to phase separate (https://doi.org/10.1016/j.molcel.2019.10.001; https://doi.org/10.1074/jbc.ra118.005120; https://doi.org/10.1016/j.celrep.2019.12.080; https://doi.org/10.1038/s41467-019-09902-7; https://doi.org/10.1016/j.molcel.2017.12.022; https://doi.org/10.1074/jbc.tm118.001189). All these aspects show that the relation between nuclear matrix, SATB1 and RNA are quite relevant to our manuscript.

      • Moreover, in light of the aforementioned information, we believe that it is much clearer to follow the protocol we did – i.e. to remove soluble proteins by CSK treatment and then, upon RNase treatment, extract the released proteins using ammonium sulfate. In an experiment utilizing whole cells, one would need to microinject RNase A into the nucleus, which 1. is very challenging for primary T cells having a radius of 3-5 micrometers, 2. is of low throughput, 3. would not allow for released protein removal which would thus make the results hard to interpret. Please note that in the reference paper, the authors used cell lines overexpressing heterologous GFP-tagged proteins, which is not related to our setup.

      Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Reply to the Reviewers

      I thank the Referees for their...

      Referee #1

      1. The authors should provide more information when...

      Responses + The typical domed appearance of a hydrocephalus-harboring skull is apparent as early as P4, as shown in a new side-by-side comparison of pups at that age (Fig. 1A). + Though this is not stated in the MS 2. Figure 6: Why has only...

      Response: We expanded the comparison

      Minor comments:

      1. The text contains several...

      Response: We added...

      Referee #2

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      This paper looks at in important nuclear matrix protein SATB1, which is a well known global chromatin organizer and help chromatin loop attach to the nuclear matrix. The paper starts with identification of novel short and long form of SATB1. Both the isoform consist of a prion like low complexity domains, but the long isoform additionally contain an extra EPF domain next the Prion like low complexity domain. The paper reports that in murine cells the long isoform is 3-4 fold more abundant than the short isoform. By using STED microscopy they show SATB1 foci lie next to transcription sites in the nucleus. They conclude by looking at the spherical shape of the SATB1 foci and the susceptibility of SATB1 staining after 1,6 hexanediol treatment that SATB1 forms the small foci in the nucleus due to LLPS. The authors also use RAMAN spectroscopy to conclude a change in nuclear chemical space in absence of SATB1 but without much explanation about which chemical bond or nuclear sub structure change correspond to the change in principal component analysis from Raman spectroscopy. The authors use the light inducible aggregation cyr2 tag with the PrD domain of SATB1 and compare it with the Cry2-FUS-LC domain to conclude that the SATB1 LC domain can undergo LLPS. The authors hint at involvement of RNA and also DNA in the LLPS of the SATB1 but without going into any detail.

      The key conclusions of the paper are- A) SATB1 undergoes LLPS. But this conclusion is drawn after correlative experiments as detailed below-

      1. observation of spherical punctae by STED-which could also seem spherical due to their small size. The resolution limit achieved by the STED microscopy used in this paper is not determined or mentioned clearly.
      2. No live cell FRAP experiment with fluorescent SATB1 long or short isoform to show that these foci are liquid like
      3. Lack of better staining with antibody against the long and short SATB1 isoforms after treatment with 1,6 Hexanediol. 1, 6 Hexanediol treatment can change many other chromatin associated proteins to which SATB1 can be bound to indirectly. This experiment can
      4. Lack of in vitro reconstitution experiments with purified long and short SATB1
      5. LLPS is strongly coupled to the cellular concentration of the proteins. Authors should quantify the cellular concentration of the long and short isoform in the cells.

      Major conclusion B)- SATB1 regulates transcription and splicing.

      This was also shown previously and in this paper they show the close proximity of the transcription site and SATB1 foci by microscopy. Hexanediol tretamnt which lead to loss of colocalization between FU foci and SATB1 is also taken as an evidence in regulation of transcription is not right as the transcription foci itself can be dissolved using 1,6 Hexanediol. Although the rate of transcription is not measured quantitatively.

      Major conclusion C)-Post transcriptional modification is important for SATB1 function.

      This point is just barely touched upon in the last figure of the paper

      Overall I find that the major conclusion-point A and B , is based on very indirect experiments and needs much more convincing data and the role of SATB1 LLPS in cells should be demonstrated more rigorously. And conclusion C is barely described and needs a lot more cell biological and genetic evidence.

      I do not recommend publishing the paper in current state. The story needs much more experiment to convincingly prove the major conclusions. Further, the MS needs more careful thinking and presentation to make it streamlined.

      Minor comments:

      One of the major flaw of the paper is the use too many techniques without proper explanation. E.g. use of STED and RAMAN microscopy need controls and explanation on what is being quantified. The use of Raman microscopy to quantify the nuclear environment of nucleus is not related to the chromatin organization or LLPS of SATB1 at all. And no information is provided at all which aspect of nuclear organization is being measured in Raman and what it means for the LLPS of SATB1.

      Similarly for Hexanediol treatment, duration of treatment is missing. Hexanediol can also dissolve the liquid like transcription foci. And hence a decrease in correlation between SATB1 foci and FU foci cannot be taken as a measure of SATB1 foci connection to transcription alone

      It is not very clear how many times the STED or Raman microscopy is done on how many samples and biological replicates. Similarly for RNA sequencing number of samples and description of controls are missing. Also if the sequencing data is made publicly available is not clear.

      Can they use the all and long isoform antibodies together, then subtract the signal from long isoform to conclude about the localization of the shorth isoform ?

      Additional control is needed to report the resolution limit of Superresolution techniques-STED and 3D-SIM systems used by them.

      Would be very helpful if the zonation was plotted for the FluoroUridine(FU) also to show that Zone1 (heterochromatin) is completely depleted of FU, and is present in other regions.

      Scale bar needed figure 3d

      Perfectly rounded SATB1 foci- this does not mean LLPS. For LLPs measurement, protein condensate dynamics measurement by FRAP or fusion experiments is required. What is the size of condensates? and cellular concentration of SATB1 ? Will SATB1 undergo LLPS in vitro at similar concentrations? does SATB1 interact with DNA or RNA to undergo LLPS ?

      After careful reading of the MS I conclude that the main conclusions of the paper are very preliminary and need much more detailed experiments. So does not qualify to get published at all at this stage.

      Significance

      The present manuscript tries to connect the phase separation of SATB1 to understanding the mechanism of SATB1 function in cells. One of the major hallmarks of phase separation is dynamic, liquid-like behaviour and in absence of these measurements, it is very difficult to say that the current manuscript has made any contribution to showing that SATB1 can phase separate.

      The presence of 2 isoforms of SATB1 is a novel finding and the paper could have focussed more on this. E.g. elucidate expression of the isoform during thymocyte development and maturation.

      As a reviewer my expertise are cell biology experiments, microscopy, in vitro reconstitution assays, RNA binding proteins, RNA and RBP condensate formation. And I feel that the reconstitution experiments are an important tool for understanding phase behaviour of proteins and also to gauge if this behaviour can occur or not in cellular concentration and conditions. I do not have sufficient expertise in Raman microscopy and hence the information provided in the MS on this part was not enough to understand the experiment and conclusions drawn from it.

    1. automatically tag some of it as important

      For Outlook, the Flag for Follow-up feature could prove as an equivalent. Atm, there is no AI/Auto prioritization, but this can be achieved using Filters.

    1. Reviewer #2 (Public Review):

      Here Wang et al have studied the role of the actin cytoskeleton in Trichomonas vaginalis pathogenicity with a focus on understanding the role of the actin cytoskeleton in transitioning from fast-moving flagellates to adherent ameboid cells. Intriguingly they determined that the adherent TH17 strain contains more actin and the actin-bundling protein alpha-actinin than the less adherent T1 strain. The adherent strain more readily morphs into the adherent ameboid form which has more polymerized F-actin than the flagellated form. Disruption of actin polymerization with LatB prevents ameboid morphogenesis and blocks adhesion. Although LatB treatment interferes with adhesion the authors show that their relatively short LatB treatments do not alter the distribution of adhesive molecules such as AP, PFO, and CLP on the cell surface.

      To understand how actin is being regulated in T. vaginalis the authors pulldown HA-tagged Tvactin and identify interacting partners with mass spectroscopy. They identify TVAG_47023 as a potential protein of interest due to homology with capping protein and name this protein TvFACP. The authors demonstrate that TvFACP can IP actin from cell extracts. They then proceed to purify His-TvFACP and GST-Tvactin to demonstrate direct interaction. Their approach of using bacterial-expressed actin is non-conventional since it is well known that eukaryotic actin requires several chaperones not present in prokaryotes for proper folding. As expected Tvactin was insoluble and was found in inclusion bodies. The authors used urea to solubilize the protein some of which re-folded into soluble protein after buffer exchange. A major concern with this experiment is that the authors did not use any other assay to confirm that their bacterially expressed actin behaved as expected. They should have verified filament formation by negative EM staining or labeled some of the actin for TIRF microscopy assays. Additionally, the 26 kD GST tag has the potential to interfere with actin dynamics which is why most studies remove affinity tags. Alternatively, the authors could have tested binding with commercially available actin. The authors then proceeded to use the purified components to determine the Kd for Tvactin and TvFACP. Intriguingly the authors determine the Kd is lower for G-actin than F-actin indicating that TvFACP preferentially binds to non-filamentous G-actin which is in contrast to canonical capping protein. However, since the quality of this actin is not verified it is not clear that the assay results can be trusted. Despite the preferential association of TvFACP for G-actin in the in vitro assays, localization studies indicate that TvFACP is associated with phalloidin stained structures which indicates that there is an association of TvFACP with filamentous actin structures. Overexpression of TvFACP reduces the ratio of polymerized to unpolymerized actin.

      The authors then explore whether TvFACP might have a role in regulating the transition between flagellated trophozoites and ameboid trophozoites. It was determined that TvFACP has a role in preventing F-actin formation in flagellates. The authors then determined that Ser2 is a phosphosite that regulates the association of TvFACP with actin. An S2A mutant that cannot be phosphorylated associates with actin and prevents ameboid morphogenesis while an S2D mutant does not associate with actin or alter morphogenesis. Since TvFACP S2 is a predicted Casein kinase II (CKII) phosphorylation site, the authors tested the ability of the CKII inhibitor TBB to alter phosphorylation and the association of TvFACP with actin. They found that TBB inhibited phosphorylation and increased the association of TvFACP with actin consistent with the S2A point mutation. Although the result is consistent with the alanine and phosphomimetic mutants, the authors used 250uM of inhibitor which could certainly result in off-target results. As a point of comparison, the IC50 for TBB is reported to be 0.5 uM so here the inhibitor was used at 500x the reported IC50, and at this high level the reduction in phosphorylation may be non-specific for CKII.

      Overall, the results of the manuscript align to support a role for TvFACP in regulating morphogenesis between fast swimming flagellated trophozoites and slow crawling adherent ameboid trophozoites and points toward a potential signaling pathway that regulates this transition. However, in addition to the two technical issues raised above, the relationship between TvFACP and its binding to F- and G- actin remains incompletely resolved. To determine if Tv F-actin capping protein truly binds F-actin the authors should perform TIRF microscopy to determine if TvFACP would be found at the end of filaments and also reveal the extent to which TvFACP alters actin organization and dynamics.

    1. Author Response

      Reviewer 2

      The manuscript by Huisjes et al presented an open-source platform for the storage and processing of imaging data, particularly for single-molecule imaging experiments. Compared to sequencing data, which have a more standardized format for data storage, imaging data have more diverse formats due to the fact that different research labs tend to use different instruments and software (either commercial or home-built) for data collection and analysis. Manual input is almost always necessary at certain steps of data analysis. All these create difficulties in data storage and reproducibility. The authors provide a practical solution to this problem by the molecular archive suite, "Mars". This platform is integrated into imageJ/Fiji, and can be used for storing detailed description of experimental settings, performing standard imaging processing steps, and recording manual input information during data analysis. I judge this platform, if fully functional and generalizable, will be very useful to many labs who are using single-molecule imaging methods in the research.

      Strength:

      1. The work presented a fairly user friendly interface (using Fiji directly), and fairly detailed protocol and other documentations in a very nicely designed website. I was able to download and use it based on the tutorial.

      2. It is integrated very well with Fiji, and some analysis modules are directly from existing Fiji analysis/plugins.

      Weakness:

      I invited one of my students to co-test the suite. We tried on both Mac and Windows systems, using the example FRET data set described in the manuscript and one of our own single-molecule images. We encountered some technical issues.

      We are very happy with the overall positive assessment of the reviewer that Mars could offer a common format that helps to enforce reproducible analysis workflows that can easily be shared with others.

      We are grateful for the additional feedback and testing done by the reviewer and her student. Ensuring that Mars works as expected on all computers and configurations is difficult given that we don’t have them at hand for testing ourselves. During the revision period, we have done more testing on more computer systems and we hope we have addressed the issues. We believe it will be impossible for us to guarantee that Mars works without problems on the first try for everyone. Therefore, Mars is a community partner on the Scientific Community Image Forum where users can report their problems in posts with the mars tag and we can help troubleshoot them (https://forum.image.sc/tag/mars). We believe this approach will offer the best support going forward. Nevertheless, we continue to make improvements and test to make sure all bugs we discover are addressed.

      In the revision, we completely reworked the smFRET example workflow and added two additional workflows to address all the comments from the reviewers and reviewing editor. In addition to expanding the explanations, and troubleshooting information on the Mars documentation website, we also created a YouTube channel with tutorial and example videos (https://www.youtube.com/channel/UCkkYodMAeotj0aYxjw87pBQ). We go through the new dynamic smFRET workflow from start to finish in one of the videos provided (https://www.youtube.com/watch?v=JsyznI8APlQ). We hope this will make it clear what inputs and outputs are expected and how the workflow should proceed. This was done on a mac but we have also tested this workflow on windows without encountering problems.

  3. Jul 2022
    1. Privacy <iframe src="https://www.googletagmanager.com/ns.html?id=GTM-57GHMWX" height="0" width="0" style="display:none;visibility:hidden"></iframe> Skip to content window.googletag = window.googletag || { cmd: [] }; window.googletag.cmd.push(function() { googletag.display("nav-ad"); }); TechRepublic Search Close Search Top Products Lists Developer 5G Security Cloud Artificial Intelligence Tech & Work Mobility Big Data Innovation Cheat Sheets TechRepublic Academy CES Toggle TechRepublic mobile menu More TechRepublic Premium Top Products Lists Developer 5G Security Cloud Artificial Intelligence Tech & Work Mobility Big Data Innovation Cheat Sheets TechRepublic Academy CES See All Topics Sponsored Newsletters Forums Resource Library TechRepublic Premium Join / Sign In Account Information TechRepublic close modal Join or sign in Register for your free TechRepublic membership or if you are already a member, sign in using your preferred method below. Use Your Email Use FacebookUse Linkedin Join or sign in We recently updated our Terms and Conditions for TechRepublic Premium. By clicking continue, you agree to these updated terms. Welcome back! Invalid email/username and password combination supplied. Reset password An email has been sent to you with instructions on how to reset your password. Back to TechRepublic Welcome to TechRepublic! Country United States Afghanistan Aland Islands Albania Algeria American Samoa Andorra Angola Anguilla Antarctica Antigua And Barbuda Argentina Armenia Aruba Australia Austria Azerbaijan Bahamas Bahrain Bangladesh Barbados Belarus Belgium Belize Benin Bermuda Bhutan Bolivia Bosnia and Herzegovina Botswana Bouvet Island Brazil British Indian Ocean Territory Brunei Darussalam Bulgaria Burkina Faso Burundi Cambodia Cameroon Canada Cape Verde Caribbean Netherlands Cayman Islands Central African Republic Chad Chile China Christmas Island Cocos (Keeling) Islands Colombia Comoros Congo Congo, DROC Cook Islands Costa Rica Cote D'ivoire Croatia Cuba Curazao Cyprus Czech Republic Denmark Djibouti Dominica Dominican Republic East Timor Ecuador Egypt El Salvador Equatorial Guinea Eritrea Estonia Ethiopia Falkland Islands (Malvinas) Faroe Islands Fiji Finland France French Guiana French Polynesia French Southern Territories Gabon Gambia Georgia Germany Ghana Gibraltar Greece Greenland Grenada Guadeloupe Guam Guatemala Guernsey Guinea Guinea-Bissau Guyana Haiti Heard And Mc Donald Islands Holy See (Vatican City State) Honduras Hong Kong Hungary Iceland India Indonesia Iran (Islamic Republic Of) Iraq Ireland Isle of Man Israel Italy Jamaica Japan Jersey Jordan Kazakhstan Kenya Kiribati Kuwait Korea, Republic Of Kosovo Kyrgyzstan Lao People's Democratic Republic Latvia Korea, Democratic People's Republic of Lebanon Lesotho Liberia Libyan Arab Jamahiriya Liechtenstein Lithuania Luxembourg Macau Macedonia Madagascar Malawi Malaysia Maldives Mali Malta Marshall Islands Martinique Mauritania Mauritius Mayotte Mexico Micronesia, Federated States of Moldova, Republic Of Monaco Mongolia Montenegro Montserrat Morocco Mozambique Myanmar Namibia Nauru Nepal Netherlands Netherlands Antilles New Caledonia New Zealand Nicaragua Niger Nigeria Niue Norfolk Island Northern Mariana Islands Norway Oman Pakistan Palau Palestinian Territory, Occupied Panama Papua New Guinea Paraguay Peru Philippines Pitcairn Poland Portugal Puerto Rico Qatar Reunion Romania Russia Rwanda S. Georgia And S. Sandwich Isles Saint Barthelemy Saint Kitts And Nevis Saint Lucia Saint Martin Saint Vincent And The Grenadines Samoa San Marino Sao Tome And Principe Saudi Arabia Senegal Serbia Serbia and Montenegro Seychelles Sierra Leone Singapore Sint Maarten Slovakia Slovenia Solomon Islands Somalia South Africa South Sudan Spain Sri Lanka St. Helena St. Pierre And Miquelon Sudan Suriname Svalbard And Jan Mayen Islands Swaziland Sweden Switzerland Syrian Arab Republic Taiwan Tajikistan Tanzania, United Republic Of Thailand Togo Tokelau Tonga Trinidad And Tobago Tunisia Turkey Turkmenistan Turks And Caicos Islands Tuvalu U.S. Minor Outlying Islands Uganda Ukraine United Arab Emirates United Kingdom Uruguay Uzbekistan Vanuatu Venezuela Viet Nam Virgin Islands (British) Virgin Islands (U.S.) Wallis And Futuna Islands Western Sahara Yemen Yugoslavia Zambia Zimbabwe By registering, you agree to the Terms of Use and acknowledge the data practices outlined in the Privacy Policy. You will also receive a complimentary subscription to TechRepublic's News and Special Offers newsletter and the Top Story of the Day newsletter. You may unsubscribe from these newsletters at any time. All fields are required. Username must be unique. Password must be a minimum of 6 characters and have any 3 of the 4 items: a number (0 through 9), a special character (such as !, $, #, %), an uppercase character (A through Z) or a lowercase (a through z) character (no spaces). Loading Account Information TechRepublic close modal Image: Chaosamran_Studio/Adobe Stock dataLayer.push({'post_author': "Franklin Okeke"}); window.googletag = window.googletag || { cmd: [] }; window.googletag.cmd.push(function() { googletag.display("leader-plus-top"); }); The 12 best IDEs for programming Account Information TechRepublic close modal Share with Your Friends The 12 best IDEs for programming Check out this article I found on TechRepublic. Your email has been sent by Franklin Okeke in Developer on July 7, 2022, 7:48 AM PDT The 12 best IDEs for programming IDEs are essential tools for software development. Here is a list of the top IDEs for programming in 2022. Image: Chaosamran_Studio/Adobe Stock Software developers have battled with text editors and command-line tools that offered little or nothing in the automation, debugging and speedy execution of codes. However, the software development landscape is rapidly changing, and this includes programming tools. To accommodate the evolution in software development, software engineers came up with more sophisticated tools known as integrated development environments. To keep up with the fast pace of emerging technologies, there has been an increasing demand for the best IDEs among software development companies. We will explore the 12 best IDEs that offer valuable solutions to programmers in 2022. Jump to: What is an IDE? The importance of IDEs in software programming Standard features of an IDE Classifications of IDEs Best IDEs for programmers Factors to consider when picking an IDE What is an IDE? IDEs are software development tools developers use to simplify their programming and design experience. IDEs come with an integrated user interface that combines everything a developer needs to write codes conveniently. The best IDEs are built with features that allow developers to write and edit code with a code editor, debug code with a debugger, compile code with a code compiler and automate some software development tasks. SEE: Hiring kit: Back-end Developer (TechRepublic Premium) The best IDEs come with class browsers to examine and reference properties, object browsers to investigate objects and class hierarchy diagrams to see object-oriented programming code. IDEs are designed to increase software developer productivity by incorporating close-knit components that create a perfect playground where they can write, test and do whatever they want with their code. Why are IDEs important in software programming? IDEs provide a lot of support to software developers, which was not available in the old text editors. The best IDEs around do not need to be manually configured and integrated as part of the setup process. Instead, they enable developers to begin developing new apps on the go. Must-read developer coverage The 12 best IDEs for programming Best DevOps Tools & Solutions 2022 CI/CD platforms: How to choose the right system for your business Hiring kit: Python developer Additionally, since every feature a programmer needs is available in the same development environment, developers don’t have to spend hours learning how to use each separately. This can be extremely helpful when bringing on new developers, who may rely on an IDE to familiarize themselves with a team’s standard tools and procedures. In reality, most IDE capabilities, such as intelligent code completion and automatic code creation, are designed to save time by eliminating the need to write out entire character sequences. Other standard IDE features are designed to facilitate workflow organization and problem-solving for developers. IDEs parse code as it is written, allowing for real-time detection of human-related errors. As such, developers can carry out operations without switching between programs because the needed utilities are represented by a single graphical user interface. Most IDEs also have a syntax highlighting feature, which uses visual clues to distinguish between grammar in the text editor. Class and object browsers, as well as class hierarchy diagrams for certain languages, are additional features that some IDEs offer. All these features help the modern programmer to turn out software development projects fast. For a programming project requiring software-specific features, it’s possible to manually integrate these features or utilities with Vim or Emacs. The benefit here is that software developers can easily have their custom-made IDEs. However, for enterprise uses, the above process might take time and impact standardization negatively. Most enterprises encourage their development teams to go for pre-configured IDEs that suit their job demands. Other benefits of IDEs An IDE serves as a centralized environment for the needs of most software developers, such as version control systems, Platform-as-a-Service and debugging tools. An IDE improves workflow due to its fast code completion capabilities. An IDE automates error-checking on the fly to ensure top-quality code. An IDE has refactoring capabilities that allow programmers to make comprehensive and renaming changes. An IDE ensure a seamless development cycle. An IDE facilitates developer efficiency and satisfaction. Standard features of an IDE Text editor Almost all IDEs will offer a text editor made specifically for writing and modifying source code. While some tools may allow users to drag and drop front-end elements visually, the majority offers a straightforward user interface that emphasizes language-specific syntax. Debugger Debugging tools help developers identify and correct source code mistakes. Before the application is published, programmers and software engineers can test the various code parts and find issues. Compiler The compiler feature in IDE assists programmers in translating programming languages into machine-readable languages such as binary code. The compiler also helps to ensure the accuracy of these machine languages by analyzing and optimizing them. Code completion This feature helps developers to intelligently and automatically complete common code components. This process helps developers to save time and reduces bugs that come from typos. Programming language support Although some IDEs are pre-configured to support one programming language, others offer multi-programming language support. Most times, in choosing an IDE, users have to figure out which programming languages they will be coding in and pick an IDE accordingly. Integrations and plugins Integration capability is one feature that makes an IDE stand out. IDEs support the integration of other development tools through plugins to enhance productivity. Classifications of IDEs IDEs come in different types and according to the programming languages they support. While some support one language, others can support more than one. Multi-language IDE Multi-language IDEs are IDE types that support multiple programming languages. This IDE type is best suited for beginner programmers still at the exploration stage. An example of this type of IDE is the Visual Studio IDE. It’s popular for its incredible supporting features. For example, users can easily code in a new programming language by adding the language plugin. Mobile development IDE As the market for mobile app development grows, numerous programming tools are becoming available to help software developers build efficient mobile apps. Mobile development IDEs for the Android and iOS platforms include Android Studio and Xcode. Web/cloud-based IDE If an enterprise supports a cloud-based development environment, it may need to adopt a cloud-based IDE. One of the advantages of using this type of IDE is that it can run heavy projects without occupying any computational resources in a local system. Again, this type of IDE is always platform-independent, making it easy to connect to many cloud development providers. Specific-language IDE This IDE type is a typical opposite of the multiple-language IDE. They are specifically built to support developers who work on only one programming language. Some of these IDEs include Jcreator for Java, Idle for Python and CodeLite for C++. Best IDEs for programmers in 2022 Visual Studio Microsoft Visual Studios The Visual Studio IDE is a Microsoft-powered integrated development interface developed to help software developers with web developments. The IDE uses artificial intelligence features to learn from the edit programmer’s make to their codes, making it easy for it to complete lines of code automatically. One of the top features many developers have come to like about Visual Studio is that it aids collaborative development between teams in live development. This feature is very crucial, especially during the debugging process. The IDE also allows users to share servers, comments and terminals. Visual Studio has the capability to support mobile app, web and game development. It also supports Python language, Node.js, ASP.NET and Azure. With Visual Studio, developers can easily create a development environment in the cloud. SEE: Hiring kit: Python developer (TechRepublic Premium) With its multi-language support, Visual Studio has features that integrate flawlessly with Django and Flask frameworks. It can be used as an IDE for Python on the Mac, Windows and Linux operating systems. IntelliJ IDEA IntelliJ IDEA IntelliJ Idea has been around for years and has served as one of the best IDEs for Java programming. The IntelliJ Idea UI is designed in a sleek way that makes coding appealing to many Java developers. With this IDE, code can get indexed, providing relevant suggestions to help complete code lines. It also takes this suggestive coding further by automating several tasks that may be repetitive. Apart from supporting web, enterprise, and mobile Java programming, it is also a good option for JavaScript, SQL and JPQL programming Xcode Xcode Xcode might be the best IDE tool for Apple product developers. The tool supports iOS app development with its numerous iOS tools. The IDE supports programming languages such as Swift, C++ and Object-C. With XCode, developers can easily manage their software development workflow with quality code suggestions from the interface. Android Studio Android Studio The Android Studio is one of the best IDEs for Android app development. This IDE supports Kotlin and Java programming languages. Some important features users can get from the Android Studio are push alerts, camera integrations and other mobile technology features. Developers can also create variants and different APKs with the help of this flexible IDE, which also offers extended template support for Google Services. AWS Cloud9 IDE AWS Cloud9 The AWS Cloud9 IDE is packed with a terminal, a debugger and a code editor, and it supports popular programming languages such as Python and PHP. With Cloud9 IDE, software developers can work on their projects from almost anywhere in the globe as long as they have a computer that is connected to the internet, because it is cloud-based. Developers may create serverless applications using Cloud9 and easily collaborate with different teams in different development environments. Eclipse Eclipse Eclipse is one of the most popular IDEs. It’s a cross-platform tool with a powerful user interface that supports drag and drop. The IDE is also packed with some important features such as static analysis tools, debugging and profiling capabilities. Eclipse is enterprise development-friendly and it allows developers to work on scalable and open-source software development easily. Although Eclipse is best associated with Java, it also supports multiple programming languages. In addition, users can add their preferred plugins to the IDE to support software development projects. Zend Studio Zend Studio Zend Studio is a leading PHP IDE designed to support PHP developers in both web and mobile development. The tool features advanced debugging capabilities and a code editor with a large community to support its users. There is every possibility that PHP developers will cling to the Zend IDE for a long time as it has consistently proven to be a reliable option for server-side programming. Furthermore, programmers can take advantage of Zend Studio’s plugin integrations to maximize PHP applications’ deployment on any server. PhpStorm PhpStorm PhpStorm is another choice to consider if users use PHP for web development. Although it focuses on the PHP programming language, front-end languages like HTML 5, CSS, Sass, JavaScript and others are also supported. It also supports popular website-building tools, including WordPress, Drupal and Laravek. It offers simple navigation, code completion, testing, debugging and refactoring capabilities. PhpStorm comes with built-in developer tools that help users perform routine tasks directly from the IDE. Some of these built-in tools serve as a version control system, remote deployment, composer and Docker. Arduino IDE Arduino Arduino is another top open source, cross-platform IDE that helps developers to write clean code with an option to share with other developers. This IDE offers both online and local code editing environments. Developers who want to carry out sophisticated tasks without putting a strain on computer resources love it for how simple it is to utilize. The Arduino IDE includes current support for the newest Arduino boards. Additionally, it offers a more contemporary editor and a dynamic UI with autocompletion, code navigation and even live debugger features. NetBeans NetBeans You can’t have a list of the best IDE for web development without including NetBeans. It’s among one of the most popular options for the best IDE because it’s a no-nonsense software for Java, JavaScript, PHP, HTML 5, CSS and more. It also helps users create bug-free codes by highlighting code syntactically and semantically. It also has a lot of powerful refactoring tools while being open source. RubyMine RubyMine Although RubyMine primarily supports the Ruby, it also works well with JavaScript, CSS, Less, Sass and other programming languages. The IDE has some crucial automation features such as code completion, syntax and error-highlighting, an advanced search option for any class and symbol. WebStorm WebStorm The WebStorm IDE is excellent for programming in JavaScript. The IDE features live error detection, code autocompletion, a debugger and unit testing. It also comes with some great integrations to aid web development. Some of these integrations are GitHub, Git and Mercurial. Factors to consider when picking an IDE Programming language support An IDE should be able to support the programming language used in users’ software development projects. Customizable text editors Some IDEs offer the ability to edit the graphical user interface. Check if the preferred IDE has this feature, because it can increase productivity. Unit testing Check if the IDE can add mock objects to some sections of the code. This feature helps test code straight away without completing all the sections. Source code library Users may also wish to consider if the IDE has resources such as scripts and source code. Error diagnostics and reports For new programmers, sometimes it’s good to have an IDE that can automatically detect errors in code. Have this factor in mind if users will need this feature. Code completion Some IDEs are designed to intelligently complete lines of code, especially when it comes to tag closing. If developers want to save some coding time from tag closing, check for IDEs that offer this option. Integrations and plugins Do not forget to check the integration features before making a choice. Code search Some IDEs offer the code search option to help search for elements quickly in code. Look for IDEs that support this productivity feature. Hierarchy diagrams If users often work on larger projects with numerous files and scripts that all interact in a certain way, look for IDEs that can organize and present these scripts in a hierarchy. This feature can help programmers observe the order of file execution and the relationships between different files and scripts by displaying a hierarchy diagram. Model-driven development Some IDEs help turn models into code. If users love creating models for the IDE, consider this factor before choosing an IDE. Programming language courses No matter what language you write or want to learn, TechRepublic Academy has a number of different programming courses to help you level-up your skills. Start with these: Python JavaScript Ruby on Rails All programming languages courses Developer Essentials Newsletter From the hottest programming languages to the jobs with the highest salaries, get the developer news and tips you need to know. Delivered Thursdays Sign up today Franklin Okeke Published:  July 7, 2022, 7:48 AM PDT Modified:  July 29, 2022, 10:40 PM PDT See more Developer Also See How to become a developer: A cheat sheet (TechRepublic) Python programming language: This training will jump-start your coding career (TechRepublic Academy) 8 must-have tools for developers on Linux (TechRepublic Premium) Programming languages and developer career resources (TechRepublic on Flipboard) window.googletag = window.googletag || { cmd: [] }; window.googletag.cmd.push(function() { googletag.display("mpu-plus-top"); }); (function() { if(isTRgamMobile && !isTRgamTablet && gam_is_topic) { var mpuPlusTopInsert = document.querySelectorAll(".list-featured .related-resources")[0]; var mpuPlusTopContent = document.getElementById('mpu-plus-top'); mpuPlusTopInsert.parentNode.insertBefore(mpuPlusTopContent, mpuPlusTopInsert); } })(); WHITE PAPERS, WEBCASTS, AND DOWNLOADS EaseUS Data Recovery Wizard Downloads from EaseUS Software Give It A Try! EaseUS Todo PCTrans Downloads from EaseUS Software Get It Today EaseUS Disk Copy for Disk Upgrade Downloads from EaseUS Software Download Now EaseUS RecExperts Downloads from EaseUS Software Download Now EaseUS Todo Backup Downloads from EaseUS Software Download Now window.googletag = window.googletag || { cmd: [] }; window.googletag.cmd.push(function() { googletag.display("native-rr-article"); }); window.googletag = window.googletag || { cmd: [] }; window.googletag.cmd.push(function() { googletag.display("mpu-middle"); }); (function() { if(isTRgamMobile && !isTRgamTablet && gam_is_topic) { var mpuMiddleInsert = document.querySelectorAll(".list-featured .related-resources")[1]; var mpuMiddleContent = document.getElementById('mpu-middle'); mpuMiddleInsert.parentNode.insertBefore(mpuMiddleContent, mpuMiddleInsert); } })(); window.googletag = window.googletag || { cmd: [] }; window.googletag.cmd.push(function() { googletag.display("mpu-bottom"); }); Account Information TechRepublic close modal Share with Your Friends The 12 best IDEs for programming Check out this article I found on TechRepublic. Your email has been sent Share: The 12 best IDEs for programming By Franklin Okeke Franklin Okeke is a freelance content writer with a strong focus on cybersecurity, search engine optimization, and software development content. Account Information TechRepublic close modal Contact Franklin Okeke Your message has been sent | See all of Franklin's content window.googletag = window.googletag || { cmd: [] }; window.googletag.cmd.push(function() { googletag.display("native-boap"); }); var boapAfterContent = document.querySelector(".article .categories"); var boapContent = document.getElementById('native-boap'); boapAfterContent.parentNode.insertBefore(boapContent, boapAfterContent); boapContent.style.height = 'auto'; boapContent.style.width = '100%'; Developer Software Top Products Editor's Picks Image: Rawpixel/Adobe Stock TechRepublic Premium TechRepublic Premium editorial calendar: IT policies, checklists, toolkits, and research for download TechRepublic Premium content helps you solve your toughest IT issues and jump-start your career or next project. TechRepublic Staff Published:  May 30, 2022, 9:30 AM PDT Modified:  May 31, 2022, 5:32 AM PDT Read More See more TechRepublic Premium Image: Jacob Lund/Adobe Stock Innovation Best tech products and most innovative AI/ML companies of 2022 TechRepublic contributing writers ranked the best tech in multiple categories, including VPNs, password managers, and headsets, as well as AI/ML companies. Connor R. Smith Published:  July 18, 2022, 7:01 AM PDT Modified:  July 18, 2022, 10:33 AM PDT Read More See more Innovation Image: Olga/Adobe Stock Developer Meta launches entry-level developer courses through Coursera Meta's new front-end, back-end, mobile and database development courses prepare entry-level professionals for development careers in less than eight months. Brenna Miles Published:  July 19, 2022, 7:48 AM PDT Modified:  July 21, 2022, 7:48 AM PDT Read More See more Developer Image: Nuthawut/Adobe Stock Software Best project management software and tools 2022 With so many project management software options to choose from, it can seem daunting to find the right one for your projects or company. We’ve narrowed them down to these nine. Sam Ingalls Published:  July 19, 2022, 12:25 PM PDT Modified:  July 29, 2022, 1:58 PM PDT Read More See more Software Apple announced iOS 16 on June 6, 2022 during the WWDC keynote. Image: Apple Mobility iOS 16 cheat sheet: Complete guide for 2022 Learn about the new features available with iOS 16, and how to download and install the latest version of Apple’s mobile operating system. Cory Bohon Published:  July 14, 2022, 7:00 AM PDT Modified:  July 29, 2022, 7:37 AM PDT Read More See more Mobility Image: Chaosamran_Studio/Adobe Stock Developer The 12 best IDEs for programming IDEs are essential tools for software development. Here is a list of the top IDEs for programming in 2022. Franklin Okeke Published:  July 7, 2022, 7:48 AM PDT Modified:  July 29, 2022, 10:40 PM PDT Read More See more Developer window.googletag = window.googletag || { cmd: [] }; window.googletag.cmd.push(function() { googletag.display("leader-bottom"); }); TechRepublic Premium TechRepublic Premium Industrial Internet of Things: Software comparison tool IIoT software assists manufacturers and other industrial operations with configuring, managing and monitoring connected devices. A good IoT solution requires capabilities ranging from designing and delivering connected products to collecting and analyzing system data once in the field. Each IIoT use case has its own diverse set of requirements, but there are key capabilities and ... Downloads Published:  May 26, 2022, 5:00 PM PDT Modified:  May 28, 2022, 8:00 AM PDT Read More See more TechRepublic Premium TechRepublic Premium How to recruit and hire an Operations Research Analyst Recruiting an Operations Research Analyst with the right combination of technical expertise and experience will require a comprehensive screening process. This Hiring Kit provides an adjustable framework your business can use to find, recruit and ultimately hire the right person for the job.This hiring kit from TechRepublic Premium includes a job description, sample interview questions ... Downloads Published:  May 19, 2022, 5:00 PM PDT Modified:  May 21, 2022, 12:00 PM PDT Read More See more TechRepublic Premium TechRepublic Premium Quick glossary: Industrial Internet of Things The digital transformation required by implementing the industrial Internet of Things (IIoT) is a radical change from business as usual. This quick glossary of 30 terms and concepts relating to IIoT will help you get a handle on what IIoT is and what it can do for your business.. From the glossary’s introduction: While the ... Downloads Published:  May 19, 2022, 5:00 PM PDT Modified:  May 21, 2022, 12:00 PM PDT Read More See more TechRepublic Premium TechRepublic Premium Software Procurement Policy Procuring software packages for an organization is a complicated process that involves more than just technological knowledge. There are financial and support aspects to consider, proof of concepts to evaluate and vendor negotiations to handle. Navigating through the details of an RFP alone can be challenging, so use TechRepublic Premium’s Software Procurement Policy to establish ... Published:  April 14, 2022, 5:00 PM PDT Modified:  April 16, 2022, 1:00 PM PDT Read More See more TechRepublic Premium Services About Us Newsletters RSS Feeds Site Map Site Help & Feedback FAQ Advertise Do Not Sell My Information Explore Downloads TechRepublic Forums Meet the Team TechRepublic Academy TechRepublic Premium Resource Library Photos Videos TechRepublic TechRepublic on Twitter TechRepublic on Facebook TechRepublic on LinkedIn TechRepublic on Flipboard © 2022 TechnologyAdvice. All rights reserved. Privacy Policy Terms of Use Property of TechnologyAdvice var REPORT_POST = {"ajax_url":"https:\/\/www.techrepublic.com\/wp-admin\/admin-ajax.php","nonce":"ac0f8f85a3","post_id":"3981951"}; var medusa_ajax = {"url":"https:\/\/www.techrepublic.com\/wp-admin\/admin-ajax.php"}; var load_more_posts = {"ajax_url":"https:\/\/www.techrepublic.com\/wp-admin\/admin-ajax.php","nonce":"e7122233fc"}; var share_email = {"ajax_url":"https:\/\/www.techrepublic.com\/wp-admin\/admin-ajax.php","nonce":"0c76aa4155"}; var email_author = {"ajax_url":"https:\/\/www.techrepublic.com\/wp-admin\/admin-ajax.php","nonce":"f085617501"}; var show_more_forum_posts = {"ajax_url":"https:\/\/www.techrepublic.com\/wp-admin\/admin-ajax.php","nonce":"82a930466d"}; var social_registration = {"ajax_url":"https:\/\/www.techrepublic.com\/wp-admin\/admin-ajax.php","nonce":"9c2163d8c6","site_url":"https:\/\/www.techrepublic.com"}; (function (undefined) {var _localizedStrings={"redirect_overlay_title":"Hold On","redirect_overlay_text":"You are being redirected to another page,<br>it may take a few seconds."};var _targetWindow="prefer-popup";var _redirectOverlay="overlay-with-spinner-and-message"; window.NSLPopup = function (url, title, w, h) { var userAgent = navigator.userAgent, mobile = function () { return /\b(iPhone|iP[ao]d)/.test(userAgent) || /\b(iP[ao]d)/.test(userAgent) || /Android/i.test(userAgent) || /Mobile/i.test(userAgent); }, screenX = window.screenX !== undefined ? window.screenX : window.screenLeft, screenY = window.screenY !== undefined ? window.screenY : window.screenTop, outerWidth = window.outerWidth !== undefined ? window.outerWidth : document.documentElement.clientWidth, outerHeight = window.outerHeight !== undefined ? window.outerHeight : document.documentElement.clientHeight - 22, targetWidth = mobile() ? null : w, targetHeight = mobile() ? null : h, V = screenX < 0 ? window.screen.width + screenX : screenX, left = parseInt(V + (outerWidth - targetWidth) / 2, 10), right = parseInt(screenY + (outerHeight - targetHeight) / 2.5, 10), features = []; if (targetWidth !== null) { features.push('width=' + targetWidth); } if (targetHeight !== null) { features.push('height=' + targetHeight); } features.push('left=' + left); features.push('top=' + right); features.push('scrollbars=1'); var newWindow = window.open(url, title, features.join(',')); if (window.focus) { newWindow.focus(); } return newWindow; }; var isWebView = null; function checkWebView() { if (isWebView === null) { function _detectOS(ua) { if (/Android/.test(ua)) { return "Android"; } else if (/iPhone|iPad|iPod/.test(ua)) { return "iOS"; } else if (/Windows/.test(ua)) { return "Windows"; } else if (/Mac OS X/.test(ua)) { return "Mac"; } else if (/CrOS/.test(ua)) { return "Chrome OS"; } else if (/Firefox/.test(ua)) { return "Firefox OS"; } return ""; } function _detectBrowser(ua) { var android = /Android/.test(ua); if (/Opera Mini/.test(ua) || / OPR/.test(ua) || / OPT/.test(ua)) { return "Opera"; } else if (/CriOS/.test(ua)) { return "Chrome for iOS"; } else if (/Edge/.test(ua)) { return "Edge"; } else if (android && /Silk\//.test(ua)) { return "Silk"; } else if (/Chrome/.test(ua)) { return "Chrome"; } else if (/Firefox/.test(ua)) { return "Firefox"; } else if (android) { return "AOSP"; } else if (/MSIE|Trident/.test(ua)) { return "IE"; } else if (/Safari\//.test(ua)) { return "Safari"; } else if (/AppleWebKit/.test(ua)) { return "WebKit"; } return ""; } function _detectBrowserVersion(ua, browser) { if (browser === "Opera") { return /Opera Mini/.test(ua) ? _getVersion(ua, "Opera Mini/") : / OPR/.test(ua) ? _getVersion(ua, " OPR/") : _getVersion(ua, " OPT/"); } else if (browser === "Chrome for iOS") { return _getVersion(ua, "CriOS/"); } else if (browser === "Edge") { return _getVersion(ua, "Edge/"); } else if (browser === "Chrome") { return _getVersion(ua, "Chrome/"); } else if (browser === "Firefox") { return _getVersion(ua, "Firefox/"); } else if (browser === "Silk") { return _getVersion(ua, "Silk/"); } else if (browser === "AOSP") { return _getVersion(ua, "Version/"); } else if (browser === "IE") { return /IEMobile/.test(ua) ? _getVersion(ua, "IEMobile/") : /MSIE/.test(ua) ? _getVersion(ua, "MSIE ") : _getVersion(ua, "rv:"); } else if (browser === "Safari") { return _getVersion(ua, "Version/"); } else if (browser === "WebKit") { return _getVersion(ua, "WebKit/"); } return "0.0.0"; } function _getVersion(ua, token) { try { return _normalizeSemverString(ua.split(token)[1].trim().split(/[^\w\.]/)[0]); } catch (o_O) { } return "0.0.0"; } function _normalizeSemverString(version) { var ary = version.split(/[\._]/); return (parseInt(ary[0], 10) || 0) + "." + (parseInt(ary[1], 10) || 0) + "." + (parseInt(ary[2], 10) || 0); } function _isWebView(ua, os, browser, version, options) { switch (os + browser) { case "iOSSafari": return false; case "iOSWebKit": return _isWebView_iOS(options); case "AndroidAOSP": return false; case "AndroidChrome": return parseFloat(version) >= 42 ? /; wv/.test(ua) : /\d{2}\.0\.0/.test(version) ? true : _isWebView_Android(options); } return false; } function _isWebView_iOS(options) { var document = (window["document"] || {}); if ("WEB_VIEW" in options) { return options["WEB_VIEW"]; } return !("fullscreenEnabled" in document || "webkitFullscreenEnabled" in document || false); } function _isWebView_Android(options) { if ("WEB_VIEW" in options) { return options["WEB_VIEW"]; } return !("requestFileSystem" in window || "webkitRequestFileSystem" in window || false); } var options = {}; var nav = window.navigator || {}; var ua = nav.userAgent || ""; var os = _detectOS(ua); var browser = _detectBrowser(ua); var browserVersion = _detectBrowserVersion(ua, browser); isWebView = _isWebView(ua, os, browser, browserVersion, options); } return isWebView; } function isAllowedWebViewForUserAgent(provider) { var googleAllowedWebViews = [ 'Instagram', 'FBAV', 'FBAN', 'Line', ], facebookAllowedWebViews = [ 'Instagram', 'FBAV', 'FBAN' ], whitelist = []; switch (provider) { case 'facebook': whitelist = facebookAllowedWebViews; break; case 'google': whitelist = googleAllowedWebViews; break; } var nav = window.navigator || {}; var ua = nav.userAgent || ""; if (whitelist.length && ua.match(new RegExp(whitelist.join('|')))) { return true; } return false; } window._nslDOMReady(function () { window.nslRedirect = function (url) { if (_redirectOverlay) { var overlay = document.createElement('div'); overlay.id = "nsl-redirect-overlay"; var overlayHTML = '', overlayContainer = "<div id='nsl-redirect-overlay-container'>", overlayContainerClose = "</div>", overlaySpinner = "<div id='nsl-redirect-overlay-spinner'></div>", overlayTitle = "<p id='nsl-redirect-overlay-title'>" + _localizedStrings.redirect_overlay_title + "</p>", overlayText = "<p id='nsl-redirect-overlay-text'>" + _localizedStrings.redirect_overlay_text + "</p>"; switch (_redirectOverlay) { case "overlay-only": break; case "overlay-with-spinner": overlayHTML = overlayContainer + overlaySpinner + overlayContainerClose; break; default: overlayHTML = overlayContainer + overlaySpinner + overlayTitle + overlayText + overlayContainerClose; break; } overlay.insertAdjacentHTML("afterbegin", overlayHTML); document.body.appendChild(overlay); } window.location = url; }; var targetWindow = _targetWindow || 'prefer-popup', lastPopup = false; var buttonLinks = document.querySelectorAll(' a[data-plugin="nsl"][data-action="connect"], a[data-plugin="nsl"][data-action="link"]'); buttonLinks.forEach(function (buttonLink) { buttonLink.addEventListener('click', function (e) { if (lastPopup && !lastPopup.closed) { e.preventDefault(); lastPopup.focus(); } else { var href = this.href, success = false; if (href.indexOf('?') !== -1) { href += '&'; } else { href += '?'; } var redirectTo = this.dataset.redirect; if (redirectTo === 'current') { href += 'redirect=' + encodeURIComponent(window.location.href) + '&'; } else if (redirectTo && redirectTo !== '') { href += 'redirect=' + encodeURIComponent(redirectTo) + '&'; } if (targetWindow !== 'prefer-same-window' && checkWebView()) { targetWindow = 'prefer-same-window'; } if (targetWindow === 'prefer-popup') { lastPopup = NSLPopup(href + 'display=popup', 'nsl-social-connect', this.dataset.popupwidth, this.dataset.popupheight); if (lastPopup) { success = true; e.preventDefault(); } } else if (targetWindow === 'prefer-new-tab') { var newTab = window.open(href + 'display=popup', '_blank'); if (newTab) { if (window.focus) { newTab.focus(); } success = true; e.preventDefault(); } } if (!success) { window.location = href; e.preventDefault(); } } }); }); var googleLoginButtons = document.querySelectorAll(' a[data-plugin="nsl"][data-provider="google"]'); if (googleLoginButtons.length && checkWebView() && !isAllowedWebViewForUserAgent('google')) { googleLoginButtons.forEach(function (googleLoginButton) { googleLoginButton.remove(); }); } var facebookLoginButtons = document.querySelectorAll(' a[data-plugin="nsl"][data-provider="facebook"]'); if (facebookLoginButtons.length && checkWebView() && /Android/.test(window.navigator.userAgent) && !isAllowedWebViewForUserAgent('facebook')) { facebookLoginButtons.forEach(function (facebookLoginButton) { facebookLoginButton.remove(); }); } });})();window.advads_admin_bar_items = [{"title":"Datalayer &amp; GAM Core","type":"ad"},{"title":"Before Closing Head Tag","type":"placement"},{"title":"TR | Master Ad Slot Definitions","type":"ad"},{"title":"Master Ad Slot Definitions Placement","type":"placement"},{"title":"TR | Skybox - Render","type":"ad"},{"title":"TR | Leader Plus Top - Render","type":"ad"},{"title":"TR | MPU Plus Top - Render","type":"ad"},{"title":"TR | Native Right Rail - Render","type":"ad"},{"title":"TR | MPU Middle - Render","type":"ad"},{"title":"TR | MPU Bottom - Render","type":"ad"},{"title":"TR | Leader Bottom - Render","type":"ad"}];!function(){window.advanced_ads_ready_queue=window.advanced_ads_ready_queue||[],advanced_ads_ready_queue.push=window.advanced_ads_ready;for(var d=0,a=advanced_ads_ready_queue.length;d<a;d++)advanced_ads_ready(advanced_ads_ready_queue[d])}(); #native-rr-article iframe, #native-main-well iframe, #native-boap iframe, #native-study-guide iframe, #native-in-article iframe { width: 100%; } #native-rr-article > div, #native-big-grid iframe, #native-big-grid > div { width: 100%; } #native-boap iframe { height: 20rem; } @media screen and (min-width: 500px) { #native-boap iframe { height: 20rem; } } @media screen and (min-width: 1100px) { #native-boap iframe { height: 20rem; } } #native-study-guide::before { content: ''; bottom: 0; width: 100%; position: absolute; border-width: 0 0 1px 0; border-style: solid; border-color: #eaeaea; border-color: rgba(0,0,0,0.19); } if( localStorage.getItem('shouldSendLoginEvent') === 'true' ) { localStorage.removeItem('shouldSendLoginEvent'); dataLayer.push({ 'event': 'user_login', 'has_premium': false, 'has_annual_subscription': true }); } (function(){function r(){function t(){var c=f.document,g=!!f.frames[u];if(!g)if(c.body){var l=c.createElement("iframe");l.style.cssText="display:none";l.name=u;c.body.appendChild(l)}else setTimeout(t,5);return!g}function D(){var c=arguments;if(c.length)if("setGdprApplies"===c[0]){if(3<c.length&&2===c[2]&&"boolean"===typeof c[3]&&"function"===typeof c[2])c[2]("set",!0)}else if("ping"===c[0]){var g={gdprApplies:g,cmpLoaded:!1,cmpStatus:"stub"};if("function"===typeof c[2])c[2](g)}else"init"===c[0]&& "object"===typeof c[3]&&(c[3]=Object.assign(c[3],{tag_version:"V2"})),w.push(c);else return w}function q(c){var g="string"===typeof c.data,l={};try{l=g?JSON.parse(c.data):c.data}catch(h){}var m=l.__tcfapiCall;m&&window.__tcfapi(m.command,m.version,function(h,x){h={__tcfapiReturn:{returnValue:h,success:x,callId:m.callId}};g&&(h=JSON.stringify(h));c&&c.source&&c.source.postMessage&&c.source.postMessage(h,"*")},m.parameter)}for(var u="__tcfapiLocator",w=[],f=window,v;f;){try{if(f.frames[u]){v=f;break}}catch(c){}if(f=== window.top)break;f=f.parent}v||(t(),f.__tcfapi=D,f.addEventListener("message",q,!1))}var y="false"!==google_tag_manager["GTM-57GHMWX"].macro(2)?google_tag_manager["GTM-57GHMWX"].macro(3):window.location.hostname,n=document.createElement("script"),z=document.getElementsByTagName("script")[0];y="https://cmp.quantcast.com".concat("/choice/",google_tag_manager["GTM-57GHMWX"].macro(4),"/",y,"/choice.js?tag_version\x3dV2");var A=0,E=3;n.async=!0;n.type="text/javascript";n.src=y;z.parentNode.insertBefore(n,z);r();var B=function(){var t=arguments;typeof window.__uspapi!== B&&setTimeout(function(){"undefined"!==typeof window.__uspapi&&window.__uspapi.apply(window.__uspapi,t)},500)};n=function(){A++;window.__uspapi===B&&A<E?console.warn("USP is not accessible"):clearInterval(F)};if("undefined"===typeof window.__uspapi){window.__uspapi=B;var F=setInterval(n,6E3)}})(); (function(){function r(a){b=",";for(var d in a)a[d]&&(b+=d+",");return b}function y(){var a=new XMLHttpRequest;a.onreadystatechange=function(){if(4==this.readyState&&200==this.status){var d=JSON.parse(this.responseText);d.hasOwnProperty("nonIabVendorList")&&(g=d.nonIabVendorList,Object.keys(g).forEach(function(k){h[g[k].vendorId]=g[k].name}))}};a.open("GET",D,!0);a.send()}function n(){var a=new XMLHttpRequest;a.onreadystatechange=function(){if(4==this.readyState&&200==this.status){var d=JSON.parse(this.responseText); d.hasOwnProperty("vendors")&&(q=d.vendors,Object.keys(q).forEach(function(k){f[q[k].id]=q[k].name}))}};a.open("GET",t,!0);a.send()}function z(a){window.dataLayer=window.dataLayer||[];window.dataLayer.push({event:"__cmpLoaded",__cmpLoaded:!0,gdpr:a.gdprApplies})}function A(a){window.dataLayer=window.dataLayer||[];a.hasOwnProperty("publisher")&&(H=r(a.publisher.consents),I=r(a.publisher.legitimateInterests));a.hasOwnProperty("purpose")&&(J=r(a.purpose.consents),K=r(a.purpose.legitimateInterests));var d= 0,k=setInterval(function(){d+=1;100===d&&clearInterval(k);q&&g&&(clearInterval(k),a.gdprApplies?a.hasOwnProperty("vendor")&&Object.keys(a.vendor.consents).forEach(function(e){if(a.vendor.consents[e]||!a.gdprApplies)c[e]=f[e],v[e]=e}):(c=f,f.forEach(function(e,C){v[C]=C})),w=c.filter(Boolean).join("|"),u=v.filter(Boolean).join(","),window.__tcfapi("getNonIABVendorConsents",2,function(e,C){C&&(e.gdprApplies?Object.keys(e.nonIabVendorConsents).forEach(function(p){if(e.nonIabVendorConsents[p]||!e.gdprApplies)G[p]= h[p],x[p]=p}):(G=h,h.forEach(function(p,L){x[L]=L})))}),m=G.filter(Boolean).join("|"),l=x.filter(Boolean).join(","),window.dataLayer.push({event:"__cmpConsents",__cmpConsents:{iabVendorConsentIds:u,iabVendorsWithConsent:w,nonIABVendorConsentIds:l,nonIABVendorsWithConsent:m,gdpr:a.gdprApplies,publisherConsents:H,publisherLegitimateInterests:I,purposeConsents:J,purposeLegitimateInterests:K}}))},100)}function E(a){google_tag_manager["GTM-57GHMWX"].macro(5)&&window.__uspapi("uspPing",1,function(d,k){var e=document.getElementById(google_tag_manager["GTM-57GHMWX"].macro(6)); k&&d.mode.includes("USP")&&d.jurisdiction.includes(d.location.toUpperCase())&&null!==e&&(e.innerHTML+='We use cookies and other data collection technologies to provide the best experience for our customers. You may request that your data not be shared with third parties here: \x3ca href\x3d"#" onclick\x3d"window.__uspapi(\'displayUspUi\');"\x3eDo Not Sell My Data\x3c/a\x3e.',e.classList.add("ccpa-msg-added"),window.__uspapi("setUspDftData",1,function(C,p){p||console.log("Error: USP string not updated!")}))})} var B=(new Date).getTime(),F=google_tag_manager["GTM-57GHMWX"].macro(7),t="https://test.cmp.quantcast.com/GVL-v2/vendor-list.json",D="https://cmp.quantcast.com".concat("/choice/",google_tag_manager["GTM-57GHMWX"].macro(8),"/",F,"/.well-known/noniab-vendorlist.json").concat("?timestamp\x3d",B),q,u,w,f=[],v=[],c=[],g,l,m,h=[],x=[],G=[],H,I,J,K;google_tag_manager["GTM-57GHMWX"].macro(9)&&(n(),y());window.__tcfapi("addEventListener",2,function(a,d){if(d)switch(a.eventStatus){case "cmpuishown":google_tag_manager["GTM-57GHMWX"].macro(10)&&z(a);break;case "tcloaded":google_tag_manager["GTM-57GHMWX"].macro(11)&& (z(a),A(a));google_tag_manager["GTM-57GHMWX"].macro(12)&&E(a);break;case "useractioncomplete":google_tag_manager["GTM-57GHMWX"].macro(13)&&A(a)}})})(); !function(b,e,f,g,a,c,d){b.fbq||(a=b.fbq=function(){a.callMethod?a.callMethod.apply(a,arguments):a.queue.push(arguments)},b._fbq||(b._fbq=a),a.push=a,a.loaded=!0,a.version="2.0",a.queue=[],c=e.createElement(f),c.async=!0,c.src=g,d=e.getElementsByTagName(f)[0],d.parentNode.insertBefore(c,d))}(window,document,"script","https://connect.facebook.net/en_US/fbevents.js");fbq("init","657434508554909"); fbq("track","PageView"); .tce4c1f91-be80-4604-86e2-8f66a678cc65 { color: #fff; background: #222; border: 1px solid transparent; } .tce4c1f91-be80-4604-86e2-8f66a678cc65.place-top { margin-top: -10px; } .tce4c1f91-be80-4604-86e2-8f66a678cc65.place-top::before { border-top: 8px solid transparent; } .tce4c1f91-be80-4604-86e2-8f66a678cc65.place-top::after { border-left: 8px solid transparent; border-right: 8px solid transparent; bottom: -6px; left: 50%; margin-left: -8px; border-top-color: #222; border-top-style: solid; border-top-width: 6px; } .tce4c1f91-be80-4604-86e2-8f66a678cc65.place-bottom { margin-top: 10px; } .tce4c1f91-be80-4604-86e2-8f66a678cc65.place-bottom::before { border-bottom: 8px solid transparent; } .tce4c1f91-be80-4604-86e2-8f66a678cc65.place-bottom::after { border-left: 8px solid transparent; border-right: 8px solid transparent; top: -6px; left: 50%; margin-left: -8px; border-bottom-color: #222; border-bottom-style: solid; border-bottom-width: 6px; } .tce4c1f91-be80-4604-86e2-8f66a678cc65.place-left { margin-left: -10px; } .tce4c1f91-be80-4604-86e2-8f66a678cc65.place-left::before { border-left: 8px solid transparent; } .tce4c1f91-be80-4604-86e2-8f66a678cc65.place-left::after { border-top: 5px solid transparent; border-bottom: 5px solid transparent; right: -6px; top: 50%; margin-top: -4px; border-left-color: #222; border-left-style: solid; border-left-width: 6px; } .tce4c1f91-be80-4604-86e2-8f66a678cc65.place-right { margin-left: 10px; } .tce4c1f91-be80-4604-86e2-8f66a678cc65.place-right::before { border-right: 8px solid transparent; } .tce4c1f91-be80-4604-86e2-8f66a678cc65.place-right::after { border-top: 5px solid transparent; border-bottom: 5px solid transparent; left: -6px; top: 50%; margin-top: -4px; border-right-color: #222; border-right-style: solid; border-right-width: 6px; } Alitools Guide βetaLink checked

      and seriously you don't mention visual code???

    1. A CMS for hosting, editing and maintaining markdown files AND a hosting service for publishing these as blogs.

      Another solution, in two steps:

      1. make your SOPs executable
      2. give them a promotion; make them first-class content (they should live on the site that you're publishing—although not necessarily front-and-center—not hidden away in the README of some ghost repo)

      See also: A New Publishing Discipline.

    1. To synchronize BMC Helix common services container images

      I've tried to run this section while harbor runs on http. This fails as docker login command is issued and thinks harbor is on SSL.

      The workaround is to do the following

      1. Create 4 replication rules.

      Name ade_part_01 Source resource registry https://containers.bmc.com Source resource filter Name bmc/lp0lz Source resource filter Tag {4.2.2-debian-10-r50,ade-authz-service-149,ade-file-service-e2830be-7,ade-identity-management-portal-12,ade-identity-management-service-15,ade-notification-service-9,adeops-util-v012,adeops-util-v013,adeops-util-v016,adeops-util-v019,adeops-util-v024,adereporting-21.3.02.02,adereporting-content-e0ab22f-251,adereporting-initdb-v001,adereporting-kafkacli-v002,adereporting-puller-7e41b3d-274,adereporting-renderer-dd91f81-216,adereporting-runner-7e41b3d-274,ade-tenant-management-automation-273,ade-tenant-management-portal-14,ade-tenant-management-service-7,ade-ui-content-service-18,aif-api-service-8150462-9,aif-clustering-ingestion-service-3a4ce1d-12,aif-clustering-query-service-3dfbda3-9,aif-clustering-service-08fa171-9,aif-core-service-fdfb78d-6,aif-incident-ingestion-service-3a0f0e2-8,aif-job-manager-service-ab85bfb-8,aif-machine-learning-utilities-8a08716-57,aif-ticket-service-d71f457-11,anomaly-detection-service-58e6996-5}

      Name ade_part_02 Source resource registry https://containers.bmc.com Source resource filter Name bmc/lp0lz Source resource filter Tag {authproxy-RSSO_Auth_Proxy_101,authproxy-RSSO_Auth_Proxy_110,authproxy-RSSO_Auth_Proxy_112,authproxy-RSSO_Auth_Proxy_80,bitnami-kafka-2.7.0-debian-10-r124,bitnami-minio-2021.4.18-debian-10-r0,bitnami-zookeeper-3.7.0-debian-10-r25,custom-elasticsearch-1.13.3,custom-postgresql-repmgr-12.9.0,custom-sec-ade-infra-clients-1,custom-sec-redis-5.0.12-alpine,custom-sec-victoriametrics-vminsert-v1.63.0-cluster,custom-sec-victoriametrics-vmselect-v1.63.0-cluster,custom-sec-victoriametrics-vmstorage-v1.63.0-cluster,es-proxy-nginx-service-6d2eb81-6,es-proxy-service-6d2eb81-6,event-ingestion-service-4c0353c-4,event-mgmt-service-fc008be-6,event-processor-service-199851c-10,event-service-a21ce51-7,haproxy-2.0.4,justwatch-elasticsearch_exporter-1.1.0,kibana-proxy-service-c4f46f6-6,kibana-service-c4f46f6-6,kubectl-latest,log-ingestion-service-ff04217-99,log-mgmt-service-ceb53d1-4,log-processing-service-726afae-6,logs-portal-eb0d3a5-8}

      Name ade_part_02 Source resource registry https://containers.bmc.com Source resource filter Name bmc/lp0lz Source resource filter Tag {metric-aggregation-service-6c4b171-9,metric-configuration-service-2b5ba78-7,metric-gateway-service-4a6caae-8,metricservice-6b50628-8,prometheus-ingestion-service-8659793-7,RSSO_21.3.00-DRRS0-3893,smart-graph-api-r841442-642-daas_ship-tkn_ship,smart-graph-controller-api-r841442-642-daas_ship-tkn_ship,smart-graph-controller-efsinit-r841442-642-daas_ship-tkn_ship,smart-graph-controller-security-r841442-642-daas_ship-tkn_ship,smart-graph-environment-controller-r841442-642-daas_ship-tkn_ship,smart-graph-instance-controller-r841442-642-daas_ship-tkn_ship,tctlrest-14,thirdparty-ingestion-service-6add794-5,truesight-credential-service-267,truesight-featureflag-service-272,0.9.0-debian-10-r35,bitnami-shell-10,bitnami-bitnami-shell-10-debian-10-r61,custom-sec-busybox-1.27.2,webhook-2102_20210218,elasticsearch-7.16.2-debian-10-r0,bitnami-elasticsearch-curator-5.8.4,kibana-7.16.2-debian-10-r0,fluentd-1.12.3-debian-10-r4}

      Name ade_part_02 Source resource registry https://containers.bmc.com Source resource filter Name bmc/lp0lz Source resource filter Tag {ade-ims-webhook-114,ade-itsm-identity-sync-199}

      1. Then you can synchronize them at will
    1. Oh dear, how hard it was to be indifferent like the others! She tried not to smile too much; she tried not to care. But every single thing was so new and exciting...

      Reading this passage reminded me of a young girl getting the chance to tag along with her older sister and friends to a night out - the way she tries to appear nonchalant like the others when everything is "so new and exciting" to her. She might be younger than the other girls, or maybe she is not as wealthy and therefore doesn't participate in these events as often.

    1. Does/did + Subject + verb + object (optional)+ question tag

      This is incorrect! Should be:

      *Do/Does + subject + base verb? *

      Do you like pizza? Does Sam like pizza?

    1. Review coordinated via ASAPbio’s crowd preprint review

      This review reflects comments and contributions by Oana Nicoleta Antonescu, Ruchika Bajaj, Sree Rama Chaitanya and Akihito Inoue. Review synthesized by Ruchika Bajaj.

      This study has characterized the function of Hero proteins in improving the recombinant expression of TAR DNA-binding protein in E. coli and restoration of enzymatic activity of firefly luciferase during heat and stress conditions. This study may be useful for future applications of Hero proteins in life sciences research. Please see below a few points offered as suggestions to help improve the study.

      • In introduction, 3rd paragraph, in context with “amino acid composition and length of Hero proteins”, please elaborate on the effect of these two factors on the function and stability of hero proteins.
      • The manuscript refers to “cis and trans” terms on several occasions. Please explain these terms in context with the association of Hero protein with the target proteins.
      • Introduction - A paragraph describing the origin of Hero proteins and the differences between the types of Hero proteins in the introduction section would be helpful for readers to understand the background on these proteins. For example, please explain the background on naming these proteins as Hero 7, 9, 11 etc. The genes SERF2, C9orf16, C19orf53, etc are mentioned in the plasmid construction section in the Material and methods. Please provide a brief explanation for the relationship between these genes and Hero proteins.
      • Please add more details in the Material and methods section, especifically in western blotting and the luciferase assay, to support the reproducibility of these experiments.
      • Figure 1A. Please explain the role of each component (for example factorXa) either in the text or the legend.
      • Figure 1B: Please add clarification regarding the normalization of lanes by total protein concentration.
      • Fig 1C. Please provide an explanation for the higher order bands in the western blot. The western blot using anti-FLAG antibodies shows non-specific bands. Alternative tags or antibodies or detection methods may be used, for example, GFP tag and in-gel fluorescence can be used to check the expression.
      • Figure 1D and 1E, the error bars are high. Suggest checking the data and providing the mathematical expressions used to calculate relative yields.
      • Figure 2D and E, the error bars are high, access to the raw data behind the graphs may aid interpretation. An explanation for the choice of temperatures 33 C and 37 C would be helpful. Is there any relation between the choice of temperature and the Tm of the protein? The protein is directly being treated at high temperature, similar experiments with cell-based assays would be helpful to understand the effect of the Hero proteins on the stability of Fluc. Would it be possible to report the mathematical expressions used to calculate “Remaining Fluc activity”. Recommend indicating n if these activities are calculated per mg of the protein. Please explain if the reduction in activity is due to loss of protein or loss of luminescence activity from each molecule of the protein.
      • Figure S1, access to the raw data would be helpful to understand the signal to noise ratio for activity.
      • Figure 2 and 3 show similar experiments with wild type and mutants, it may be possible to combine the figures (for example, to avoid the redundancy in Figure 2C and 3A).
      • Figure 3D and G, access to the raw data would be helpful to interpret the signal and noise ratio especially given the low values.
      • Figure 4, Can some further discussion be provided for the reason for higher residual activity for SM and DM than wild type? Tm experiments during stress conditions (heat shock and freeze thaw cycles) may be helpful to define the stability of Fluc and Fluc mutants.
      • Figure 5: Suggest including an explanation for choosing Proteinase K -among other proteases- for these experiments.
      • The residual activity is different in Figure 4 and 5, which could be due to different stress conditions. Please include some discussion about possible explanations.
      • In section “Hero proteins protect Fluc activity better in cis than in trans”, ‘When the molarity of recombinant GST, Hero9, and Hero11 proteins was increased by 10-fold...’ does molarity refer to the concentration of protein ?
      • In the first paragraph of the discussion, “physical shield that prevents collisions of molecules leading to denaturation” and “maintaining the proper folding” is mentioned. Is it the hypothesis for the mechanism behind the stability provided by Hero proteins? Can further discussion on this be provided, along with a relevant reference.
      • In the discussion section, it is mentioned that “Hero may be reminiscent of polyethylene glycol (PEG)”. Please provide further explanation for why hero proteins are correlated with PEG in this fragment.
      • A discussion on why specific Hero proteins may be better for specific target proteins may be helpful.
      • In the second paragraph, of the Discussion “Hero protein can behave differently depending on the client protein and condition” and “important to test multiple Hero proteins to identify one that best protects the protein of interest” are mentioned. Suggest adding further discussion of these points, for example around any alternatives or computational predictions or simulations to test individual Hero proteins for specific client proteins.
    1. He explains the purpose of his "waste book" in his notebook E: Die Kaufleute haben ihr Waste book (Sudelbuch, Klitterbuch glaube ich im deutschen), darin tragen sie von Tag zu Tag alles ein was sie verkaufen und kaufen, alles durch einander ohne Ordnung, aus diesem wird es in das Journal getragen, wo alles mehr systematisch steht ... Dieses verdient von den Gelehrten nachgeahmt zu werden. Erst ein Buch worin ich alles einschreibe, so wie ich es sehe oder wie es mir meine Gedancken eingeben, alsdann kann dieses wieder in ein anderes getragen werden, wo die Materien mehr abgesondert und geordnet sind.[2] "Tradesmen have their 'waste book' (scrawl-book, composition book I think in German), in which they enter from day to day everything they buy and sell, everything all mixed up without any order to it, from there it is transferred to the day-book, where everything appears in more systematic fashion ... This deserves to be imitated by scholars. First a book where I write down everything as I see it or as my thoughts put it before me, later this can be transcribed into another, where the materials are more distinguished and ordered."
    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      __Manuscript number: __RC-2022-01357

      __Corresponding author(s): __Peter Novick and Gang Dong

      1. General Statements [optional]

      We would like to thank both reviewers for their thorough and constructive evaluation and comments on our manuscript. Following their suggestions, we have reworked our manuscript and added several pieces of new data to address questions from them, including (1) evaluation of how M7 mutant of Sso2 affects its interaction with Sec3 using three independent methods (in vitro); (2) investigation of how the M7 mutant affects the interaction of Sso2 with Sec3 by co-immunoprecipitation (in vivo). We hope that, with all these further introduced changes, this manuscript will be suitable for publication in your journal. Detailed point-to-point responses are shown below.

      2. Point-by-point description of the revisions

      Reviewer #1 (Evidence, reproducibility and clarity (Required)): *

      Using the entire cytoplasmic domain of Sso2 and protein crystallization, Peer and colleagues show that two N-terminal peptides (NPY) of Sso2 synergistically interact with the Sec3 PH domain. This interaction provides an additional low affinity binding site to the previously published interface between the Sso2 four-helix bundle and the PH domain. Mutagenesis, in particular of both NPY motifs, results in reduced cell growth, in the accumulation of transport vesicles at the budding site, and in decreased secretion of invertase and Bgl2. The paper is well written, the data are convincing and the characterization of these novel peptide interaction sites clearly advances the field. Although, the exact role of the Sec3 NPY - Sec3 interaction still needs to be established, the overall functional relevance is apparent and thus the paper could be published with minor changes. *

      __Response: __We really appreciate the reviewer for his/her positive comments and clear/constructive feedbacks.

      *Nevertheless, the authors may consider to address the following issues to improve the manuscript. - To strictly exclude the possibility that the Sso2 NPY motif also interacts with other components of the exocytosis machinery (e.g. Sec1), thereby causing the observed phenotypes, Sec3 mutagenesis of the NPY motif-binding site would be required. *

      __Response: __It would be a good idea to generate reverse mutants on Sec3. However, the pocket on Sec3 bound by the NPY motifs of Sso2 is mostly hydrophobic and contains many semi-buried residues that are in close contact with other residues in the hydrophobic core of structure (including L78, Y82, I109, V112, V208, etc.; see Fig. S3D, E) and thus essential in maintaining the folding of Sec3. Making mutations on these residues would destabilize the folding of Sec3. This was why we have not done this as suggested by the reviewer.

      *- The authors suggest that the NPY-peptide binding contributes to the initial interaction/recruitment of Sso2 to the exocytosis site, defined by the localization of Sec3 (exocyst). Further data sustaining this concept/hypothesis could improve the impact of the manuscript. Thus, an experiment analyzing the co-distribution of the Sec3 with Sso2 would directly support the authors' conclusion. (In Figure 7, the authors already show the highly polarized distribution of Sec3-3xGFP.) The M7 mutant could impact the distribution of Sso2. In addition, it would be helpful to determine to which degree the Sso2 NPY - Sec3 PH domain interaction increases the overall affinity of Sso2 for the Sec3 PH domain; e.g. comparison of the binding of Sso2 (1-270) wt and M7 to Sec3 PH domain using ITC. *

      Responses:

      • We greatly value the reviewer’s suggestion. For the suggestion to investigate how the M7 mutant affects the co-distribution of Sso2 with Sec3 in yeast, we have tried a variety of conditions with both the original serum and affinity purified Sso antibodies. In neither case did we see a clear concentration at sites where we would expect to see Sec3, such as the tips of small buds. We were able to see some detectable concentration of HA-tagged Sso2 in small buds using anti-HA Ab, but it would be difficult to tag the M7 mutant at the same site since it is so close to the M7 mutation. We are also worried that the tag might interfere with Sec3 binding due to the proximity. Given the lack of detectable concentration of WT Sso2, it would not be possible to see a loss of localization in M7.
      • For the suggestion to check the binding of Sec3 with either the WT or M7 mutant of Sso2 (aa1-270), we have generated M7 mutant within the same fragment of Sso2 as the WT (i.e. aa1-270) and carefully checked how this M7 mutant affects the interaction of Sso2 with the Sec3 PH domain using three independent methods. Our ITC data show that WT Sso2 bound Sec3 very robustly, with a Kd of approximately 2 µM (Fig. 8C). Surprisingly, however, the M7 mutant of Sso2 (aa1-270) completely abolished its interaction with Sec3 (Fig. 8D). To further verify this observation, we carried out electrophoresis mobility shift assays (EMSA) and size-exclusion chromatography (SEC). Our EMSA data on a native PAGE gel shows that WT Sso2 (aa1-270) bound Sec3, whereas the M7 mutant did not (Fig. S5A, B). Similarly, our SEC data demonstrate that Sec3 was co-eluted with WT Sso2 in the higher molecular weight peak; in contrast, Sec3 and the M7 mutant of Sso2 (aa1-270) were eluted in separate peaks and no stable complex of the two was formed (Fig. S5C, D). All these new data confirm that the NPY motifs play an essential role in maintaining the stable interaction between Sso2 and Sec3, which would explain why the M7 mutant gave such dramatic phenotype in vivo (Fig. 4B-E; Fig. 5D-F; Fig. 6D, E). *Minor point: In the discussion, the authors should mention to which degree the NPY binding site within Sec3 is accessible for / occupied by other known exocyst components, or PI(4,5)P2, etc. *

      Response: __Thank you for the suggestion. A new diagram has been added to __Fig. 9E to compare the structures of the previously reported Sec3/Rho1 complex and the Sso2/Sec3 complex determined by us. It shows that the NPY binding site on Sec3 is on the opposite side of the membrane-binding surface patch. The NPY binding site is also far away from the Rho1 interacting site on Sec3 and thus does not interfere with Rho1 binding either.

      *Reviewer #1 (Significance (Required)):

      The manuscript significantly contributes to our understanding of how the vesicle tethering machinery interacts and coordinates the assembly of the membrane fusion machinery and will be of broad interest in the field of membrane trafficking. I am not an expert in X-ray crystallography. *

      __Response: __We sincerely appreciate this reviewer’s positive feedbacks.

      ***Referees cross-commenting**

      I agree with the comments of the other reviewer. It would be nice to show the effect of the M7 mutant in a reconstituted liposome fusion assay, but as already mentioned this may require an additional collaboration. Whether the relatively weak Sec3 - NPY interaction can be resolved in the liposome fusion assay needs to be shown.*

      __Response: __Please check our detailed answer to the other reviewer’s question about this.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)): * The manuscript of Peer et al. Describe the structural characterization of the interaction of the syntaxin-like Sso2 protein with the exocyst subunit Sec3. The authors identify here a dual NPY motif at the N-terminal part of Sso2 that binds to Sec3 and thus confers functionality. Using x-ray crystallography, they show a nearly full-length Sso2 in complex with Sec3, which reveals how Sso2 binds to Sec3. Subsequent mutagenesis shows that both NPY motifs act together in binding, and are both required for functionality in vivo, using established assays in localization of exocyst subunits, secretion assays and growth tests. Their data suggest an overall model how Sso2 is efficiently recruited by exocyst to promote vesicle secretion.

      This is__ an overall very complete and clear manuscript__, where the authors nicely demonstrate, how the two NPY motifs both contribute to efficient Sso2 interaction with Sec3. Their data further show that each motif alone can contribute to function, whereas loss of both motifs (the M7 mutant) result in deficient binding. Likewise, their established assays to determine cellular importance of the NPY motifs in Sso2 show that trafficking and localization in the secretory pathway is strongly impaired in the mutant. I only have a few questions and suggestions. *

      __Response: __Thank you for the positive feedback.

      *1. The authors present in Figure 4 the mutants. I recommend to show the alignment of the mutants (M5,M6,M7) similar to panel A in Figure S4 here to orient the reader. They could also be listed in Figure 3, since the authors have here the sequences. *

      Response: __Alignment of M5-M7 has been added in __Fig. 4A as suggested. Thank you.

      2. The authors previously showed that Sso2 mutants affect the Sec3 driven assembly and also the fusion. I am wondering if they have the tools ready to also conduct this assay with their M7 mutant, which has the strongest defect. I am aware that this may be challenging if the tools are not established here as in the previous collaboration (Yue et al., 2017). It may provide additional information on the functional crosstalk.

      Responses:

      • Thank you for the suggestion. However, we do not think it is necessary to perform such assay based on our new results. As shown in 8C&D and Fig. S5, we found that the M7 mutant of Sso2 (aa1-270) completely abolished its interaction with Sec3, which is in contrast to the robust interaction between the WT Sso2 (aa1-270) and Sec3. Therefore, we expect that the M7 mutant would fail to accelerate liposome fusion in the same way as we had previously seen for the WT Sso2.
      • On the other hand, we have to admit that to perform such assay would indeed be challenging for us as the PhD student who had carried out the in vitro liposome fusion assay has left our previous collaborator’s lab and it would take quite a while to re-establish the assay in our own group and to optimize various parameters in that assay. *3. Along the same line, it would be good if the authors show that the mutation also impairs the interaction of Sec3 and Sso2 in vivo. *

      Response: __We appreciate the reviewer’s suggestion and have carried out co-immunoprecipitation of Sec3-3×Flag and Sso2 from yeast extract to find out how the M7 mutant affects Sso2’s interaction with Sec3 (__Fig. S6). Our results show that in contrast to the clear signal of WT Sso2 pulled down by Sec3-3×Flag, the pull-down band for the M7 mutant was much weaker and at a similar level to the negative control. This is consistent with what we saw in our in vitro binding assays (Fig. 8D; Fig. S5).

      *4. I really like the similarity of the different Munc18-Syntaxin interactions and the Sec3-Sso2 interaction. Do the authors think that Sec3 is an ancestral fragment of a Sec1 like protein, which just maintained this interaction? *

      __Response: __This is a very interesting idea. However, it seems too speculative to us to draw such conclusion. It could also be due to co-evolution in function for Sec3 to use a simpler structure (i.e. PH domain) to mimic syntaxin binding of SM proteins and to employ the extra “add-on” NPY motifs as a handle to facilitate and regulate their interaction.

      1. *Small mistake in the discussionResponses: "plasmas membrane" *

      __Response: __This has been corrected. Thank you.

      *Reviewer #2 (Significance (Required)): Important advance in our understanding of Exocyst function, which deserves publication. I only had minor issues that can be addressed quickly. *

      __Response: __We sincerely appreciate the reviewer’s positive feedbacks and constructive suggestions.

    1. Most existing tools and browsers treat web pages and pieces of notes like complete black boxes of information. These tools know how to scan for keywords, and they have access to the metadata we use to tag our information like hashtags and timestamps, but unlike a human, most current tools don’t try to peer into the contents of our notes or reading materials and operate with an understanding of our information. With ratcheting progress in machine understanding of language, I think we have good high-quality building blocks to start building thinking mediums and information systems that operate with some understanding of our ideas themselves, rather than simply “this is some text”.
    1. “Conspiracy theory, like causality, works fantastically well as an explanatory model but only if you use it backwards. The fact that we cannot predict much about tomorrow strongly indicates that most of the explanations we develop about how something happened yesterday have (like history in general) a high bullshit content.” ― Peter J. Carroll, Psybermagick: Advanced Ideas in Chaos Magick
    1. Reviewer #1 (Public Review):

      In this Research Advance, the authors build on two earlier eLife papers that described and experimentally validated a mathematical model of the transcriptional response of yeast to heat shock in which unfolded proteins sequester Hsp70 away from Hsf1 promoting an Hsf1-driven transcriptional program, and report two new findings. First, they provide evidence that upon heat shock it is newly synthesized proteins rather than denatured mature proteins that sequester the Hsp70 chaperone away from Hsf1 permitting Hsf1 to bind to target genes and drive the heat shock-induced gene transcription program during the heat shock response (HSR), and, second, by analyzing the role of the Sis1 Hsp70 co-chaperone in the HSR they showed that Sis1 does not have a direct negative role in the HSR, but rather is needed for fitness during prolonged stress.

      Because recent studies using cycloheximide to block protein synthesis have suggested that it is newly synthesized proteins in the process of folding rather than denatured mature proteins that are the clients for Hsp70 responsible the HSR, the authors reconfigured their model by assuming that heat shock slows the folding of newly synthesized proteins and adding the rate of translation as a new input function. They validated their new model using a yeast strain that has an HSE-YFP reporter gene as an HSR readout, and showed that rapamycin treatment, which reduces the rate of translation, resulted in a decrease in the HSR, that is predicted with kinetics predicted by their new model. In addition, based on their own recent work showing that the Sis1, a J-protein chaperone, regulates the HSR by promoting Hsf1-Hsp70 association in the nucleus to repress Hsf1 activity under non-heat shock conditions, they also incorporated Sis1, a Hsp70 co-chaperone, as a new component of their model circuitry. By experimentally induced eviction of Sis1 from the nucleus, they observed reduced Hsf1 activity towards the HSE-YFP reporter in the absence of a temperature shift, as predicted by the model. The new model also accounted for the rapid initial and then subsequent slowing kinetics of the HSR as it reached a maximum, as well as the different levels of HSR induction at increasing temperatures above 35oC. Moreover, even though the SIS1 promoter has an HSE and its basal transcription is driven by Hsf1, the elimination of this regulatory step experimentally showed that Hsf1-driven Sis1 transcription was not required for temperature shift-induced HSR output, implying, as the model predicted, that increased Sis1 expression is not important and not needed for negative feedback inactivation of Hsf1. This was tested directly by generating a strain in which the SIS1 promoter was replaced with two copies of the SUP35 promoter to maintain the basal expression level of Sis1, which showed normal kinetics of HSR inactivation under several experimental conditions. Using a Halo-tag pulse protocol, they demonstrated that heat shock induction of newly synthesized Sis1-halo was delayed and that the new Sis1 protein was preferentially localized around the nucleolus away from Hsf1, as determined using an Nsr1-mScarlet nucleolar marker, and thus Sis1 would presumably not be in a position to promote Hsp70/Hsf1 interaction and repression of Hsf1 activity. Finally. to investigate what role Sis1 plays in heat-stressed cells, they showed that the 2xSUP35pr-SIS1 yeast strain had reduced fitness compared to the other strains after 4 hours at 37ºC, suggesting that Sis1 has an undefined role in maintaining fitness in heat-stressed cells. Consistent with this, they showed that Sis1 also has a role in maintaining fitness in yeast cells growing on a non-preferred carbon source.

      The updated model of the HSR, which still retains the two-component feedback loop consisting of the chaperone Hsp70 and the transcription factor Hsf1 of the original model but replaces the unfolded protein activation step with an equivalent step involving unfolded newly synthesized proteins, appears to be able to model cellar responses to heat shock quite accurately. This refinement of their model, coupled with the demonstration that the Sis1 J protein chaperone does not appear to play a direct role in the inactivation phase of the HSR, provide a significant advance over their earlier work.

      A main weakness is that while the evidence that Sis1 is important for fitness of heat-stressed yeast cells is reasonable, exactly how Sis1 achieves this is not clear. In a single sentence the authors suggest that Sis1 might be an orphan ribosome chaperone, partly based on its nucleolar localization, but provide no evidence for this. If this were true, then one might expect a reduction in ribosome content under stress conditions and a decreased rate of protein synthesis, which could be tested. Some further insights into this more general role of Sis1 would strengthen the authors' conclusions.

      Moreover, whether Sis1 plays a general role in the fitness of cells under stress has not been firmly established, i.e., is its mechanistic role the same in heat shock conditions and under nutrient stress conditions? Without knowing the mechanistic basis for how Sis1 maintains the fitness of heat-stressed cells, it is not possible to conclude that the same mechanism is at play in cells grown on a non-preferred carbon source.

      Figure 4: This is an ingenious experiment to study the subcellular localization of newly synthesized Sis1 in response to heat shock, compared to that of the heat-shock inducible Hsp70 Ssa1. However, based on the images presented in panel B it is hard to know how discrete the subnuclear distributions of Sis1 and Ssa1 really are, and ideally what is needed is to be able to analyze their localizations when both tagged proteins are expressed in the same cell, although this would obviously not be possible using the halo-tagged protein system. In addition, one would like to know the localization of Hsf1 in the cell at the same time. As it stands, these data seem overinterpreted, and it remains possible that dome other event such as an inactivating post-translational modification of Sis1 under heat shock conditions might be involved in inactivating its function.

      One way to establish whether Sis1 nucleolar sequestration prevents it from acting on Hsf1 during the inactivation phase of the HSR would be to selectively disrupt its nucleolar localization signal eliminated while retaining its nuclear localization and determine how expression of such a mutant perturbed the inactivation kinetics of the HSR.

    1. The Map Is Not The Territory

      • The map is not the territory metaphorically illustrates the differences between belief and reality.
      • The phrase was coined by Alfred Korzybski.

      Scribbling on the map does not change the territory

      • If you change what you believe about an object, that is a change in the pattern of neurons in your brain.
      • The real object will not change because of this edit.

      The map is a separate object from the territory and the map exists as an object inside the territory

    1. Author Response

      Reviewer #1 (Public Review):

      Cheng et al. address one of the fundamental questions of gene expression regulation - what are the relative contributions of RNA-level and protein-level regulation to the final gene expression levels. In order to do that they take advantage of mainly published datasets, especially tumor datasets where matching somatic copy number alterations (SCNAs), RNA expression and protein expression data is available. Performing proteogenomic analysis (taking DNA, RNA and protein into account) they address several open questions, such as: Is gene compensation happening mainly at the RNA level, protein level or both for each gene? Is this the same across different tissue types and also cellular pathways? Taking advantage of the SCNAs in the DNA, the authors use correlation analysis of DNA to RNA and RNA to protein to determine if the expression of a gene is regulated mainly at the level of RNA or protein in the respective samples.

      Although it is mainly a very descriptive study, the meta-analysis of existing datasets (and one smaller dataset that was newly generated) yields very interesting observations, which will be of interest to the cancer and gene expression community. However, there is limited mechanistic insight into how the observations can be explained. This is not a problem in my view as the observations are interesting enough in themselves.

      The main findings of the study are:

      • In general genes are either regulated at the RNA-level or at the protein level, but rarely at both.

      • This is the first study (at least as far as I know) to look at tissue-specific RNA-level and protein-level compensation across several different tumor types. Interestingly, the authors show tissue specificity of RNA and protein-level compensation - for example lung adenocarcinoma does not show nearly any compensation.

      • Protein complex genes show stronger protein-level regulation than non-complex genes and the opposite trend in regards to RNA level regulation.

      • There seems to be an agreement for genes within the same pathway that they show a similar regulatory mode (either RNA level or protein level).

      • Genes involved in RNA processing, mRNA translation and mitochondrial regulation are generally upregulated at the protein-level in highly aneuploid primary tumor samples.

      However, I do think that two points need to be addressed by additional analyses to strengthen the findings.

      • The authors show that SCNAs are often significantly compensated at the protein-level in most tumor types. This compensation is also normally stronger than RNA level compensation. A technical issue about this finding that needs to be addressed is that this is mainly based on proteomics data that used TMT for quantification. TMT-based quantifications, although quite precise, are not always the most accurate measurements in the sense of capturing the true amplitude of changes. This is due to the so-called ratio compression of TMT mass spec data. The authors need to account for that in order to exclude that this technical limitation of TMT-based proteomics measurements is a main contributor to the protein-level compensation seen. Do the authors also have some proteomics data where label-free quantification of SILAC quantification was used? Do the same conclusions hold true when such data sets are used?

      We thank the reviewer for this comment and point which we have now addressed through the following literature search or analyses:

      • First, we found there are some previous studies which observed the similar protein-level compensation in yeast and human cells by different detection methods. Dephoure et al. compared two different methods, stable isotope labeling by amino acids in cell culture (SILAC) and tandem mass tag (TMT) based proteomics. The protein-level compensation of gained genes in yeast was discovered by both methods (Figure 2 and Figure 2 – figure supplement 1 of Dephoure et al., 2014). Similarly, Stingele et al. identified the protein-level compensation in pairs of isogenic diploid and aneuploid human cell lines by SILAC (Figure 2B of Stingele et al., 2012). Another group also found the protein-level compensation in primary human fibroblasts from individuals with Patau (trisomy 13), Edwards (trisomy 18) or Down (trisomy 21) syndromes by MS3-based approach (Hwang et al., 2021), which should eliminate the interference of ratio distortion (Ting et al., 2011). Taken together, those previous studies suggest the protein-level compensation should not be just the artifacts induced by the technical limitation of TMT-based proteomics.

      • To further validate the protein-level compensation, we performed the same analysis on TCGA (The Cancer Genome Atlas Program) (Research Network et al., 2013) COAD samples for which label-free proteomics data is available (Zhang et al., Nature, 2014). Consistent with TMT-based proteomics, significant compensation at the protein level was found, which is higher for complex genes than non-complex genes (Figure 1 – figure supplement 1C, Supplementary File 1G). As we observed before for COAD (Figure 1C), RNA-level compensation was shown in all groups of DNA change, and was stronger for non-complex genes (deep loss and high gain, FDR<0.005, Figure 1 – figure supplement 1C, Supplementary File 1G). These results suggest that the limitations imposed by the TMT quantification do not alter the conclusions of our analysis on gene compensation. We have now added this data in Figure 1 – figure supplement 1C and Supplementary File 1G and corresponding text at page 5.

      • Many of the statistically significant differences seen - e.g complexed proteins versus non-complexed proteins, highly conserved proteins versus less conserved proteins - have actually a relatively small effect size. It is not 100% clear to me that the authors apply always the most stringent and appropriate statistical evaluation. For example, when two density plots are compared and it is evaluated if the distributions differ significantly from each other (e.g. the median), the authors constantly use a bootstrapping strategy (most plots in Fig 2 and Fig S2). Due to the high number of iterations, bootstrapping is very sensitive to picking up statistical differences, even if there are very small effect size differences (as is the case for many of the comparisons). Would not a KS test be more appropriate to compare two density distributions? If a KS test is applied - do the authors still recapitulate the same statistical significance tendencies as seen with their bootstrapping strategy?

      We thank the reviewer for this comment, and we have addressed it in detail. We have performed the analyses using Mann-Whitney U test and Kolmogorov-Smirnov (KS) test (Supplementary File 2K). Compared with bootstrapping, the p-values calculated by Mann-Whitney U test or KS test were much smaller, close to zero. Therefore, the same statistical significance tendencies were observed no matter which statistic method was used (bootstrapping, Mann-Whitney U test or Kolmogorov-Smirnov test). While Mann-Whitney U test or KS test carries the risk of p-value inflation due to the high sample number, the bootstrapping method can solve the problem as it is independent from the sample number. Initially we had used Mann-Whitney U test for all our analyses and were suggested to include bootstrapping method after consultation with the NYU Biostatistics Resource.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      1. General Statements

      We would like to thank the reviewers for their insightful and useful comments about our manuscript. Based on these comments and as outlined in our revision plan, we plan to strengthen our findings by performing new experiments and quantitative analyses. This particularly applies to our nanoscale (dSTORM) imaging dataset which was discussed by multiple reviewers.

      We also appreciate the reviewers’ overall positive evaluation of the significance of our labeling method for the axon initial segment studies. With regards to this, we would like to highlight that this manuscript particularly addresses the labeling of “difficult-to-label” neuronal proteins, such as large ion channels and transmembrane proteins. Although we and another group have recently reported click labeling of neurofilament light chain (PMID: 35031604) and AMPAR regulatory proteins (PMID: 34795271) in primary neurons, both of these proteins have a small size between ~30-68 kDa and compared to larger ion channels/transmembrane proteins are “easier” to express in primary neurons. The novelty in the current manuscript is that we successfully applied this method for the labeling of large and spatially restricted AIS components, such as NF186 and Nav1.6 (186 and 260 kDa, respectively). As some of the reviewers also pointed out, the size and complexity of these proteins makes labeling of the AIS rather challenging. We also used our approach to study the localization of epilepsy-causing Nav1.6 variants and could exclude the retention in the cytoplasm as a possible cause of their loss of function. Finally, we improved the efficiency of genetic code expansion in primary neurons by developing AAV-based viral vectors. Although AAVs are routinely used for gene delivery to neurons, AAVs for click-based labeling need to encode multiple components of the orthogonal translational machinery for genetic code expansion. By trying different promoters and gene combinations, we developed several variants that enable high efficiency of the genetic code expansion in neurons. On their own, these findings will facilitate further genetic code expansion and click chemistry studies, beyond the labeling of the axon initial segment.

      2. Description of the planned revisions

      Reviewer #2

      • On lines 107 and 108, the sentence "The C-terminal HA-tag allowed us to detect the full-length NF-186 protein by immunostaining it with an anti-HA antibody" would have a better place just after lines 104-105 " [...] we modified the previously described plasmid (Zhang et al., 1998) by moving the hemagglutinin (HA) tag from the N terminus to the C terminus".

      We will modify the text as the reviewer suggested.

      • Fig.2b: the AnkG staining looks substantially longer than that showed in c. However, the results on AIS length show no significant changes in between the groups. This is visually misleading, the authors should choose a picture for the WT construct that is representative of the data.

      We thank the reviewer for bringing this up. We will replace the panel in Fig.2b with a more representative image of NF186 WT construct in the revised version of the manuscript.

      • Line 238: what is the rationale behind choosing these cells? For example, have they been used in other studies for similar purposes? If so, please provide the reference.

      We initially probed neuroblastoma ND7/23 which are commonly used for the electrophysiological recordings of recombinant Nav1.6 (PMID: 30615093, 22623668, 25874799, 27375106). Although we were able to record Na+ currents in those cells, only a small portion of channels was detected on the cell surface by microscopy (Suppl. Fig. 5a). As we discuss in the manuscript (lines 237-240), we then switched to N1E-115-1 cells in which we obtained a higher level of expression of the recombinant NaV1.6 channels on the cell surface (Suppl. Fig. 5b). These cells have also been previously used for the electrophysiological studies of voltage-gated sodium channels, including Nav1.6 (PMID: 8822380, 24077057). We will modify the text and include these references in the revised manuscript.

      • Figure 3c, the authors omitted the comparison with the WT construct this time, as opposed to the neurofascin experiments. What is the reason?

      As shown by others (PMID: 31900387) and us in this manuscript, one of the main issues with the expression of the recombinant NF186 in neurons was that overexpression led to mislocalization of NF186 in neuronal soma and processes. This was particularly true for WT construct and certain amber mutants (e.g. K809TAG). Based on previous reports (PMID: 31900387), we then tested a weak human neuron-specific enolase promoter. This reduced expression level and improved localization of NF186. However, since we still observed some neurons with mislocalized NF186 WT even with the enolase promoter, we found it important to quantitively compare the AIS length of WT construct and amber mutants to surrounding untransfected cells. On the other hand, since we did not have overexpression and mislocalization problem with Nav1.6 WT construct (all observed neurons have signal localizing in the AIS), we measured only the AIS length of the amber mutants. However, to avoid any confusion, we will also measure the AIS size of the neurons expressing Nav1.6 WT construct and compare it to surrounding cells and amber mutants. For this, we will need to perform new experiments and acquire new images. We will include the data in the revised manuscript.

      • Fig. 4: why did the authors chose these cells for electrophysiology experiments and not neurons? Explain the rationale in the text or, alternatively, cite similar studies using the same tool.

      Due to the branched neuronal processes which cause the space clamp problem in voltage clamp experiments with neurons, round and none-branching cells are frequently used to examine the biophysical properties of ion channels, including Nav1.6. By far, most of studies investigating the biophysical properties of NaV1.6 channels were performed in neuroblastoma cells e.g. ND7/23 and N1E-115-1 cells (PMID: 25874799; 25242737). We tested these two types of cells and found that N1E-115-1 cells supported higher expression level of the recombinant NaV1.6 channels on the cell surface than the ND7/23 cells (Suppl. Fig 5). Hence, N1E-115-1 were more suitable to get robust and reliable recordings (as we also discuss above in the response to reviewer’s comment). We will clarify this in the revised manuscript.

      • Fig.4, biophysical properties: did the authors find differences in passive properties? Measures of resting potential, membrane resistance and cell capacitance should be reported.

      Passive properties such as resting membrane potential and membrane resistance are important functional features in neurons measured in current clamp experiments, but not applicable for ND7/23 and N1E-115-1 cells used in our voltage clamp experiments. To measure the Na+ current mediated by WT or mutant NaV1.6 channels expressed in N1E-115-1 cells, the endogenous Na+ channels were blocked by tetrodotoxin and the endogenous K+ channels were blocked by tetraethylammonium chloride, CsCl and CsF in extracellular and intracellular solutions. Under these conditions, resting potential and membrane resistance are not relevant for experiments. Cell capacitance reflects the size of the cell surface area, which can affect the number of channels expressed on the cell surface. To eliminate the effect of different cell sizes, Na+ current densities normalized by cell capacitances were used in our experiments. We will report on these values in the revised manuscript.

      • Fig 4, STORM images. The periodic distribution of the dots should be enhanced with some sort of arrows or lines, for the non-specialist audience.

      Based on the comments from multiple reviewers, we plan to obtain additional dSTORM images of the neurons expressing recombinant Nav1.6 WT or amber mutants. We also intend to improve the visualization of these results by updating/modifying existing figures and including quantitative data.

      • Line 374: rat or mouse primary neurons?

      We are here referring to both, rat and mouse neurons. The images shown in Fig. 06 and Suppl. Fig. 08 were obtained from rat cortical neurons expressing Nav1.6 or fluorescent reporter. However, we were also able to successfully transduce mouse neurons with AAV92A carrying orthogonal translational machinery (data not shown). We will clarify this in the revised manuscript.

      **Referees cross-commenting**

      I fully agree with the following remarks from Reviewers #3, #4 and #5. This is a point that I have raised in my report too. The authors need better images to show the periodicity we visualization, and a quantification would be of great benefit to support the claim with numbers (and how these compare to similar studies in the literature):

      R3: 2. For the dSTORM analysis of the tagged Nav1.6 protein, I also cannot tell there is periodic organization from the image directly. Some analysis is needed there. R4: 2."As there was no obvious difference in the nanoscale organization of the NaV1.6WT 317 -HA or NaV1.6TAG 318 -HA channels (Fig. 4. e-g), these experiments confirmed that the NaV1.6 overexpression, TCO*A319 Lys incorporation, and click labeling did not affect the nanoscale periodic organization of the sodium channels in the AIS." It is clearly noticeable that for WT, the spot density is more compared to the other two mutants. Why is that so? Using cluster analysis, one can quantify spot density and discuss nanoscale organization quantitatively. The author should quantify the periodicity and compare it among different variants and with previous reports. R5: 3. The authors claim that there was no obvious difference in the nanoscale organization of the NaV1.6WT 317 -HA or NaV1.6TAG 318 -HA channels (Fig. 4. e-g), but it is hard to conclude this without any quantification and statistical analysis. Sodium channels have been shown to be associated with the membrane-associated periodic skeleton structures in neurons and average autocorrelation analysis has been developed to quantify the degree of periodicity of such structural organizations (Han et al. PNAS 114(32)E6678-E6685, 2017). The authors should use this approach to quantify and compare the average autocorrelation amplitudes.

      As we outlined in our responses to the individual reviewers’ comments below, we will address these questions by performing new experiments and quantifications.

      I also agree with these comments from Reviewers #3 and #5:

      R3: 4. It is unclear, for all the presented data, whether all the cells are collected from a single biological replicate or from multiple replicates. At least 2-3 replicates are needed to see the reproducibility in terms of labeling efficiency, and other related conclusions. R5: 1. The authors should indicate how many replicates were performed and how many cells were analyzed for each experiment.

      We thank the reviewers for bringing this up. By mistake, we omitted this important information. We will include it in the revised manuscript, but we would like to highlight here that each experiment was repeated at least 3 times.

      Reviewer #3

      1. There is some patch-like background from the 488 channel from the click reaction, some of which have very as strong signal as the staining on the neurons. What is the potential cause for this? With immunostaining on HA, the background doesn't affect too much on the image data interpretation. However, the major goal of this method development is to use it in live-cell without immunostaining. Without another reference, the high background might cause issues in data interpretation. Can the author also suggest way to avoid or lower this in the discussion?

      We thank the reviewer for bringing this up. We have occasionally observed patch-like background in what appears to be the cell debris. Such dead cells do not have an intact cell membrane and therefore can absorb cell-impermeable ATTO488-tetrazine dye during click labeling. This kind of background is also present in the control neurons transfected with the WT Nav1.6, which suggests that it originates from the UAA and tetrazine-dye accumulations. Additionally, since these patches are not visible with the immunostaining, they do not contain our protein of interest, which further confirms that they contain only dye and UAA accumulations. Depending on the neuron prep/quality before and after transfections, the presence of these patches is more or less obvious. However, despite the background we did not have problems identifying AIS during live cell imaging. Especially when overall neuronal health is optimal after transfections, AIS can easily be distinguished from patches that are positioned outside of labeled neurons. We will investigate this further and discuss it in the revised manuscript.

      1. For the dSTORM analysis of the tagged Nav1.6 protein, I also cannot tell there is periodic organization from the image directly. Some analysis is needed there.

      We will address this in the revised manuscript by performing additional experiments and quantifications. We also wrote a detailed answer below, in the response to the other reviewers.

      1. The authors use the AIS length as a parameter to evaluate the function of the clickable mutant of NF186, and using patch clamp for functional validation of the clickable mutant of Nav1.6. In both cases, the comparison is done between the mutant and the WT construct, but both in transfected cell and exogenously expressed. It's also worth comparing with untransfected cells as the true native situation.

      We agree with the reviewer that it is important to compare transfected cells with untransfected cells. As the reviewer points out, we have already performed some of these comparisons. When it comes to the NF186, we used the AIS length as a parameter to estimate if the expression of clickable mutant affected the AIS structure. As we show in the Fig. 02, we co-immunostained neurons transfected with NF186-HA WT or TAG constructs. We used HA antibody to detect neurons expressing NF186, while the ankG was used as a marker of the AIS length. To check if the AIS length of transfected cells is affected, we compared the length of transfected cells (expressing NF186, HA+) to surrounding untransfected cells (HA-). When it comes to the Nav1.6, we also compared the AIS length of cells expressing Nav1.6 (HA+) to surrounding untransfected cells (HA-). Similarly to the experiments with NF186, this allowed us to check if the expression of the recombinant Nav1.6 affect the AIS structure. What is missing is the comparison with untransfected conditions (i.e. neurons that are simply stained with ankG). We assume that is what the reviewer is referring to? We will also include these data in the revised manuscript. Furthermore, since we introduced a labeling modification in NaV1.6, we wanted to check if such modification would affect its function. To do so, as routinely done in the field (PMID: 25874799), we rendered the WT and TAG channels TTX-resistant and recorded only recombinant Na+ currents in neuroblastoma cells in the presence of TTX. Perhaps we misunderstand the reviewer’s comment, but in this regard measurements of untransfected cells are not relevant since they would not allow us to compare WT and TAG mutants.

      1. It is unclear, for all the presented data, whether all the cells are collected from a single biological replicate or from multiple replicates. At least 2-3 replicates are needed to see the reproducibility in terms of labeling efficiency, and other related conclusions.

      We thank the reviewer for the observation. By mistake, we omitted this important information. We will include in the revised version of the manuscript. We would like to highlight here that each experiment was repeated at least 3 times.

      Reviewer #4

      1."Confocal microscopy revealed that the hNSE promoter lowered the WT and clickable NF186-HA expression levels and consequently improved the localization of these proteins." Is the lower expression level a measure of localization improvement? How does the author conclude that the localization has improved?

      Previous report (PMID: 31900387) suggested that the overexpression of the recombinant WT NF186 can affect its trafficking, leading to the NF186 mislocalization. We observed the same in our experiments with CMV NF186 (in particular for NF186 WT). Hence, based on the PMID: 31900387 we probed weak neuron specific enolase promoter. Since the WT was the most problematic in terms of the ectopic expression, we checked if AIS localization was improved with enolase promoter for this construct. To this aim, we counted number of neurons that with mislocalized signal or with the signal in the AIS for both, CMV and enolase promoter. We could observe that number of neurons with mislocalized signal was lower for enolase promoter. Since there were more neurons with the AIS-specific signal when NF186 was expressed from enolase promoter compared to CMV, we concluded that enolase promoter lowered expression and improved localization of the NF186. Therefore, we used enolase promoter for click labeling of NF186 amber mutants. We will include the results of this analysis in the revised version of the manuscript.

      2."As there was no obvious difference in the nanoscale organization of the NaV1.6WT 317 -HA or NaV1.6TAG 318 -HA channels (Fig. 4. e-g), these experiments confirmed that the NaV1.6 overexpression, TCO*A319 Lys incorporation, and click labeling did not affect the nanoscale periodic organization of the sodium channels in the AIS." It is clearly noticeable that for WT, the spot density is more compared to the other two mutants. Why is that so? Using cluster analysis, one can quantify spot density and discuss nanoscale organization quantitatively. The author should quantify the periodicity and compare it among different variants and with previous reports.

      We thank the reviewer for these suggestions. We will address these remarks by performing additional new experiments and quantifications. The difference in the level of the expression of the recombinant Nav1.6 might explain differences in the spot density for WT vs. TAG clickable mutants. However, as the reviewer suggested quantitative analysis is needed to address these concerns. We also intend to quantify the periodicity and compare it among different variants and with previous reports. It is just important to note that in the current version of the manuscript we looked at the nanoscale organization of the subset of Nav1.6 channels. The reason being that we used anti-HA antibody which will only detect our recombinant protein which got incorporated into the AIS and not the endogenous Nav1.6.

      Minor comments

      1."Although NF186K809TAG 158 -HA (Supplementary Fig. 4) showed bright click labeling, we excluded it from the analysis due to its frequent ectopic expression along the distal axon." How frequently is this bright click labeling observed for this mutation? Is it not observed for other mutations at all? The authors should state this point clearly with some statistics.

      We are not sure what is the exact question from the reviewer. If we understand it correctly, the reviewer is asking us to quantify how frequent was the ectopic expression of this amber mutant compared to other mutants? And not the click labeling (as written in their original comment), since click labeling was observed for all the mutants independently of their ectopic expression?

      2."Immunostaining with anti-HA antibody revealed that the expression of NaV1.6WT 239 -HA on the membrane of the N1E-115-1 cells was higher than on the ND7/23 cells (Supplementary Fig. 5a-c). However, click labeling of both NaV1.6K1425TAG 240 -HA and NaV1.6K1546TAG 241 -HA with ATTO488-tz was not successful (Supplementary fig. 5d) indicating insufficient expression of the clickable constructs." Is this due to insufficient expression level or accessibility? The author should make this statement clear.

      We thank the reviewer for bringing this up. We will clarify this in the revised version of the manuscript. We believe that the click labeling of the K1546TAG mutant in N1E-115-1 cells is absent due to the insufficient expression of the channels on the membrane, since this mutant was successfully labeled in the primary neurons that represent more native environment and where Nav1.6 form high-density clusters. K1425TAG mutant is not labeled due to the insufficient expression on the membrane in N1E-115-1 cells as well. However, since this mutant is also poorly labeled in primary neurons, we can speculate that K1425TAG position might be less accessible for the tetrazine-dye compared to K1546TAG. To further support our claim that due to the insufficient expression click labeling is low/absent in neuronal cells, we can use NF186 as an additional example. When NF186 was expressed from strong CMV promoter, we observed click labeling for all the mutants in ND7/23 cells (Suppl. Fig.01). However, when CMV was replaced with neuron specific enolase promoter, the expression was of NF186 was substantially lower in ND7/23 cells and click labeling was absent (data not shown). We will clarify this in the revised manuscript.

      1. Authors should clearly state the drift correction procedure of 3D STORM data. What are the localization precision and photon count for 3D STORM experiments?

      We processed 3D dSTORM data in NIS-elements AR software. We used the automatic drift correction from the NIS-elements software that is based on the autocorrelation. We will provide further and updated information in the revised manuscript, including the localization precision and photon count for the new dSTORM images.

      1. "Click labeling of NaV1.6 channels in living primary neurons" What kind of primary neurons have been used for click labeling of NaV1.6 channels? Is there any specific reason why authors have chosen cortical neurons for labeling NF186? Does this labeling strategy depend on primary neuron type?

      For the establishment and click labeling of Nav1.6 we used primary rat cortical neurons (Fig. 03, Fig. 06). The same neuronal type has been used for click labeling of NF186 (Fig. 02). We established labeling of the AIS components in cortical neurons because we use those routinely in the laboratory. However, this labeling strategy does not depend on the neuronal type. As we show in Fig. 05, to study localization of the loss-of-function pathogenic Nav1.6 variants we used mouse hippocampal neurons. The reason for this is that in previous study the same neuronal type was used to characterize these two mutations (lines 361-362). This demonstrates nicely that method can be easily transferred to any neuronal type. Furthermore, we were also able to label Nav1.6 and NF186 in mouse cortical neurons (data are not shown in the manuscript). We will clarify this in the revised manuscript.

      Reviewer #5

      1.Throughout the manuscript, only one representative image containing one AIG is shown for each condition without statistics and quantifications, so the conclusions are not sufficiently convincing. For example, in Fig. 1b, c, e; Fig. 2b,c,d,e; Fig. 3b,c,d,e ; Fig. 5c; and Supplementary Fig.1-6, the authors should quantify the average fluorescence intensities both for HA immunostaining and ATTO488-tz labeling in different conditions, as well as the labeling ratios (fluorescence intensity ratios between ATTO488 and AF647/AF555) . Without statistics and quantifications, it is unclear whether there is any significant difference between the constructs with different TAG positions, or between different transfection methods (e.g., lipofectamine 2000 vs 3000).

      We agree with the reviewer that the quantitative analysis is important and we will provide more quantitative data in the revised manuscript. At the same time, we are a bit confused by this comment which seems to refer to missing quantifications in one of the schemes (Fig. 1) and overlooks existing quantifications (e.g. quantitative analysis of the data set from Fig. 5c is shown in Fig. 5d). However, as suggested by the reviewer and to strengthen our data, in addition to the quantifications already provided in the manuscript (e.g. Fig. 2d: AIS length of NF186TAG constructs; Fig. 3f: AIS length of Nav1.6 TAG constructs; Fig. 5d: click-labeling intensity of LOF mutants), we intend to quantify the differences between labeling ratios of different mutants and transfection methods. When it comes to the different transfection methods, some data is already provided in the manuscript (e.g. we counted number of transfected versus transduced neurons) but we intend to clarify and expand on this in the revised manuscript.

      1. The only quantification done was for the average AIS length, but the statistical tests should be performed between different conditions and the corresponding P values should be provided. It seems that the transfected neurons generally have a longer AIS length than the transfected neurons (Fig. 2d and 3f). Could the authors provide an explanation for this?

      We are a bit confused by the first part of this comment. We measured the AIS lengths of NF186 WT or NF186 TAG as well as Nav1.6 TAG and compared it to the AIS lengths of surrounding untransfected cells (Fig. 2d and Fig.03f). In addition, we compared the AIS lengths of the NF186 WT and TAG to each other, and Nav1.6 TAG to each other. To analyze the differences, we performed statistical tests and provided the corresponding p values in the figure legends (Fig. 02 and 03). Further details on the statistical analysis are provided in supplementary tables (Suppl. table 01 and 02). Regarding the 2nd question, we have also noticed that the AIS lengths of transfected neurons appear longer than those of untransfected cells. This seems to be more pronounced in the case of NF186 which is expressed at the higher level compared to the Nav1.6. The appearance of slightly longer AIS is most likely the consequence of the fact that recombinant constructs are overexpressed in the neurons that express endogenous NF186 and Nav1.6. However, this difference in the AIS length is not significant to the controls. We will discuss this further in the revised manuscript.

      1. The authors claim that there was no obvious difference in the nanoscale organization of the NaV1.6WT 317 -HA or NaV1.6TAG 318 -HA channels (Fig. 4. e-g), but it is hard to conclude this without any quantification and statistical analysis. Sodium channels have been shown to be associated with the membrane-associated periodic skeleton structures in neurons and average autocorrelation analysis has been developed to quantify the degree of periodicity of such structural organizations (Han et al. PNAS 114(32)E6678-E6685, 2017). The authors should use this approach to quantify and compare the average autocorrelation amplitudes.

      We are thankful to the reviewer for suggestions on how to quantify the periodicity of recombinant sodium channels and how to more accurately compare WT and TAG mutants at the nanoscale level. We will perform additional experiments and analysis in order to address the concerns of this and other reviewers.

      1. The authors should also obtain dSTORM images for the click labeled neurons to demonstrate if the click labeling method would provide sufficient labeling efficiency for dSTORM, compared to immunostaining (HA and Ankyrin G immunostaining).

      We would like to thank the reviewer for this suggestion. We have already shown in our previous work that STED can be performed with click labeled neurons (PMID: 35031604). When it comes to this manuscript and AIS labeling, we have already obtained preliminary dSTORM images of click-labeled NF186. Since the expression of Nav1.6 is lower compared to NF186, the labeling is also less bright and dSTORM is a bit more challenging. To try to overcome this issue, in addition to dSTORM of click-labeled Nav1.6, we are planning to try click-PAINT (PMID: 27804198). Click-PAINT has been used for super-resolution imaging of less abundant targets in cells and could possibly allow super-resolution imaging of Nav1.6. We will report on these new experiments in the revised version of the manuscript.

      1. It seems that the click labeling has a off-target/background labeling in the soma of the neuron (see Fig. 3c,d. Could the authors quantify and determine the sources of such off-target labeling?

      We thank the reviewer for pointing this out. We will clarify this in the revised manuscript, but by looking at the other examples from our dataset it appears to us that this background is present in WT constructs as well. In the current version of the manuscript, this is not clear since the WT image that is shown in the Fig. 03b is a single plane confocal image. Therefore, we will replace it in the revised manuscript with a z-stack in which the presence of the background is more obvious (due to the maximum intensity projection). In addition, we will conduct additional control experiments to clarify this.

      Minor comments:

      1. The authors should indicate how many replicates were performed and how many cells were analyzed for each experiment.

      We thank the reviewer for bringing this up. By mistake, we omitted this important information. We will include this information in the revised manuscript, but we would like to highlight here that each experiment was repeated at least 3 times.

      1. The display range (i.e., intensity scale bar) was indicated only for a small portion of the fluorescence images. It is better to be consistent and show the display range for all images presented.

      We will include intensity scale bars in all the images in the revised version of the manuscript.

      3. Description of the revisions that have already been incorporated in the transferred manuscript

      Not applicable.

      4. Description of analyses that authors prefer not to carry out

      Reviewer #3, comment #5. One application presented in this manuscript is to evaluate the effect of epilepsy-causing mutations of Nav1.6. By comparing the intensity of ATTO488, the result suggests that there is no significant impact of these mutations on membrane tracking. I am wondering if the author should study the membrane tracking by also looking at the diffusion in live-cell with the labeling method. The comparison of the intensity only can be achieved by just immunostaining. It doesn't really demonstrate the benefit of live-cell labeling and imaging with the presented method.

      Generally speaking, one of the advantages of click labeling is its compatibility with live cell labeling. As the reviewer also points out, this is especially useful for live-cell imaging but is not limited to it. In addition, click labeling allows selective labeling of membrane population of Nav1.6 in living neurons. We took advantage of this and used cell-impermeable dyes to label unnatural amino acids incorporated into extracellular part of Nav1.6 (Scheme 03a). On the contrary, HA tag that allows immunodetection of recombinant Nav1.6 is added to the intracellular C terminus. Hence, by anti-HA immunostaining total (intra- and extracellular) epilepsy-causing Nav1.6 channel population will be detected. That is why in this case live-cell click labeling was advantageous compared to the conventional immunostaining. We will clarify this in the revised manuscript. In addition, we would like to note that when we started the experiments with the epilepsy-causing mutations, we wanted to a) check if they are present on the membrane and b) depending on the outcome of those experiments follow the trafficking of these LOF Nav1.6 mutants. Since patch clamp recordings of pathogenic Nav1.6 showed loss of Na+ currents, we at first assumed that they are not properly expressed on the membrane. However, our click labeling showed that the pathogenic channels were detected at the AIS membrane despite the loss of Na+ currents. This was also somewhat surprising to us and we would love to investigate this further. We also appreciate the reviewer’s suggestion in this regard and we hope to be able to use all the advantages of our labeling approach in our follow-up studies. However, keeping in mind time and resources limitations, live-cell trafficking study might be beyond the scope of this revision.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #5

      Evidence, reproducibility and clarity

      Summary:

      In this manuscript, Nevena Stajković et al. present a method for live labeling of the proteins localized at the axon initial segment (AIS) of cultured neurons using unnatural amino acids (UAAs) carrying strained alkenes and click chemistry. Using this method, the authors showed the successful labeling of two AIS-localized proteins, the 186 kDa isoform of neurofascin (NF186) and the 260 kDa voltage-gated sodium channel (NaV1.6). The authors also showed the transduction of neurons using adeno-associated viruses (AAVs) had higher efficiency than transfection by lipofectamine in delivering the vectors expressing required components for the click labeling.

      Major comments:

      1. Throughout the manuscript, only one representative image containing one AIG is shown for each condition without statistics and quantifications, so the conclusions are not sufficiently convincing. For example, in Fig. 1b, c, e; Fig. 2b,c,d,e; Fig. 3b,c,d,e ; Fig. 5c; and Supplementary Fig.1-6, the authors should quantify the average fluorescence intensities both for HA immunostaining and ATTO488-tz labeling in different conditions, as well as the labeling ratios (fluorescence intensity ratios between ATTO488 and AF647/AF555) . Without statistics and quantifications, it is unclear whether there is any significant difference between the constructs with different TAG positions, or between different transfection methods (e.g., lipofectamine 2000 vs 3000).
      2. The only quantification done was for the average AIS length, but the statistical tests should be preformed between different conditions and the corresponding P values should be provided. It seems that the transfected neurons generally have a longer AIS length than the transfected neurons (Fig. 2d and 3f). Could the authors provide an explanation for this?
      3. The authors claim that there was no obvious difference in the nanoscale organization of the NaV1.6WT 317 -HA or NaV1.6TAG 318 -HA channels (Fig. 4. e-g), but it is hard to conclude this without any quantification and statistical analysis. Sodium channels have been shown to be associated with the membrane-associated periodic skeleton structures in neurons and average autocorrelation analysis has been developed to quantify the degree of periodicity of such structural organizations (Han et al. PNAS 114(32)E6678-E6685, 2017). The authors should use this approach to quantify and compare the average autocorrelation amplitudes.
      4. The authors should also obtain dSTORM images for the click labeled neurons to demonstrate if the click labeling method would provide sufficient labeling efficiency for dSTORM, compared to immunostaining (HA and Ankyrin G immunostaining).
      5. It seems that the click labeling has a off-target/background labeling in the soma of the neuron ( see Fig. 3c,d. Could the authors quantify and determine the sources of such off-target labeling?

      Minor comments:

      1. The authors should indicate how many replicates were performed and how many cells were analyzed for each experiment.
      2. The display range (i.e., intensity scale bar) was indicated only for a small portion of the fluorescence images. It is better to be consistent and show the display range for all images presented.

      Significance

      Unnatural amino acid (UAA)-based minimal tags for live-cell protein labeling in mammalian cells were invented about ten years ago (Lang et al., 2012b, Lang et al., 2012a, Nikic et al., 2014, Plass et al., 2012, Uttamapinant et al., 2015), and these authors recently introduced this labeling method to label live cultured neurons (Arsić et al., 2022). Therefore, it is unclear whether the method present in this manuscript has any significant advance compared to the Arsić et al. paper, given that the major difference between the two papers is that in the current manuscript, AIS localized proteins were labeled, whereas in the Arsić et al. paper, neurofilaments were labeled in the neurons. Therefore, the method presented in the current manuscript does not provide much novelty or technical advance compared to what has been described in the Arsić et al. paper.

      My expertis is super-resolution flurescence imaging, cell labeling methods, and neurobiology.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #4

      Evidence, reproducibility and clarity

      The manuscript demonstrates a novel method of labeling two large components of the initial axon segment, neurofascin (NF186) and Nav1.6 using unnatural amino acids and click chemistry in live cells. They have applied their method for epilepsy causing two Nav1.6 variants without affecting their functionality. Since these proteins are larger in size, selecting the labeling sites and transfection efficiency become critical factors. They have targeted different lysine sites and shown the best performing labeling site. Also, they have developed a viral vector to improve transfection efficiency.

      The experiments are well designed, and the manuscript is nicely written. In my opinion, the manuscript can be accepted, but the author should address the following comments.

      Major comments

      1. "Confocal microscopy revealed that the hNSE promoter lowered the WT and clickable NF186-HA expression levels and consequently improved the localization of these proteins." Is the lower expression level a measure of localization improvement? How does the author conclude that the localization has improved?
      2. "As there was no obvious difference in the nanoscale organization of the NaV1.6WT 317 -HA or NaV1.6TAG 318 -HA channels (Fig. 4. e-g), these experiments confirmed that the NaV1.6 overexpression, TCO*A319 Lys incorporation, and click labeling did not affect the nanoscale periodic organization of the sodium channels in the AIS." It is clearly noticeable that for WT, the spot density is more compared to the other two mutants. Why is that so? Using cluster analysis, one can quantify spot density and discuss nanoscale organization quantitatively. The author should quantify the periodicity and compare it among different variants and with previous reports.

      Minor comments

      1. "Although NF186K809TAG 158 -HA (Supplementary Fig. 4) showed bright click labeling, we excluded it from the analysis due to its frequent ectopic expression along the distal axon." How frequently is this bright click labeling observed for this mutation? Is it not observed for other mutations at all? The authors should state this point clearly with some statistics.
      2. "Immunostaining with anti-HA antibody revealed that the expression of NaV1.6WT 239 -HA on the membrane of the N1E-115-1 cells was higher than on the ND7/23 cells (Supplementary Fig. 5a-c). However, click labeling of both NaV1.6K1425TAG 240 -HA and NaV1.6K1546TAG 241 -HA with ATTO488-tz was not successful (Supplementary fig. 5d) indicating insufficient expression of the clickable constructs." Is this due to insufficient expression level or accessibility? The author should make this statement clear.
      3. Authors should clearly state the drift correction procedure of 3D STORM data. What are the localization precision and photon count for 3D STORM experiments?
      4. "Click labeling of NaV1.6 channels in living primary neurons" What kind of primary neurons have been used for click labeling of NaV1.6 channels? Is there any specific reason why authors have chosen cortical neurons for labeling NF186? Does this labeling strategy depend on primary neuron type?

      Significance

      Although the use of unnatural amino acids and click chemistry for labelling has been shown before from the same group, labelling large proteins, especially ion channels, without affecting their function is always challenging because of the accessibility of the labelling site as well as poor transfection efficiency. Here, they have selected two such large essential proteins: NF186 and Nav1.6, which are associated with epilepsy, and developed a method for fluorophore labelling with minimal perturbation. Other approaches namely using fluorescent proteins, biotin-streptavidin chemistry and halo-tag have been reported before to label these proteins, but these have a strong impact on their mislocalisation and perturbing their functionality. Therefore, this method will be of great importance in the field of studying these proteins.

      Expertise: Live-cell confocal and multi-photon microscopy imaging, Super-resolution microscopy imaging, Live-cell labelling, and Amyloid aggregations

    4. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary:

      This study proposes a novel tool for AIS live and fixed labelling based on biorthogonal click chemistry. Stajkovic and colleagues used this method to specifically label the AIS proteins NF186 and Nav1.6 of mouse and rat neurons, and did a thorough process of optimization to get convincing results. The authors considered different promoters, transfection strategies and the use of AAVs to get the most efficient labelling strategy for both proteins. They have also gone through a strong validation process based on transfection efficiency, quality of staining, potential effects on AIS length and nanostructure, and electrophysiological properties. Finally, Stajkovic and colleagues used this tool to study how two epilepsy-causing Nav1.6 mutant variants affect AIS function, providing interesting data to the understanding of this pathology. In summary, this method convincingly overcomes some well-described issues associated with pre-existing AIS live cell labelling tools by being minimally "invasive" to the proteins of interest. Besides the scientific content, another strong point of this article is the clarity of the manuscript and the figures: the presence of schematics (i.e. Fig. 1) and the detailed description of experiments and results will help non-specialist readers to follow the study. I strongly recommend this article for journal publication.

      Major comments:

      I have no major comments

      Minor comments:

      I have some minor comments:

      • On lines 107 and 108, the sentence "The C-terminal HA-tag allowed us to detect the full-length NF-186 protein by immunostaining it with an anti-HA antibody" would have a better place just after lines 104-105 " [...] we modified the previously described plasmid (Zhang et al., 1998) by moving the hemagglutinin (HA) tag from the N terminus to the C terminus".
      • Fig.2b: the AnkG staining looks substantially longer than that showed in c. However, the results on AIS length show no significant changes in between the groups. This is visually misleading, the authors should choose a picture for the WT construct that is representative of the data.
      • Line 238: what is the rationale behind choosing these cells? For example, have they been used in other studies for similar purposes? If so, please provide the reference.
      • Figure 3c, the authors omitted the comparison with the WT construct this time, as opposed to the neurofascin experiments. What is the reason?
      • Fig. 4: why did the authors chose these cells for electrophysiology experiments and not neurons? Explain the rationale in the text or, alternatively, cite similar studies using the same tool.
      • Fig.4, biophysical properties: did the authors find differences in passive properties? Measures of resting potential, membrane resistance and cell capacitance should be reported.
      • Fig 4, STORM images. The periodic distribution of the dots should be enhanced with some sort of arrows or lines, for the non-specialist audience.
      • Line 374: rat or mouse primary neurons?

      Referees cross-commenting

      I fully agree with the following remarks from Reviewers #3, #4 and #5. This is a point that I have raised in my report too. The authors need better images to show the periodicity visualization, and a quantification would be of great benefit to support the claim with numbers (and how these compare to similar studies in the literature):

      R3: 2. For the dSTORM analysis of the tagged Nav1.6 protein, I also cannot tell there is periodic organization from the image directly. Some analysis is needed there. R4: 2."As there was no obvious difference in the nanoscale organization of the NaV1.6WT 317 -HA or NaV1.6TAG 318 -HA channels (Fig. 4. e-g), these experiments confirmed that the NaV1.6 overexpression, TCO*A319 Lys incorporation, and click labeling did not affect the nanoscale periodic organization of the sodium channels in the AIS." It is clearly noticeable that for WT, the spot density is more compared to the other two mutants. Why is that so? Using cluster analysis, one can quantify spot density and discuss nanoscale organization quantitatively. The author should quantify the periodicity and compare it among different variants and with previous reports. R5: 3. The authors claim that there was no obvious difference in the nanoscale organization of the NaV1.6WT 317 -HA or NaV1.6TAG 318 -HA channels (Fig. 4. e-g), but it is hard to conclude this without any quantification and statistical analysis. Sodium channels have been shown to be associated with the membrane-associated periodic skeleton structures in neurons and average autocorrelation analysis has been developed to quantify the degree of periodicity of such structural organizations (Han et al. PNAS 114(32)E6678-E6685, 2017). The authors should use this approach to quantify and compare the average autocorrelation amplitudes.

      I also agree with these comments from Reviewers #3 and #5:

      R3: 4. It is unclear, for all the presented data, whether all the cells are collected from a single biological replicate or from multiple replicates. At least 2-3 replicates are needed to see the reproducibility in terms of labeling efficiency, and other related conclusions. R5: 1. The authors should indicate how many replicates were performed and how many cells were analyzed for each experiment.

      Significance

      The proposed tool in this article represents a big step forward in the field of AIS live cell imaging. As stated by the authors in the introduction, previous studies have described methods based on tagging fluorescent proteins to the protein of interest or labelling the extracellular part of proteins with antibodies. The same studies reported several issues: the interference with important domains of the protein due to the size and the position of the tag in the case of fluorescent proteins (Dumitrescu et al., 2016, PMID: 27932952; Dzhashiashvili et al., 2007, PMID: 17548513), or the failure to report plasticity changes in the AIS in the case of antibodies (Dumitrescu et al., 2016, PMID: 27932952). This tool can be useful for research teams aiming to understand, for example, the live development of the AIS or understanding the trafficking of its proteins. The authors have applied this method to two transmembrane proteins (NF186 and Nav1.6), but as they state in their discussion, it will be useful to tag other candidates, including cytoplasmic proteins. One of the main problems of immunocytochemistry is to find the right antibody to detect your protein. Sometimes, absence of proof is not proof of absence: just because the protein is not detected via immunostaining does not mean that the protein is not expressed there. This tool offers an alternative to these challenging scenarios.

      My expertise keywords: axon initial segment, neuronal polarity, axon biology, super resolution microscopy.

    1. When the HTML parser finds a <script> tag, it pauses the parsing of the HTML document and has to load, parse, and execute the JavaScript code. Why? because JavaScript can change the shape of the document using things like document.write() which changes the entire DOM structure

      This is why you put script tags at the bottom of an html document.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We are sincerely grateful to the reviewers for several key comments that led us to correct some mistakes and better appreciate how to put our findings in the context of recently published data. These changes undoubtedly improved the manuscript.

      Many other reviewer comments seem to equate chaperone binding with a functional chaperone role in de novo folding. These are not the same. Cytosolic chaperones presumably “sample” nearly every protein that is synthesized by cytoplasmic ribosomes. This does not mean that every such protein would misfold if even one of those chaperones failed to bind it. If we want to understand what chaperone mutations might cause human disease due to septin misfolding, for example, it will not be enough to catalog all the chaperones that bind septins. We have already done that. What will help is to understand which chaperones make functional contributions to septin folding and complex assembly. Our study is the first to experimentally address chaperone roles in de novo septin folding, period. We take responsibility for not being sufficiently clear about the goals of our work, and, to emphasize these points, we added one sentence to the Introduction and revised another.

      Another consistent criticism was that the use of the E. coli system, both in vivo and in vitro, limited our ability to gain insight into the folding of septins in eukaryotic cells and led to a “tessellated view”. For example, reviewers claimed that our model about translation elongation rates for Cdc12 were “based mainly on the E. coli system and bioinformatics analysis”. We disagree with this interpretation. Key evidence in support of our model come from published data in yeast, specifically the much higher density of ribosomes on Cdc12 and the accumulation of ribosomes on the Pro-rich cluster near the Cdc12 N terminus. These are precisely the kinds of “more stringent analysis” in “authentic yeast” (to use Reviewers’ language) that we would have wanted to do to test our model, had they not already been done by others. Without specific suggestions, we struggle to imagine what other kinds of experiments the Reviewers have in mind, apart from a eukaryotic version of a reconstituted cell-free translation system, which Reviewer #1 admits “would be substantially difficult” and “time consuming”. While we are intrigued by the reconstituted eukaryotic cell-free translation system that was published last year (which we mentioned on lines 994-995) and look forward to exploring it in future studies, it is not commercially available and we agree that the amount of effort required to prepare it ourselves is unrealistic for the current study. Most importantly, we do not find in the critiques provided any specific reason why our E. coli-based systems experiments are intrinsically less “stringent” or “rigorous”.

      Accordingly, we think that, together with the results of multiple new experiments (detailed below), the extensive re-writing and re-ordering that we have done in the revised manuscript will be enough to better emphasize the importance and rigor of our findings and thus to address all of the Reviewers’ specific concerns.

      Reviewer 1 thought that our manuscript “does not even provide new information, since the involvement of CCT and the Hsp70 system is not novel” and thought that “the key finding of this manuscript is how chaperones are involved in the de novo folding of septins, which is not conceptually new because of previous findings, including those of the authors”. Reviewer #3 also stated that “the function of Tric/CCT in septin folding and assembly is well documented”.

      We were quite surprised at this reaction, since we dedicated a significant portion of the original manuscript (lines 68-76 and 319-322) to explicitly discussing the only other paper in the literature that specifically addresses the question of whether or not CCT is required for de novo septin folding. As a reminder, that paper explicitly stated that “it is unlikely that CCT is required to fold septins de novo” and “septins probably do not need CCT for biogenesis or folding”. With regard to involvement of the Hsp70 system, the only existing evidence in the literature on this subject is the aggregation of some septins in ssb1∆ ssb2∆ cells. Like the CCT study, that study did not distinguish whether this was a result of problems during septin synthesis and before septin complex assembly, or, alternatively, whether pre-folded and assembled septins were subject to disassembly, misfolding, and aggregation. Our experiments specifically test the fate of newly-synthesized septins prior to assembly in living cells. Our previous findings documented physical interactions between wild-type septins and multiple chaperones but did not address whether these interactions had any functional relevance. We previously reported functional effects of interactions between chaperones and MUTANT septins but, again, these studies did not address functional chaperone requirements for WILD-TYPE septins. While we did our best to highlight these points in the original document without devoting excessive amounts of text, we accept responsibility for not making these points sufficiently clear and to address this issue we added additional text, including the text quoted above, to the Introduction.

      While Reviewer #3 commented that the manuscript “is overall well presented”, Reviewer 1 thought that the manuscript was “complicated to read” with “no logical connections, just a list of many results” and mentioned that part of the difficulty was “that it contains many negative results”.

      In addition to reorganizing the manuscript, as suggested by the reviewers, we added more text at the beginning and end of nearly every section to even more explicitly state the logical connections between results. In our opinion, negative results of properly controlled experiments are valuable to the research community, and we do not understand what it is about negative results that makes them difficult to read about. Many of the extra experiments we performed were in anticipation of being asked to perform them by reviewers, some of which generated negative results. We are reluctant to remove negative results unless there is a more compelling reason. For example, to address another reviewer concern, we did remove the negative results with the Ydj1–Ssa2 compensatory mutants.

      Reviewer #2: “4) Figure 2: The labeling on the protein structure makes it seem like the exact region for Ydj1 and Hsp70 was experimentally identified, when it hasn’t.”

      We acknowledge that the first sentence of the figure legend (“the colored ribbon follows the color scheme in the sequences at right for overlapping β-aggregation, Ydj1 and Hsp70-binding sites”) could be misinterpreted, since only in the second sentence does it say “Sequence alignments show predicted binding sites”. We corrected this mistake, and added the text “Predicted chaperone binding sites” as the first words in the legend to this figure.

      Reviewer #2: “8) The authors confusingly jump back and forth between different Septins and different chaperone (Ssa1-4, Ydj1, Sis1, Hsp104). We would ask the authors to re-arrange the manuscript, collating all the yeast work in one section and bacterial work in another.”

      We re-arranged the manuscript and put all the yeast work in one section and all the bacterial work in another, with the exception of the studies of individually purified Cdc3 and Cdc12, which we put in between the yeast studies of the kinetics of de novo assembly and the yeast studies of post-translational assembly. Our reasoning is that the studies with the purified proteins demonstrate challenges with maintaining native conformations in the absence of chaperones and other septins, which flows naturally into the yeast studies asking about the ability of “excess” septins to maintain oligomerization-competent conformations in the absence of other septins and when we experimentally eliminate specific chaperones. All of the work actually manipulating E. coli genes/proteins is now together.

      Reviewer #3: “1. The co-translational binding of CCT to nascent polypeptide chains has been studied (Stein et al., Mol Cell 2019). While the authors indicate that septin subunits are engaged co-translationally, they do not comment which ones are interacting with CCT and at which state of translation. This information is crucial and should also be mentioned in the discussion section.”

      We are grateful to the Reviewer for bringing up this point, which we had overlooked. We hadn’t noticed that, in the end, only Cdc3 met the CCT confidence threshold to be included in the supplemental data of the Stein et al. paper. All septins co-purified with CCT in an earlier Dekker et al proteomic study, so we strongly suspect that the failure of the other septins to meet the confidence threshold in the Stein et al paper reflects the sensitivity of that assay, rather than a significant difference in how septin GTPase domains interact with CCT. We also hadn’t appreciated that according to that study, the main sites in the Cdc3 GTPase domain bound by CCT and Ssb are the same. Hence our statement that Ssb bound to septins “earlier” during translation, and CCT bound “later” was wrong. Instead, the overlapping Ssb and CCT site in Cdc3 turns out to be remarkably consistent with a conclusion from Stein et al paper, that CCT binds Rossmann-fold proteins like septins at sites where “early” beta strands have been translated and expose a chaperone-binding surface that later becomes buried by an alpha helix. We corrected our mistake in the text and in our model figure and added: (1) a new supplemental figure with predicted septin structures and a sequence alignment indicating where CCT and Ssb bound; and (2) text discussing the confidence thresholds for “calling” septin-CCT interaction, the Rossmann-fold binding, and how we interpret Ssb and CCT binding to the same site.

      Reviewer #3 “3. Figure 3: It is recommended to also follow Cdc10-GFP and Cdc12-GFP fluorescence. This will on the one hand generalize the presented findings and provide a direct link to other parts of the study (e.g. crosslinking analysis of Cdc10).

      We carried out the requested experiment for Cdc12, using Cdc12-mCherry rather than Cdc12-GFP because of the formation of non-native foci that we observed with Cdc12-GFP. We also attempted to analyze Cdc10, using an existing GAL1/10-promoter-driven Cdc10-mCherry plasmid that we’d made a few years ago, but it did not behave as expected, with high expression even in the absence of galactose (not shown), which prevented us from performing the requested experiment. We have a Cdc10-GFP plasmid with the inducible MET15 promoter, but this promoter does not provide sufficiently low levels of expression in repressive conditions, so there would be too much expression at the beginning of the experiment for us to accurately follow accumulation thereafter. Instead, we tried the only other plasmid we had with the GAL1/10-promoter controlling a tagged septin: Cdc11-GFP. Above a certain threshold of expression, Cdc11-GFP formed unexpected cortical foci, but we were still able to perform the analysis and found a clear delay in septin ring signal in cct4 cells, providing the requested generalization to other septins, if not Cdc10.

      Reviewer #3 “5. Figure 4C: The finding that only ssb1 but not ssb2 knockouts have an effect on joining of free Cdc12-mCherry subunits into septin rings is puzzling. Similarly, Ssb1 largely acts co-translationally, while in this assay post-translational septin ring assembly is monitored. The authors need to comment on these two points.”

      We did not examine ssb2 knockouts, so we do not know to what the Reviewer is referring in the first point. If the Reviewer means that they are puzzled by the fact that we saw a phenotype in cells in which only SSB1 was deleted and SSB2 remained, we offer two explanations. As can be seen in the Saccharomyces Genome Database entry for SSB1 (https://yeastgenome.org/locus/S000002388/phenotype), there are at least a dozen known phenotypes associated with deletion of SSB1 in cells with wild-type SSB2. We even showed a very clear septin misfolding/mislocalization phenotype in Supplemental Figure 4D. Thus while our findings are new and provide novel insights into Ssb function, they are not unprecedented. The Reviewer is correct that most Ssb is ribosome-bound and thus Ssb1 “largely acts co-translationally” but ~25% of Ssb is not ribosome-associated (PMID: 1394434). Furthermore, the lack of a strong phenotype for ssb1∆ cells in our new kinetics-of-folding experiment (see below), plus the realization that Ssb and CCT both bind the same site in Cdc3, leads us to a new model: Ssb acts both co- and post-translationally in septin folding, but only the post-translational function is associated with a phenotype in ssb1∆ cells, because in that assay we drastically overexpress a tagged septin and thereby exceed the Ssb chaperone capacity that remains when we delete SSB1. This logic also explains the first ssb1∆ phenotype we saw, when overexpressing Cdc10(D182N)-GFP. In the kinetics-of-folding assay, on the other hand, tagged septin expression is much lower and reducing the amount of total Ssb by ~50% (via SSB1 deletion) likely does not compromise Ssb function in folding the tagged septin. We therefore removed our statement that “Ssb dysfunction leaves nascent septins in non-native conformations that are aggregation-prone and unrecognizable to CCT”, revised our model figure accordingly, and added new text and citations to explain our new model.

      Reviewer #3 “Additionally, they should test whether the appearance of septin ring fluorescence is slowed down in ssb1 mutants (as shown for cct4-1 mutant cells in Figure 3B).”

      We agree that slower septin folding in ssb1∆ cells is a prediction of our model, and we performed the requested experiment and include the results in our revised manuscript. The new data show that the appearance of septin ring fluorescence is not delayed in ssb1∆ mutants, which is easily explained by the ability of Ssb2 to chaperone the folding of the low levels of tagged septin that we express in these kinds of experiments (see above).

      Reviewer #3: “7. Figure 5G: The data is not convincing. This reviewer cannot detect a specific Cdc12 band accumulating in presence of GroEL/ES.”

      We re-ran the reactions again with fresh reagents and this time ran the gel longer to reduce excess signal from free fluorescent puromycin and the bright Cdc10 bands. We now see a very clear band for full-length Cdc12 in the reaction with added GroEL/ES, fully consistent with our mass spectrometry results. We updated the figure with the new results.

      Reviewer #3: “Furthermore, the activity tests done for the chaperonin system are confusing (Supplemental Figure 7). The ATPase rate (slope!) of GroEL/GroES seems higher as compared to GroEL but according to the authors it should be opposite.”

      In our assays, the ATPase activity is so fast that for our “time 0” timepoint, much of it has already occurred by the time the reaction can be physically stopped and measured. In other words, the handling time is such that we can’t visualize what happened in the earliest stages of the reaction, where the rates could accurately be estimated as slopes. This is obvious from the fact that at time 0, the absorbance for the “GroEL alone” reaction is already more than twice the absorbance for GroEL+ES. We added clarifying text to the figure legend.

      Reviewer #3: “The refolding assay using Rhodanese as substrate is also confusing: What is the activity of native Rhodanese? The aggregated Rhodanese sample seems to have substantial activity that is not too different from a GroEL/ES-treated one. From the presented data it is not clear to the reviewer to which extend GroEL/ES prevents aggregation and supports folding of denatured Rhodanese.”

      We thank the Reviewer for bringing this to our attention, because made we mistakenly left out the values for native Rhodanese with the reporter. With regard to the aggregated Rhodanese, we failed to note that this sample contains urea. When the urea absorbance is subtracted, it is clear that the GroEL/ES-treated sample has higher activity. Furthermore, some native enzyme is likely still active within the aggregated sample, explaining the “substantial activity” that the Reviewer correctly notes. We corrected the figure and added clarifying text to the figure legend.

      Reviewer #3: “the study goes astray following aspects that does not seem relevant to this reviewer (e.g. the role of N-terminal proline residues for Cdc12 translation, Fig. 5E/F).”

      We acknowledge that we did a poor job of introducing the N-terminal Pro-rich cluster in Cdc12 with relation to our model of slow Cdc12 translation. Instead, we have revised and reorganized the manuscript to set up these experiments as a direct test of our model: if ribosome collisions on the body of the ORF drive mRNA decay, then decreasing the spacing of those ribosomes should exacerbate the problem, and eliminating the Pro-rich cluster (where published yeast data already show ribosomes accumulate) is the most logical way to test the prediction. Far from being irrelevant, the results fit the prediction perfectly and thus support the model. We expect that this change will highlight the importance of these experiments for the reader.

      Reviewer #2: “1) Fig. 1 Is the folding of Cdc3 being measured in cells lacking chaperones mentioned towards the end of the paper or are the authors referring to the lack of yeast proteins?”

      We are unclear as to what the Reviewer is asking here. The title of Figure 1 states that these are “purified yeast septins” and the figure legend further emphasizes this fact. Additionally, the Coomassie-stained gel in Figure 1A shows a single band, corresponding to purified 6xHis-Cdc3. The proteins were purified from wild-type E. coli cells, so all E. coli chaperones were present when Cdc3 initially folded, but chaperones and all other proteins were removed during the purification and prior to the analysis. We do not know what change to make.

      Reviewer #2 asked “How do the authors account for the septin defect in Ssa4 delete cells in unstressed conditions where Ssa4 would be very low already? According to the authors previous work, Ssa2 and 3 should be able to compensate.”

      We explicitly addressed this point in the original manuscript (lines 893-898). Again, we think here the Reviewer is equating chaperone binding with chaperone function. According to our previous work, Ssa2 and Ssa3 are able to bind septins, but this does not mean that they can fold septins the same way as Ssa4. We cite several papers that discuss the distinct functional roles for the different Ssa proteins. We do not think that additional clarification of this point would strengthen the manuscript.

      Reviewer #3: “6. Figure 5B: It is unclear why Cdc3 is observed in the pulldown of His-tagged Cdc12 (37˚C), although no Cdc12 was isolated under these conditions. How is that possible?”

      That is not possible. As we indicate in the figure legend and with the red asterisk, the only band appearing in that lane is a non-specific band that cross-reacts with the anti-Cdc3 and/or anti-Cdc11 antibodies. This is why it is also present in the “No septins” control lanes. We made the asterisk larger to help accentuate this point.

      Reviewer #3: “Furthermore, the authors observe a specific effect on Cdc12-Cdc11 assembly in the E. coli groEL mutant. How do they rationalize this specific effect as Cdc12-Cdc3 assembly remained unchanged? This observation also seems in conflict with the suggestion of the authors that Cdc12 preferentially recruits Cdc11 before interacting with Cdc3 (page 45, lane 1024).”

      Cdc11 was not expressed in the groEL mutants because no Cdc11 gene was present in those cells, as explained in the body text and indicated in the labeling above the lanes in Figure 5A. The band near the size of Cdc11 is a non-septin protein that bound to the beads in the groEL-mutant cells, as is shown in the immunoblot using anti-Cdc11 antibodies in Figure 5B. Thus there is no conflict to rationalize.

      Reviewer #1: “The only evidence that CCT binds to septin is the list of LC-MS/MS. Western blotting would provide more solid data.” and “2) The cross-linking experiments appears not to have been successful. Why are the Ssas, Ydjs etc not detected here? “

      First, CCT subunits are relatively low-abundance, expressed at 5- to 50-fold lower levels than other chaperone families in the yeast cytosol (see PMID: 23420633). To the Reviewer’s second point, we did in fact detect other chaperones in our crosslinking mass spectrometry experiments, including Ydj1, multiple Ssa and Ssb chaperones, Hsp104, etc., as can be seen in Table S1. However, they were also detected in negative control experiments. This is not surprising, given that these chaperones are among the most common “contaminants” of affinity-based purification schemes (see the CRAPome database at https://reprint-apms.org/). It was for this reason we had to perform so many negative control experiments, which likely produced some false negative results, as some “real” interactions were likely discarded when the same chaperone showed up in our controls. We added a figure panel with a Venn diagram of overlap between experimental and control samples, and text pointing out this caveat of our approach.

      Second, in this experiment we attempted to identify proteins that transiently interact with a specific region of Cdc10 that will later become buried in a septin-septin oligomerization interface. Due to the transient nature of the interaction, we do not expect to detect high levels of crosslinked chaperones. Mass spectrometry is significantly more sensitive than immunoblotting, so there is no guarantee that we would be able to detect a band even if the crosslinking works as desired. Indeed, the crosslinked bands we saw by immunoblot for GroEL were quite faint (see Figure 2F), despite the fact that GroEL and the T7-promoter-driven Cdc10 were among the most abundant proteins in those E. coli cells.

      Third, there is no commercially available, verified antibody recognizing yeast Cct3 for which to perform the requested immunoblot experiment. Since both the N and C termini of CCT subunits project into the folding chamber, it is unwise to use a standard epitope tagging approach, as the tags may compromise function. Indeed, for purification purposes others inserted an affinity tag in an internal loop in Cct3 (PMID: 16762366). We have a yeast strain with Cct6 tagged in an analogous way, but to perform the requested immunoblot experiment with Cct3 would require creating or obtaining the Cct3-tagged strain, deleting NAM1/UPF1, and introducing our Bpa tRNA/synthetase and GST-6xHis-Cdc10 plasmids. Given the sensitivity of detection concerns stated above, we doubt this would help.

      In summary, we prefer not to attempt the requested immunoblot experiments.

      Reviewer #1: “-Fig. 3B ant related Figures: The experiment to see if GFP-tagged septin accumulates in the bud neck is important, but only the graphs after the analysis are shown. The authors should provide the readers with representative examples from imaging data.”

      We are confused, because the images at the bottom of Figure 3A already show what the Reviewer requests. As stated in the figure legend, these are representative examples of the imaging data from a middle timepoint of one of the experiments. It would be nearly impossible (for space reasons) to provide representative images for all of the timepoints for all of the genotypes for all of the experiments. Since in our new experiments we introduce new tagged septins (Cdc11-GFP and Cdc12-mCherry), we also now include representative images of cells expressing these proteins, as well.

      Reviewer #2: “3) If the authors had evidence of chaperone interaction from their previous study, why did they not simply do IPs with fragments of the septins/chaperones?”

      We are unclear why the Reviewer is suggesting IPs after referring to our previous study. IPs are a poor choice for transient interactions, which is why we mostly avoided them in previous studies, and instead used a novel approach (BiFC) to “trap” chaperone–septin interactions. Moreover, we seek to identify chaperones that bind wild-type septins at future septin-septin interfaces on the path towards the native conformation. Fragments of septin proteins would likely misfold and would therefore likely attract chaperones that wouldn’t normally bind the full-length septin. Indeed, our previous studies demonstrated that even a single non-conservative amino acid substitution was sufficient to alter chaperone-septin binding. Thus IPs with fragments of septins or chaperones would be highly unlikely to yield informative results for the questions we seek to answer. We strongly prefer not to attempt these suggested experiments.

      Reviewer #2: “5) While differences between Ssa paralogs are highly interesting, using deletions of Ssas is not useful, given that yeast compensate by overexpressing other paralogs. The yeast GFP Septin assays should be repeated in yeast lacking all Ssas and expressing one paralog on a constitutive promoter (See numerous papers by Sharma and Masison).”

      We disagree that ssa deletions are “not useful”, since if the overexpressed paralogs cannot fulfill the same function as the deleted SSA, then we will see a phenotype. Which we do. Furthermore, we had already obtained and thoroughly tested a strain like the ones mentioned by the reviewer (ECY487, a.k.a. JN516, from Betty Craig’s lab, with ssa2∆ ssa3∆ ssa4∆ and SSA1, which is constitutively expressed, PMID: 8754838), but we found that, as published, it divides slightly more slowly even under the most permissive of conditions. The requested strain cannot be analyzed using our method, because slow accumulation of ring fluorescence could be attributed to other defects unrelated to septin folding. Thus we strongly prefer not to attempt the suggested experiments.

      Reviewer #2: “7) The authors need to clarify the experiment with the Ydj1 D36N and Ssa2 R169H. In Reidy et al, they never fully biochemically test this system and it was never examined for Ssa2-Ydj1. The authors would need to do some fundamental experiments to demonstrate the validity and functionality of this double mutant in yeast.”

      Given that this experiment was unable to generate meaningful data, since the mutations affected the kinetics of induction of the GAL1/10 promoter, we do not think the requested biochemical experiments would add any value to the study. Instead, we removed these studies from the manuscript.

      Reviewer #3: “4. Figure 3B: The difference between wt and cct4-1 cells in appearance of septin ring fluorescence is observed at one timepoint. Since this experiment is considered highly relevant, the authors are asked to include another timepoint to bolster the conclusion that Cdc3-GFP folding and thus septin ring assembly is delayed in the CCT mutant.”

      We carried out new experiments with cct4-1 cells using Cdc12-mCherry and Cdc11-GFP with more timepoints than in our original cct4-1 experiments with Cdc3-GFP. Since these experiments provide the same kinds of results, but at multiple timepoints, we do not see the value in repeating the Cdc3-GFP experiment.

      Reviewer #3: “If Ssb1 functions to maintain Cdc12 in an assembly competent state preventing misfolding, one would expect either enhanced degradation or aggregation of Cdc12-mCherry in ssb1 mutant cells. Did the authors check for such scenario? Septin aggregation has been shown in a ssb1 ssb2 double deletion strain (Willmund et al., 2013), yet the data shown here predict that aggregation might already occur in single ssb1 mutants.”

      We already examined septin aggregation in single ssb1 mutants and showed these data (Supplementary Figure 4D). Indeed, this phenotype was the rationale for testing post-translational septin assembly in ssb1 single mutants. We have seen no evidence of septin degradation in any context (as we mentioned on line 889), so we would not expect it here. While we added new text and a very new citation showing that many “misfolded” conformations of wild-type E. coli proteins avoid aggregation and degradation, we do not think that the suggested experiments would add enough value to the current study to justify the effort, time and expense.

      Reviewer #3: “Fig. 3C: The figure showing septin ring fluorescence does not include error bars. This is crucial, also because the difference between wt and ssa4 mutant cells is not large.”

      There are, in fact, error bars included in the figure, as can be most clearly seen for the final timepoint for the ssa4∆ cells. For most of the other timepoints the error bars are smaller than the data point symbols (the circles and squares). We do not think that adjusting the size or opacity of the symbols to better show the error bars will be sufficiently valuable to justify the effort.

    1. I found this comment to be surprising as I have never heard of the "Black Identity Extremist" tag. Because I was interested in this, I did further research using Caulfield's “check for other coverage” technique and looked into it.

    2. The FBI said it has stopped using the "Black Identity Extremist" tag and acknowledged that white supremacist violence is the biggest terrorist threat this country faces. https://trib.al/OepGw2S

      To my understanding this is not exactly accurate and by that I mean, it is from multiple people and not organically sourced which can make it unreliable.

    3. The FBI said it has stopped using the "Black Identity Extremist" tag and acknowledged that white supremacist violence is the biggest terrorist threat this country faces.

      The Root was a black justice community organizer, but after scrolling over the check, I discovered it is a digital magazine platform something which shares previously believed information from numerous black perspectives. I was using the majority opinion for other coverage and discovered that there is no actual news on this and that the link in the tweet shared is to their blog post.

    4. The FBI said it has stopped using the "Black Identity Extremist" tag and acknowledged that white supremacist violence is the biggest terrorist threat this country faces.

      This article is so true. White terrorism and White supremacy has been the biggest threat to our American citizens. The basis of being an all white society and hurting or harming those who do not fit is blatant terrorism.

    1. we're gonna sanction the periodic table original question alex which is that these people live in a land of illusions 00:21:08 they live in a relationship in a fantasy world that you know you know i last i checked you can't tag atoms of gold with um with nfps or with little markers on the blockchain in order to figure out where they came from

      sanction the periodic table

      fantasy world

      can't tag atoms of gold with urn nfts

    1. https://www.zylstra.org/blog/2022/06/spring-83/

      I've been thinking about this sort of thing off and on myself.

      I too almost immediately thought of Fraidyc.at and its nudge at shifting the importance of content based on time and recency. I'd love to have a social reader with additional affordances for both this time shifting and Ton's idea of reading based on social distance.

      I'm struck by the seemingly related idea of @peterhagen's LindyLearn platform and annotations: https://annotations.lindylearn.io/new/ which focuses on taking some of the longer term interesting ideas as the basis for browsing and chewing on. Though even here, one needs some of the odd, the cutting edge, and the avant garde in their balanced internet diet. Would Spring '83 provide some of this?

      I'm also struck by some similarities this has with the idea of Derek Siver's /now page movement. I see some updating regularly while others have let it slip by the wayside. Still the "board" of users exists, though one must click through a sea of mostly smiling and welcoming faces to get to it the individual pieces of content. (The smiling faces are more inviting and personal than the cacophony of yelling and chaos I see in models for Spring '83.) This reminds me of Stanley Meyers' frequent assertion that he attempted to design a certain "sense of quiet" into the early television show Dragnet to balance the seeming loudness of the everyday as well as the noise of other contemporaneous television programming.

      The form reminds me a bit of the signature pages of one's high school year book. But here, instead of the goal being timeless scribbles, one has the opportunity to change the message over time. Does the potential commercialization of the form (you know it will happen in a VC world crazed with surveillance capitalism) follow the same trajectory of the old college paper facebook? Next up, Yearbook.com!

      Beyond the thing as a standard, I wondered what the actual form of Spring '83 adds to a broader conversation? What does it add to the diversity of voices that we don't already see in other spaces. How might it be abused? Would people come back to it regularly? What might be its emergent properties?

      It definitely seems quirky and fun in and old school web sort of way, but it also stresses me out looking at the zany busyness of some of the examples of magazine stands. The general form reminds me of the bargain bins at book stores which have the promise of finding valuable hidden gems and at an excellent price, but often the ideas and quality of what I find usually isn't worth the discounted price and the return on investment is rarely worth the effort. How might this get beyond these forms?

      It also brings up the idea of what other online forms we may have had with this same sort of raw experimentation? How might the internet have looked if there had been a bigger rise of the wiki before that of the blog? What would the world be like if Webmention had existed before social media rose to prominence? Did we somehow miss some interesting digital animals because the web rose so quickly to prominence without more early experimentation before its "Cambrian explosion"?

      I've been thinking about distilled note taking forms recently and what a network of atomic ideas on index cards look like and what emerges from them. What if the standard were digital index cards that linked and cross linked to each other, particularly in a world without adherence to time based orders and streams? What does a new story look like if I can pull out a card either at random or based on a single topic and only see it or perhaps some short linked chain of ideas (mine or others) which come along with it? Does the choice of a random "Markov monkey" change my thinking or perspective? What comes out of this jar of Pandora? Is it just a new form of cadavre exquis?

      This standard has been out for a bit and presumably folks are experimenting with it. What do the early results look like? How are they using it? Do they like it? Does it need more scale? What do small changes make to the overall form?


      For more on these related ideas, see: https://hypothes.is/search?q=tag%3A%22spring+%2783%22

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Response to the reviewers

      Manuscript number: RC-2022-01407

      Corresponding author(s): Ivana, Nikić-Spiegel

      1. General Statements

      We would like to thank the reviewers for careful reading of our manuscript and for their insightful and useful comments. We are happy to see that the reviewers find these results to be of interest and significance. The way we understand reviewers’ reports, their main concerns can be roughly divided in following categories: 1) providing more quantitative data 2) interpretation of the Annexin V/PI assay 3) additional evidence for calpain involvement. We intend to address these experimentally or by modifying the text, as outlined below.

      2. Description of the planned revisions

      Reviewer #1

      Fig1A/B o SYTO 16 staining suggests slight reshaping of nucleus upon spermine NONOate, showing less blurry punctae. From the SYTO 16 profile, this should be quantifiable.

      By looking at the shown examples and the entire dataset, it appears to us as if neuronal nuclei are shrinking upon spermine NONOate treatment resulting in their less blurry appearance. We are not sure if this is what the reviewer is referring to, but this can also be quantified by measuring changes in neuronal nuclear size. We already have this data from the measurements shown in Fig4 and we intend to show it in the revised version of the manuscript. Line profile measurements are also possible, but the nuclear size quantification might be more suitable for this purpose.

      o There is a subset of neuron nuclei that are SYTO 16 positive. Please quantify the ratio

      We will use our existing dataset to quantify the ratio of NFL positive and SYTO16 positive nuclei.

      FigS1A o Show NeuN with Anti-NFL merged figures

      We will show merged NeuN and anti-NFL images, which might require rearrangement of the existing figures and figure panels. We will do this in the revised manuscript.

      FigS1C o Show quantification and timeline. I want to know whether there is also a plateau reached here.

      As the data shown in the FigS1C do not include NeuN staining, we will do additional experiments and perform proposed quantifications.

      FigS2A-F o Though the statements might be true, selecting one nucleus for a line profile as a statement for the whole dataset seems problematic. Average a larger number of unbiased selected nuclei profiles across multiple cultures to make a stronger statement, or a percentage of positive nuclei as in FigS1b.

      Corresponding images and line profiles are representative of the entire dataset. However, we agree with the reviewer that this is not obvious from the current manuscript version. Thus, to strengthen our findings, we intend to quantify the percentage of positive nuclei as in FigS1b. The only difference will be that instead of NeuN, we will use SYTO16 as a nuclear marker. The reason being that the existing datasets contain images of NFL and SYTO16 and not NeuN.

      FigS3 • There are no fluorescence profiles, no quantification

      As the reviewer suggests, we will quantify the ratio of NFL positive and SYTO16 positive nuclei, and include the quantifications in the revised manuscript.

      General statement: There do seem to be punctated patterns of non-nucleus accumulating NFL fragments. Can they be localized to any specific structure?

      We assume that the reviewer is referring to neuronal/axonal debris. They are present after injury but they do not colocalize with nuclear stains. We will address this in the revised manuscript.

      Fig1C-F • I find it too simplistic to categorize c+f and d+e together. There is a huge difference in the examples of nuclear localization between d and e. To not comment on their distinction (if that is consistent) is problematic. Also, since we don't see a merge with either NeuN or SYTO 16, reader quantification is difficult.

      We thank the reviewer for bringing this up. We will carefully check our entire dataset and we will update the figures and the text accordingly. We will also show the corresponding SYTO16 images, as the reviewer suggested.

      Would the microfluidic device construction allow for time to transport any axonally damaged fragments to the soma?

      Yes, the construction of the microfluidic devices allows the transport of axonal proteins back to the soma. Based on our experiments, it seems that damaged NFL from the axonal compartment could be contributing to the accumulation of NFL fragments in the nuclei. However, this contribution seems to be minimal as we cannot detect nuclear NFL upon the injury of axons alone. Alternatively, it could be that the processing of axonal NFL fragments proceeds differently if neuronal bodies are not injured and that this is the reason we don’t detect the NFL nuclear accumulation upon injury of axons alone. We will discuss this in the revised manuscript.

      Fig2C+D • The statement ".... no annexin V was detected on the cell membrane" needs to be shown more clearly

      We will modify figures to address this comment.

      • Please provide merged AnnexinV/PI images

      We will modify figures to address this comment.

      • The conclusion about 2D, that nuclear accumulated NFL overlaps with PI is not supported by the example image shown. There are plenty of PI positive spots that are not NFL positive and even several NFL positive ones that do not have a clear PI staining. Please quantify and then show a very clear result in order to be able to suggest necrosis as the underlying process.

      We are not sure if we understand the reviewer’s concern correctly. We will try to clarify it here and in the revised text. If necessary, we will tone down our conclusion, but the reason why not all of PI positive spots are NFL positive is most likely due to the fact that not all injured nuclei are NFL positive. We quantified in FigS1 that up to 60% of nuclei under injury conditions show NFL accumulations. That is why we are not surprised to see some PI positive/NFL negative nuclei. And the fact that there are some NFL positive nuclei which appear to be PI negative is most likely related to the fact that the PI binding is affected. In addition, upon closer inspection of NFL and PI panels in Fig2d it can be observed that NFL positive nuclei are also PI positive, albeit with a lower PI fluorescence intensity. We will modify the figure to show this clearly in the revised manuscript.

      FigS5 C+D • If the case is made that nitric oxide damage induces necrosis, then why is it that the AnnexinV example of Staurosporine exposure (which induces apoptosis) looks similar to that of nitric oxide damage in Fig2d and necrosis induction with Saponin looks very different?

      We thank the reviewer for bringing this up. We will try to clarify this in the revised manuscript. Regarding the specific questions, the most likely explanation why staurosporine treated neurons look similar to the ones treated with spermine NONOate is that in the late stages of apoptosis cell membrane ruptures and allows for the PI to label nuclei. This is probably the case here as illustrated by the nucleus in the middle of the image (FigS5c) that shows the fragmentation characteristic for the apoptosis. This is not happening in early apoptotic cells due to the presence of an intact plasma membrane. On the other hand, the reason why saponin treated cultures look different compared to spermine NONOate is that membranes are destroyed by saponin so that the PI can enter the cell. For that reason, there could have not been any AnnexinV binding to the membrane which would correspond to the AnnexinV signal of spermine NONOate treated neurons. As we will discuss below, we did not try to mimic spermine NONOate-induced injury with saponin treatment. Instead this was a control condition for PI labeling and imaging. We also used a rather high concentration of saponin which probably destroyed all the membranes which was not the case with spermine NONOate treatment. We intend to do additional control experiments to address this.

      • Additionally, does necrosis induction with Saponin also cause NFL fragment accumulation in the nucleus? Please show a co-staining of them. Also, the authors want to make a claim about reduce PI binding in NFL accumulated necrotic cells. In these examples, the intensity of the nuclear stain of PI with Saponin looks dimmer than with Staurosporine. Are the color scalings similar? It might be that the necrotic process itself causes reducing binding of PI and is not related to the presence of NFL.

      With regards to this question, it is important to note that Annexin V and PI imaging was done in living cells. To obtain the corresponding anti-NFL signal as shown in Fig 2c,d we had to fix the neurons, perform immunocytochemistry and identify the same field of view. We tried to do the same procedure after saponin treatment (Supplementary Figure 5d) but the correlative imaging was very difficult due to the detachment of neurons from the coverslip after the saponin treatment. For this reason, we could not identify the same field of view co-stained with NFL. However, other fields of view did not show NFL fragment accumulation. This could also be the consequence of the high saponin concentration that we used as we discuss above. We have also noticed the reduced intensity of PI binding in the nuclei of saponin-treated neurons. However, if the necrotic process itself reduces the binding of PI to the DNA, then all of the neurons treated with spermine NONOate would have an equally low PI signal. In our experiments, only the nuclei which contained NFL accumulations had a low PI signal, while the signal of NFL-negative nuclei was higher (as shown in Fig2d). We would also like to point out again that the saponin treatment was our control of the PI’s ability to penetrate cells and bind the DNA, as well as our imaging conditions, and not the control of the necrotic process itself. This is the reason why we didn’t go into details about neuronal morphology and NFL localization upon saponin treatment. We thank the reviewer for pointing this out since it prompted us to reevaluate what we wrote in the corresponding paragraph of the manuscript. We realized that the confusion might stem from our explanation of the AnnexinV/PI assay controls in the lines 196-198 (“Additional control experiments in which neurons were treated with 10 μM staurosporine (a positive control for induction of apoptosis) or with 0.1% saponin (a positive control for induction of necrosis) confirmed the efficiency of the annexin V/PI assay (Supplementary Fig. 5c,d).”). We will modify this portion of the text to clearly state that staurosporine and saponin treatments were controls of the AnnexinV and PI binding to their respective targets and not of the apoptosis/necrosis process. When it comes to the saponin treatment, our intention was only to permeabilize the membranes in order to allow PI penetration and DNA binding and not to induce necrosis or to mimic the effect of the spermine NONOate. We also intend to perform experiments with lower concentration of saponin to try to address this experimentally in addition to the text modifications.

      Fig3d • Please show similarly scaled images from controls for proper comparison

      We will show similarly scaled images of the control neurons so that they can be properly compared. They were initially not scaled the same for visualization purposes, but we will modify this in the revised manuscript.

      • How do the authors scale the degree and kinetics of induced damage between application of hydrogen peroxide/CCCP and glutamate toxicity? Does glutamate toxicity take longer to affect the cell, not allowing enough time to accumulate NFL fragments in the nucleus?

      It is challenging to scale the degree and kinetics of induced damage with different stressors. That is why we did not intend to do this. Instead we set different injury conditions based on the published literature. That is why can only speculate when it comes to this. In this regard, it can be that the glutamate toxicity takes “longer” to affect the cells even though it is very difficult to compare them on a timescale, especially when considering different mechanisms of action. We will discuss this limitation in the revised manuscript.

      Fig4B • Some groups (like NO and NO + emricasan) have much larger numbers of close to 0 intensity, compared to the control group. Why?

      We were wondering the same when we analyzed the data. The fact that our nuclear fluorescence intensity analysis picked up NFL signal in control neurons which had no nuclear NFL accumulation made us realize that the intensity measured in the nuclei of control group comes entirely from the out of focus fluorescence – from neurofilaments in cell bodies, dendrites and axons (an example can be seen in the FigS6). That is why we presented the corresponding data with a cut-off value based on the control signal (as mentioned in lines 238-240). Since the oxidative injury causes NFL degradation (not only in neuronal soma, but also neuronal processes), the overall fluorescence intensity of the NFL immunocytochemical staining is reduced in injured neurons. We can see that in all of our images. Consequently, there is no contribution of out of focus fluorescent signal to the measured fluorescence intensity in the majority of nuclei. Due to that, the nuclei without NFL accumulation (at least 40% of injured nuclei) will appear to have a close to 0 intensity of the fluorescent signal. We will discuss and clarify this additionally in the revised manuscript.

      • Please add the ratio of above/below threshold (50/50 obviously in controls)

      We will update the figure in the revised manuscript.

      • The description of the CTCF value calculation seems a little... muddled? Several parameters are described whereas "integrated density" is not even used. Why not simply mean intensity of nuclear ROI-mean intensity of background ROI?

      We included the integrated density in the description since it is measured together with the raw integrated density and can also be used for the CTCF value calculation. However, since we didn’t use it for the CTCF calculation, we will remove it from the corresponding section of the manuscript. We calculated the CTCF value instead of calculating mean intensity of the nuclear ROI - mean intensity of the background ROI, since the CTCF value also takes into account the area of the ROI and not just the mean intensity.

      • Also, please tell me if the areas for nuclear ROIs change, as I noted for Fig1A/B

      We will include this information in the revised manuscript.

      • To make sure that one of the 3 experimental repeats didn't skew the results, please show the median fluorescence intensity for each individual experiment to clarify that the supposed effect is repeated across experiments.

      We have already noticed that in the earliest of the three experiments overall fluorescence intensity was higher, but this was consistent across all the experimental groups and did not skew the results or affect the overall conclusion. However, we will double-check this and revise the figure.

      • From the text "...and due to the NFL degradation during injury...": this seems to contradict the process? Either the NFL fragment accumulates in the nucleus or it is degraded during injury. And isn't the degradation through calpain what supposedly allows this fragment of NFL to go to the nucleus in the first place? I reckon that the authors are possibly trying to reconcile why there are many close-to-0 intensity nuclei in the NO and NO + emricasan groups, but I don't feel the explanation given here fits.

      As we tried to explain in our response above, we think that the overall degradation of neurofilaments in neurons affects the fluorescence intensity originating from the out of focus neurofilaments. Therefore, the nuclei without NFL accumulation in injured conditions have a close to 0 fluorescence intensity. Additionally, we think that this is not an either/or situation, but that both degradation and nuclear accumulation of NFL happen simultaneously. We also think that degradation of axonal NFL and the transport of its tail domain to the soma will at least partially contribute to the accumulation in the nucleus. In any case, degradation and nuclear accumulation seem to be differentially regulated in individual neurons, as some of them show nuclear NFL accumulation and some not. Furthermore, calpain and other mechanisms could also cause NFL degradation up to the point at which these fragments can no longer be recognized by the anti-NFL antibody leading to the loss of signal. We will try to clarify this in the revised version of the manuscript.

      Fig5 • Does the distribution of this GFP in B match any of the various antibody stainings of different NFL fragments? Perhaps this is still a valid fragment of NFL, just not picked up by any AB?

      The GFP signal in B appears rather homogenous and it does not match any of the various antibody stainings of different NFL fragments. As the reviewer points out, this could also be a valid fragment of NFL fused to GFP that none of our antibodies is recognizing. We will clarify this in the revised manuscript.

      • "... and was indistinguishable from the full277 length NFL-GFP." Based on what parameters?

      We will clarify this in the revised text, but we meant in terms of overall neurofilament network and cell appearance, which is commonly used to test the effect of NFL mutations.

      • The authors claim that b is different from d, but I am not convinced. I would like to see a time dependent curve from multiple cells showing a differential change in nuclear and cytosolic GFP signal.

      As we also wrote in the manuscript, in the majority of neurons that were monitored during injury we were not able to detect an increase in the GFP fluorescence intensity in the nucleus. This is what prompted further experiments with NFL(ΔA461–D543)-FLAG. We will clarify this additionally in the revised manuscript and perform line profile intensity measurements to show the difference in nuclear and cytosolic GFP signal.

      • Secondly, the somatic GFP intensity for NFL increases for full length NFL-GFP. How is this explained, if it is only a separation of NFL and GFP? If anything, GFP should float away. And if the answer is that NFL is recruited to the nucleus, you showed that inhibition of calpain activity partially prevents that. So, if calpain activity is necessary for the transport of NFL to the nucleus, then wouldn't it also cut the GFP from NFL before it reaches the nucleus?

      We thank the reviewer for bringing this up and we apologize for the confusion. This can be explained by the fact that the images were scaled in a way that the GFP signal over time could still be seen easily (i.e. differently across different time points which we unfortunately forgot to mention in the figure legend). In the revised manuscript, we will either scale the images the same or we will alternatively show the displayed grey values in individual panels.

      Fig6 • It is recommended to overlap the transfected cells with a stain for endogenous NFL to show that despite the absence of the FLAG-tag, there is still NFL.

      We did not overlap the anti-NFL with anti-FLAG and SYTO16 staining, due to the space constraint and the intent to clearly show the overlap of FLAG and SYTO16 signals in the merged images above the graphs. However, the line profile intensity measurements were done in all three channels and show that despite the absence of FLAG, there is still NFL in the nucleus (Fig6b), or that both FLAG and NFL are present in the nucleus (Fig6d, NFL signal shown in gray). However, as this is not obvious and can easily be overlooked, we will show the endogenous NFL staining overlap in the revised version of the manuscript.

      Fig7 • „ ...all disrupted neurofilament assembly...": this sounds like the staining for native NFL supposedly shows a distortion due to a dominant negative effect of the expression of these constructs? Please clarify.

      Yes, we were referring to the disruption of neurofilament assembly due to a dominant negative effect of the expression of NFL domains. We will clarify this in the revised version of the manuscript.

      Discussion: • The authors show that after overepression of the head domain only, it possibly passively diffuses into the nucleus even in the absence of oxidative injury. However, it seems to be suggested as well that the head domain would not be freely floating around if it wouldn't be for increased calpain activity as a result of oxidative injury in the first place. Therefore, a head domain fragment localized in the nucleus would still more prominently happen upon oxidative injury and interact with DNA through prior identified putative DNA interaction sites from Wang et al. Please comment.

      That is correct. Upon injury and calpain cleavage, it is conceivable that a fragment containing the NFL head domain would also be present in the cell and could potentially diffuse to the nucleus and interact with the DNA. However, by staining injured neurons with an antibody that recognizes amino acids 6-25 of the NFL head domain, we were not able to detect an NFL signal in the nucleus (FigS2a,b). It could be that either the NFL head domain does not localize in the nuclei upon injury, or that the fragment localizing in the nucleus does not contain amino acids 6-25 of the NFL head domain. As the putative DNA-binding sites described by Wang et al involve 7 amino acids located in the first 25 residues of the NFL head domain, we would expect to detect it with the aforementioned antibody. However, as that was not the case we speculated that the interaction of NFL and DNA occurs differently in living cells, as opposed to the test tube conditions utilized by Wang et al. We will comment and clarify this in the revised version of the manuscript.

      • Reviewer #2*

      • Major Comments:

      • The initial data presented in the paper is good, does response of oxidative damage with proper controls, testing the antibodies to NF-L and etc. (Fig. 1-Fig. 4). *

      We thank the reviewer for their positive feedback.

      1. The evidence for calpain involvement in NF-L cleavage during oxidative damage is missing. Provide the evidence for full length NF-L construct and deletion mutants transfected into cells by immunoblot for cleavage of NF-L, perform nuclear and cytoplasmic extract preparations and show that enrichment of the tagged cleaved NF-L fragment in nuclear fraction.

      We thank the reviewer for their comments and suggestions. Since we saw in our microscopy experiments that calpain inhibition reduced the accumulation of NFL in the nucleus, and since it is known that NFL is a calpain substrate (Schlaepfer et al., 1985; Kunz et al., 2004 and others), we did not perform additional experiments to confirm the involvement of calpain in NFL degradation during injury. However, to strengthen our findings, we intend to perform the suggested experiments and include the results in the revised manuscript.

      1. Show calpain activation during oxidative damage by performing alpha-Spectrin immunoblots identify calpain specific 150-kda Spectrin and caspase specific 120-kDa fragment generation in these cells. Also, calpain activation can be measured by MAP2 level alteration and p35 to p25 conversion. Without this evidence it's very hard to believe if the calpain activity is increased or decreased during oxidative damage and these markers are altered by using calpain inhibitors.

      To confirm the calpain activation, we intend to perform anti-alpha spectrin and/or anti-MAP2 blots in lysates of control and injured neurons and include the results in the revised manuscript.

      1. The premise that NF proteins are absent in cell bodies and present only in axons is not correct. It has been demonstrated by multiple investigators that NFs are present in the perikaryon and dendrites of many types of neurons (Dahl, 1983, Experimental Cell Research)., Dr. Ron Liem's group showed NF protein expression in cell bodies of dorsal root ganglion cells (Adebola et ., 2015, Human Mol Genetics) and also showed N-terminal antibodies for NF-L, NF-M and NF-H stain rat cerebellar neuronal cell bodies and dendrites (Kaplan et al., 1991, Journal of Neuroscience Research) when NFs are less phosphorylated. (Schlaepfer et al., 1981, Brain Research) show staining of cell bodies of cortex and dorsal root ganglion cell bodies with NF antibody Ab150, and Yuan et al., 2009 in mouse cortical neurons with GFP tagged NF-L.

      We are not sure what the reviewer is referring to since we cannot find a corresponding section in which we claim that NF proteins are absent in cell bodies. We wrote the following “Anti-NFL antibody staining of neurons treated with the control compound showed the expected neurofilament morphology, that is, a strong fluorescence intensity in axons and lower intensity in cell bodies and dendrites (Fig. 1a)” in our results section (lines 119-121), but the claim we were trying to make there was that NF proteins are particularly abundant in axons. We will clarify this in the revised manuscript.

      1. Quantifying NF-L signal or tagged NF-L fragment signals in the cell body by ICC has many problems and making conclusions. It's extremely difficult to have control over levels of proteins in transfected overexpression models and comparing two or three different constructs with each other by ICC. Not every cell expresses same levels of protein in transfected cells and quantifying it by ICC again has a major problem. This can be addressed if there are stable lines that express equal levels of protein in all cells that comparisons can be made. Under thesese circumstances validation of the hypothesis presented in the study has no strong direct evidence to demonstrate that calpain is activated and NF-L fragment translocate to the nucleus.

      We agree that the results from overexpression-based experiments should be interpreted with caution as levels of expression vary between the cells. We intend to discuss this in the revised manuscript. However, we find it difficult to experimentally address this comment since we are not sure which specific experiments the reviewer is referring to. With regards to this, we would like to emphasize that most of the initial experiments in which we observed NFL accumulation in the nuclei of injured neurons were based on the ICC labeling of endogenous NFL and didn’t involve its overexpression. This includes labeling of endogenous NFL in various types of neurons, comparing the effects of different types of oxidative injury, as well as testing the effects of calpain inhibition on the observed nuclear accumulation (Figures 1-4; Supplementary Figures 1-6). We later resorted to the overexpression experiments in primary neurons (Figures 5-7; Supplementary Figure 7, 10) to gain more information about the identity of NFL fragment which was detected in the nucleus. Due to the low transfection efficiency of primary neurons, we performed an additional set of overexpression experiments in neuroblastoma ND7/23 cells (Figure 8; Supplementary Figures 8,9) and obtained similar results in a higher number of cells. We agree that having stable cell lines which e.g. express same levels of NFL domains would be a more elegant approach and we intend to make them for our follow-up studies, however the generation of said stable cell lines might be beyond the scope of this revision. Furthermore, looking at our data with overexpression of NFL domains in ND7/23 cells (Supplementary Figure 8,9), it appears to us as if different domains are rather homogenously expressed in different cells. While the expression levels might vary, it seems that they all show the same trend when it comes to their localization (which was the main point of those experiments).

      1. The interpretation that NF-L preventing DNA labeling cells is misinterpretation. NFs have very long half-life compared to other proteins. Due to oxidative damage, DNA is degraded in the cells but NFs that have very long half-life you see as NFs rings in the dead cells. So, NFs do not prevent DNA labeling, but DNA or chromatin is degraded in dead cells.

      We thank the reviewer for their useful insight. DNA degradation could certainly be the reason why we observe a lower fluorescence intensity of the propidium iodide fluorescence in the nuclei of injured neurons. We intend to discuss this in the revised manuscript. However, if the DNA degradation is the only reason for the lower PI fluorescence intensity, then the PI fluorescence intensity would be the same in all injured nuclei. In our experiments, we saw the reduced PI fluorescence intensity in nuclei that contained NFL accumulations and not in other nuclei. Additionally, we observed a reduction of SYTO16 fluorescent labeling of nuclei which contained accumulations of the NFL tail domain, even in the absence of oxidative injury. Due to these reasons we speculated that NFL accumulation in the nucleus might hinder nuclear dyes from interacting with the DNA. But this is only a speculation and we will try to clarify this further in the revised manuscript including alternative explanations.

      Minor comments: 1. In the introduction on page 4 reference is missing for NF transport, aggregation and perikaryal accumulation (on line 93).

      We will add a reference to the revised manuscript.

      1. The statement in discussion on page 14 line 454 for Zhu et al., 1997 study is not accurate. It should be modified to sciatic nerve crush not spinal cord injury.

      We will correct this mistake in the revised manuscript.

      1. What is the size of the calpain cleaved NF-L tail domain? If you perform immunoblots on cell extracts treated with oxidative agents one would know it.

      We will perform immunoblots on cell lysates and incorporate the corresponding results in the revised manuscript.

      1. Authors could make their conclusions clear. This is particularly true for the experiments in Figure 4 panels c and d. It is very difficult to understand the conclusions of the experiments. First state the expectation and then described whether the expectation is true or different.

      We will do as the reviewer suggested in the revised manuscript.

      1. The ICC images are at extremely low magnification. They should be shown at 100x or 120x so that details of the cell body and the nucleus can be seen.

      Our intention was to show larger fields of view and wherever appropriate insets, but we will try to improve this in the revised manuscript by either zooming in, cropping or adding additional insets with individual cell bodies and nuclei. In general, images were taken with an optimal resolution/pixel size in mind for any of the used objectives (60x/1.4 NA or 100x/1.49 NA) and we can easily modify our figure panels to show more details.

      1. Oxidative damage leads to beaded accumulation of NF-L in neurites and axons. Authors should address this issue.

      We will discuss this in the revised manuscript.

      1. The combination treatment of the inhibitors (last 3 sets of the Fig. 4 b) has no statistical significance should be removed.

      Actually, these differences were statistically significant (Supplementary Table 1). For clarity and as described in the figure legend (line 516: “The most relevant significant differences are indicated with an asterisk”) we showed only a subset of them on the graph, but we will change this in the revised manuscript.

      1. Why only two antibodies recognize cleaved NF-L? If the antibodies at directed at tail region, they should recognize it unless the phosphorylated tail at Ser473 may inibit the antibody binding. In that case NF-L Ser473 specific antibody (EMD Millipore: MABN2431) may be used to test this idea.

      This is a very good point that we also wonder about. Even if all antibodies are directed at tail region, exact epitopes are not described for all of them. That makes it also difficult for us to understand and speculate on this. However, we have already ordered the new antibody as suggested by the reviewer and we will experimentally test it.

      **Referees cross-commenting**

      I agree with the reviewer#1 about presenting the quantification data for the indicated figures to make conclusions strong and see how much of variation is there among sampled cells.

      As discussed in our response to reviewer #1, we will provide additional quantifications.

      3. Description of the revisions that have already been incorporated in the transferred manuscript

      4. Description of analyses that authors prefer not to carry out

      Reviewer #2, major comment 7. Authors could do chromatin immunoprecipitation (chip) analysis to identify NF-L binding sites on chromatin and perform gel shift assays to show NF-L tail domain binding to specific consensus DNA sequences.

      We thank the reviewer for their suggestion. We are very interested in performing additional experiments and identifying the NFL binding sites on the DNA (either by chromatin immunoprecipitation or DamID-seq) and we intend to perform these experiments as soon as possible. Unfortunately, at the moment we do not have the expertise to perform such experiments in our lab. Instead, this type of follow-up project requires establishing a collaboration which is beyond the scope of this revision.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary:

      The manuscript presented by Arsić and Nikić-Spiegel investigates a physiological consequence when neurons in vitro are exposed to oxidative stress injury, specifically a supposed interaction of the tail subdomain of the neurofilament light chain (NFL), after cleavage of the full NFL protein by calpain.

      General comments:

      The conclusions the authors draw from individual non-quantified example images are sometimes seen to be too simplistic when the shown examples ask for a more thorough investigation, especially when specific merged images are not available. It is highly recommended that the authors use the available data to come to more comprehensive answers across the entire acquired dataset. This for instance happens only in figures 4 and 8 and should be extended to other figures as well. There is not necessarily doubt about the author's general claims, but convincing the reader requires showing the variability and effect size of the entire group beyond a single selected example.

      If these more thorough quantifications continue to support the author's claims, then I find no objections for publication of this data.

      Specific comments:

      Fig1A/B - SYTO 16 staining suggests slight reshaping of nucleus upon spermine NONOate, showing less blurry punctae. From the SYTO 16 profile, this should be quantifiable. - There is a subset of neuron nuclei that are SYTO 16 positive. Please quantify the ratio

      FigS1A - Show NeuN with Anti-NFL merged figures

      FigS1C - Show quantification and timeline. I want to know whether there is also a plateau reached here.

      FigS2A-F - Though the statements might be true, selecting one nucleus for a line profile as a statement for the whole dataset seems problematic. Average a larger number of unbiased selected nuclei profiles across multiple cultures to make a stronger statement, or a percentage of positive nuclei as in FigS1b.

      FigS3 - There are no fluorescence profiles, no quantification

      General statement:

      There do seem to be punctated patterns of non-nucleus accumulating NFL fragments. Can they be localized to any specific structure?

      Fig1C-F - I find it too simplistic to categorize c+f and d+e together. There is a huge difference in the examples of nuclear localization between d and e. To not comment on their distinction (if that is consistent) is problematic. Also, since we don't see a merge with either NeuN or SYTO 16, reader quantification is difficult. - Would the microfluidic device construction allow for time to transport any axonally damaged fragments to the soma?

      Fig2C+D - The statement ".... no annexin V was detected on the cell membrane" needs to be shown more clearly - Please provide merged AnnexinV/PI images - The conclusion about 2D, that nuclear accumulated NFL overlaps with PI is not supported by the example image shown. There are plenty of PI positive spots that are not NFL positive and even several NFL positive ones that do not have a clear PI staining. Please quantify and then show a very clear result in order to be able to suggest necrosis as the underlying process.

      FigS5 C+D - If the case is made that nitric oxide damage induces necrosis, then why is it that the AnnexinV example of Staurosporine exposure (which induces apoptosis) looks similar to that of nitric oxide damage in Fig2d and necrosis induction with Saponin looks very different? - Additionally, does necrosis induction with Saponin also cause NFL fragment accumulation in the nucleus? Please show a co-staining of them. Also, the authors want to make a claim about reduce PI binding in NFL accumulated necrotic cells. In these examples, the intensity of the nuclear stain of PI with Saponin looks dimmer than with Staurosporine. Are the color scalings similar? It might be that the necrotic process itself causes reducing binding of PI and is not related to the presence of NFL.

      Fig3d - Please show similarly scaled images from controls for proper comparison - How do the authors scale the degree and kinetics of induced damage between application of hydrogen peroxide/CCCP and glutamate toxicity? Does glutamate toxicity take longer to affect the cell, not allowing enough time to accumulate NFL fragments in the nucleus?

      Fig4B - Some groups (like NO and NO + emricasan) have much larger numbers of close to 0 intensity, compared to the control group. Why? - Please add the ratio of above/below threshold (50/50 obviously in controls) - The description of the CTCF value calculation seems a little... muddled? Several parameters are described whereas "integrated density" is not even used. Why not simply mean intensity of nuclear ROI-mean intensity of background ROI? - Also, please tell me if the areas for nuclear ROIs change, as I noted for Fig1A/B - To make sure that one of the 3 experimental repeats didn't skew the results, please show the median fluorescence intensity for each individual experiment to clarify that the supposed effect is repeated across experiments. - From the text "...and due to the NFL degradation during injury...": this seems to contradict the process? Either the NFL fragment accumulates in the nucleus or it is degraded during injury. And isn't the degradation through calpain what supposedly allows this fragment of NFL to go to the nucleus in the first place? I reckon that the authors are possibly trying to reconcile why there are many close-to-0 intensity nuclei in the NO and NO + emricasan groups, but I don't feel the explanation given here fits.

      Fig5 - Does the distribution of this GFP in B match any of the various antibody stainings of different NFL fragments? Perhaps this is still a valid fragment of NFL, just not picked up by any AB? - "... and was indistinguishable from the full277 length NFL-GFP." Based on what parameters? - The authors claim that b is different from d, but I am not convinced. I would like to see a time dependent curve from multiple cells showing a differential change in nuclear and cytosolic GFP signal. - Secondly, the somatic GFP intensity for NFL increases for full length NFL-GFP. How is this explained, if it is only a separation of NFL and GFP? If anything, GFP should float away. And if the answer is that NFL is recruited to the nucleus, you showed that inhibition of calpain activity partially prevents that. So, if calpain activity is necessary for the transport of NFL to the nucleus, then wouldn't it also cut the GFP from NFL before it reaches the nucleus?

      Fig6 - It is recommended to overlap the transfected cells with a stain for endogenous NFL to show that despite the absence of the FLAG-tag, there is still NFL.

      Fig7 - „ ...all disrupted neurofilament assembly...": this sounds like the staining for native NFL supposedly shows a distortion due to a dominant negative effect of the expression of these constructs? Please clarify.

      Discussion:

      • The authors show that after overepression of the head domain only, it possibly passively diffuses into the nucleus even in the absence of oxidative injury. However, it seems to be suggested as well that the head domain would not be freely floating around if it wouldn't be for increased calpain activity as a result of oxidative injury in the first place. Therefore, a head domain fragment localized in the nucleus would still more prominently happen upon oxidative injury and interact with DNA through prior identified putative DNA interaction sites from Wang et al. Please comment.

      Significance

      This in vitro study, despite its acknowledged caveats, can provide novel support for the claim that calpain induced cleavage of the NFL may play a role in downstream gene expression in order to regulate a neural response upon oxidative injury. Further investigation into this topic may provide further understand of physiological gene expression through interaction with cleavage products as well as yield possible therapeutic targets for pathological conditions. This study therefore may be of interest to a broad audience.

  4. Jun 2022
    1. Es gilt daher, diese digitale Affinität der Studie-renden methodisch und inhaltlich zu motivieren und philosophisch fruchtbar zumachen

      Das sagt Will Richardson auch für den Bereich der Schule so. Es muss, in der Schule noch mehr, v.a. pädagogische und didaktische Expertise in digitale Transformationen einfließen. Man läuft sonst Gefahr u.a. Konsumtendenzen nicht kritisch gegenüber treten zu können und unmündiges Verhalten an den Tag zu legen und im schlimmsten Falle zu lehren.

    Tags

    Annotators

    1. h0p3 has a home page entry point that is carefully curated and groomed, but which is several layers up from a complete chaos of link dumps, raw drafts and random introspections […] These layers run a spectrum of accessibility—there is always a learning curve before you hit the bottom. You start with a doorway before entering a maze.

      carefully cureated groomed

      chaos of link dumps

      you start with a door way before entering a maze

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity (Required)): **Summary:** Techniques to probe the local environment of membrane proteins are sparse, although the influence of lipids on the membrane protein's function are known since many years. Therefore, the paper by Umebayashi et al. is important. The environment-sensitive dye Nile red (NR) coupled to a membrane protein is an appropriate sensor for monitoring the local membrane fluidity. Linking of Nile red to the receptor via a flexible tether was achieved with the acyl carrier protein (ACP)-tag method. Experiments showed that depending on the ACP site a certain linker length is required to have NR inserted in the membrane and thus be an effective sensor for lipid disorder. This technology could be of general usability to study the environment of membrane proteins in the context of their function. As an example, the technique allowed insulin induced membrane disorder in the close insulin receptor vicinity to be observed. Further, results suggested that tyrosine activity is required for this disorder to happen. The experimental results appear to be complete and controls were made.

      **Major comments:** 1) Sometimes technical terms are used without explanation: What is the GP value? What is ACP-IR? The spectrum was measured in number of rois? The reader can find those abbreveations out, but it would be nice to have them defined.

      We have made a list of abbreviations.

      2) Fig. 1d) is confusing. The ACP-IR labelling is evident in 3 panels, but there is no difference in the color (emission spectra of 1992-ACP-IR vs 2031-ACP-IR should be visible??). The DAPI staining is very different. When doing the latter, how difficult is it to get the staining equal?

      The differences in spectra cannot be seen because we used pseudo colors for display of the DAPI and CoA-PEG-NR staining. The reviewer’s comments about the unequal DAPI staining is correct. The reason for this is most likely that the cell membrane is unequally permeabilized by PFA treatment. As the point of this figure is just to show that the plasma membrane is labeled, dependent upon the expression of the ACP-tagged insulin receptor, we don’t think that the variable intensities of the DAPI staining is important. DAPI is simply used to indicate the position of the cells.

      3) How can one interpret Fig. 4: a) Control goes over 4 frames, at 240" insulin is added, and 10 frames should show a fluctuation difference?

      We showed 4 frames after control treatment that showed no significant change was observed by control treatment. We expected that clear changes would be invoked by insulin treatment in GP images, however these changes, while visible in the GP images, are difficult to see for the untrained observer. This is the reason why we used the ZNCC method in the subsequent figures to better visualize the changes.

      1. b) A color shift from blue to green is visible after insulin addition. But it is faint - difficult to assess from the pseudo color scheme. What does 1000 pixel top/1000 pixel bottom mean in c). Is it an attempt to better visualize the fluctuation? It is difficult to recognize a difference before and after adding insulin. d) It seems that the kymograph set should show this. What is the color scale? Why is 3 so untypical, i.e., no change? Box 6 is also peculiar: the left side does not show a strong change upon insulin administration, the right side does. Why? We appreciate the helpful comments for improving our manuscript.

      As pointed out, the change of GP value is extremely small before and after insulin addition, so it is difficult to fully visualize the change with normal pseudo-color expression. To deal with this, we adopted the following two methods to visualize minute changes.

      1) Visualization of local changes of the statistical GP value showed by ZNCC throughout the time-lapse images (Fig. 6 and Fig. S2B).

      2) Visualization of the top/bottom 1000 pixels of the sorting ZNCC value in each image (Fig. 7 and Fig. S2C). The top 1000 pixels are the ones that showed the largest changes. The bottom 1000 pixels are the ones that showed the smallest changes.

      Owing to these expressions, we found out that the level of the response against the insulin signal was spatially and temporally heterogeneous in the membrane.

      As for the color scale, in order to clarify the meaning of the difference of color, we have added the description about the relationship between the color and the ZNCC value in the results section.

      4) How is the kymogram calculated? The legend says 'The horizontal dimension represents the averaged ZNCC inside the rectangular area, and the vertical dimension represents time'. The averaged ZNCC is a single value, so it is not clear why the kymogram shows a variation from left to right. May it be the ZNCC was averaged just vertically?

      We apologize that we did not provide information regarding making the kymograph.

      In the yellow rectangular area (Fig. 6B), the ZNCC values of the pixels with the same x coordinate value were vertically averaged, which were represented as the horizontal direction of the kymograph. That is, one horizontal line of the kymograph holds the spatial distribution of the ZNCC value along the horizontal direction of the membrane, and the vertical direction shows their time changes. To make it easier to understand, we refined the description about the kymograph in the legend of Fig. 6.

      5) When calculating cross-correlation values on images, they need to be aligned. What fraction of the total image does the selected 19x19 box represent? As described, I imagine that a rolling CC over 19x19 pixels is calculated over an image from the time lapse series comparing it with the reference Iave(x,y). Compared to the 3x3 median filtered CP image, the ZNCC image should then be much more blurred??

      Below we provide more information regarding the calculation of ZNCC.

      Each local window for ZNCC calculation is set to a 19x19 pixels centered on every single pixel excluding the edges of an image. The ZNCC value calculated in that window is set to a center pixel of that area. After that, a new window centered on the adjacent pixel is set and calculate the new ZNCC. That is, the calculation window is slid throughout the image. Also, the calculated ZNCC value is not set to all the pixels of the window, but is set to only the center pixel of the window, so there is no blur effect like median filtering.

      The figure below shows a schematic view of our ZNCC calculation.

      Schematic view of our ZNCC calculation

      **Minor comment:** On page 16 supplementary is not spelled properly.

      corrected

      Reviewer #1 (Significance (Required)):

      The key point of this paper is convincing and the new technology appears to have a lot of potential. It can be applied to study membrane protein function in the context of its environment, the lipid bilayer.

      Membrane fluidity measurements have been developed (e.g., using fluorescent probes like laurdan). However, the trick to link a probe like nile red by ACP technology to the insulin receptor and to observe its activity is quite new.

      A most recent description of such a technology is in TrAC Trends in Analytical Chemistry Volume 133, December 2020, 116092.

      This is an interesting review, but not directly impacting on our work.

      **Referees cross-commenting**

      All comments are constructive and important. The paper is important but needs to be amended as proposed.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)): **Summary:** In this manuscript, authors generated an ACP-attached Nile Red probe in order to specifically label Insulin receptor in the membrane. Owing to this specificity, one can measure the lipid membrane properties around a specific protein in the membrane. **Major comments:**

      For the conclusions in the manuscript to be convincing, in my opinion, these additional data need to be added. Some of these are new experiments, and some are detailed analysis of existing data. The new experiments are not for new line of investigation, instead it is to confirm their statements and conclusions. The major point is the reliability of spectral shift. In usual environment sensitive probes, it is certain that they are in the membrane whatever is done to the membrane. However, when the probe is attached to a protein, it is not trivial to have the same confidence that the probe is always inside the membrane, and it is in the same plane of the membrane. 1992-ACP-IR is a good example; authors state that it binds to the protein outside the membrane, but when there is cholesterol addition and -maybe more interestingly- cholesterol removal, the dye still reacts and changes its emission (even PreCT changes its emission quite a bit at the 570 nm region). This is a clear indication of a change in localization of the probe upon some changes in the membrane. This implies that observed spectral shifts may not be due to lipid packing differences, but due to localization of the probes. For this reason, it is crucial to know where any environment sensitive probe localize in the membrane with respect to membrane normal, and this knowledge is more important for this probe. Related to this, the spectral difference upon insulin treatment and activation of insulin receptor could be due to changes in probe's localization in the membrane. Especially because authors show in Fig1e, the spectra can change depending on the probe localization. Relatedly, quantum yield of NR should be significantly different when it is inside vs outside membrane. Authors should show QY for 1992-ACP-NR and 2031-ACP-NR with different PEG lengths and upon insulin treatment.

      We understand the logic of the request to measure the QY, since the QY of Nile red is much higher in organic solvents than in aqueous solutions, so it might be predicted that the QY of Nile red is higher in a lipid bilayer than when covalently bound to the protein in an aqueous environment. However, this argument depends upon the mechanism for the increase in quantum yield when going from aqueous to a non-polar solution. One possible explanation is based on the intrinsic properties of the dye under the two conditions. The alternative explanation would be that the dye would aggregate (be insoluble) in aqueous solution and therefore either not fluoresce or self-quench. In this case, we believe that the latter is the explanation because we and others have previously shown the turn-on properties of the probe when binding to proteins (SNAP-tag and others). It is not simple to measure QY in the cell under a microscope, but we have done something similar shown in supplementary figure 4. We labeled the three ACP-receptor complexes with PEG11-Nile red and co-stained with antibody to the Insulin Receptor. We then calculated a relative quantum yield. There were very little differences at all between the relative quantum yields, so we conclude that it is not the environment of the probe, which affects the quantum yield under these conditions, but the fact that it is covalently attached to a protein and incapable of forming aggregates. What distinguishes these constructs is the emission spectrum, not the quantum yield. In supplementary Table 2 we also did QY measurements in vitro and we could reproduce the increase of quantum yield by association with liposomes or in organic solvents. We tested whether non-covalent association with a protein would increase the QY by incubation with the lipid binding protein, BSA, in PBS. This was not the case, strongly pointing to the conclusion that it is the covalent association with the protein that increases the QY, not association with a protein. We believe that our demonstration of changes in fluorescent spectra with changes in cholesterol, large changes in fluorescent spectra with linker length for the 1992 construct and voltage sensitivity using patch-clamp prove that the Nile red is reporting on the membrane environment under the conditions we propose.

      **Minor comments:** - Fig 1d requires quantification We do not agree on this. This is simply to show that the labeling is dependent upon expression of the relevant ACP-IR constructs. There is no detectable labeling of the control.

      • Voltage sensitivity of different PEG length of 2031-ACP probe should be added. We have added this data in figure 2 panel E.

      • Fig 3a graph should show all data points, not only bar graphs. Also, the band in 3a for +CoA-PEG-NR is dimmer than other bands, is it specific to this particular gel since quantification does not show any difference?

      There is no significant difference- Fig 4d, colour code is needed.

      Done

      • Fig 5b and Fig3d are basically the same experiments in terms of control measurement, why is the difference in 3b is 0.04 GP unit while it is 0.007 GP unit?

      We explain in the MS, but have improved the title of Y-axis in Fig.5 b graph so that the difference in what is plotted is clear. - Why is inhibitor data so noisy? We should discuss.

      We don’t know the exact reason why inhibitor data is noisy, but we speculate that the actin cytoskeleton and phosphoinositide-dependent signaling could affect the membrane stability, and the membrane environment would be fluctuated in the presence of latrunculin B or PI3K inhibitor.

      Reviewer #2 (Significance (Required)): Overall, this is a very useful approach, and this line of research will yield very useful tools to shed light on how lipids surrounding proteins can change their function. Major advance of the paper is the new chemical biology tool. There is also biological data on how insulin can change the insulin receptor's membrane environment which is contradictory to some old literature claiming that InsR becomes more "rafty" upon insulin treatment (e.g., PMID: 11751579).

      If this type of tagging proves robust and reproducible (limitations and concerns listed above and below), it could be used by other researchers to tag their protein of interest and investigate the lipid environment around those proteins.

      The downside of this method is that the probe requires ACP tag, a relatively less used tag than others in biology, therefore researchers interested in using this probe should have their proteins with ACP tag. Moreover, the linker length and ACP-tag position are quite crucial parameters (and probably should be optimized for each protein). Longer PEG lengths cannot report on changes efficiently (Fig3b), while shorter lengths are prone to artefacts as they can go out of membrane (Fig1 and Fig2). This might limit its widespread use.

      The reason for using the ACP tag is that neither the SNAP tap nor the HALO tag working. The tethered Nile Red preferred to bind to the tqg rather than inserting into the membrane.

      **Referees cross-commenting** I agree with all comments and concerns of other reviewers. I see the usability and potential of this new technology along with its limitations as all three reviewers pointed out.

      Reviewer #3 (Evidence, reproducibility and clarity (Required)): See below. No concerns on any of these issues.

      Reviewer #3 (Significance (Required)): **Critique:** This MS reports a proof-of-principle for using site-directed environmentally sensitive probe technology to assess the local membrane environment of a receptor tyrosine kinase (IR) upon activation. This technology addresses a major gap in our arsenal of tools to study the mechanisms of membrane signaling as the parameters of interest are biophysical parameters rather than purely biochemical ones. How to do this with spatial and temporal resolution is a major challenge. This study builds on previous work by the Riezman group that develops an extrinsic labeling system to tether Nile Red to specific sites on the ectodomain of a signaling receptor and then probe local membrane environments as a function of receptor activity. This is a carefully done study is well-controlled, is clever in design and is well-described. Although the major issues to which such a general technology could contribute involve intracellular (and not extracellular) event, the advances described will be of general interest -- particularly that local membrane order decreases when IR becomes activated. Specific comments for the authors' consideration follow:

      **Specific Comments:** (i) As a general comment, the authors are measuring extracellular plasma membrane leaflet properties that may or may not translate to what is happening in the local inner leaflet environment. A general reader may well miss the significance of this. This point needs to be more explicitly emphasized in the Discussion.

      This has been discussed in the revised version.

      (ii) Why not treat cells with a PLC inhibitor to block PIP2 hydrolysis and ask if that inhibits membrane disorder. It is PIP2 hydrolysis/resynthesis that regulates the actin cytoskeleton at signaling receptors and this seems an attractive candidate for study.

      There is a long list of attractive post-signaling events of the insulin receptor and how this works in different cell types that could be tested. We believe that this is beyond the scope of this study and we encourage others to do this.

      (iii) The data acquisition time is at least 4 min which is long enough for activated receptors to be recruited to sites of endocytosis. Can the authors exclude the possibility that what they are measuring isn't reflective of such spatial reorganization? Does a clathrin inhibitor block the observed change in local membrane order for activated IR? We determined localization to AP2 adaptor containing clathrin coated pits at the cell surface and showed that during the time-course of the experiment that there is no significant change in co-localization or evidence for endocytosis (new figure 9). Therefore, we decided not to do the clathrin inhibitor blocking experiment because we believe that it could only lead to indirect effects.

      (iv) Receptor activation is accompanied by other transitions such as dimerization, etc. Can the authors exclude the possibility that what they are measuring is related to changes in depth of insertion of the NR probe into the plasma membrane outer leaflet that is a consequence of IR conformational transitions associated with activation? This is highly unlikely given the fact that fluidification of the membrane environment is found with all length linkers. Given the intervals in increases in linker length on the 2031 construct, which is the closest to the membrane, it is very difficult to conceive that any of the ones larger than 5 PEGs restrict significantly the membrane insertion of the dye. **Referees cross-commenting**

      I think we have a consensus opinion

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #2

      Evidence, reproducibility and clarity

      Summary:

      In this manuscript, authors generated an ACP-attached Nile Red probe in order to specifically label Insulin receptor in the membrane. Owing to this specificity, one can measure the lipid membrane properties around a specific protein in the membrane.

      Major comments:

      For the conclusions in the manuscript to be convincing, in my opinion, these additional data need to be added. Some of these are new experiments, and some are detailed analysis of existing data. The new experiments are not for new line of investigation, instead it is to confirm their statements and conclusions. The major point is the reliability of spectral shift. In usual environment sensitive probes, it is certain that they are in the membrane whatever is done to the membrane. However, when the probe is attached to a protein, it is not trivial to have the same confidence that the probe is always inside the membrane, and it is in the same plane of the membrane. 1992-ACP-IR is a good example; authors state that it binds to the protein outside the membrane, but when there is cholesterol addition and -maybe more interestingly- cholesterol removal, the dye still reacts and changes its emission (even PreCT changes its emission quite a bit at the 570 nm region). This is a clear indication of a change in localization of the probe upon some changes in the membrane. This implies that observed spectral shifts may not be due to lipid packing differences, but due to localization of the probes. For this reason, it is crucial to know where any environment sensitive probe localize in the membrane with respect to membrane normal, and this knowledge is more important for this probe. Related to this, the spectral difference upon insulin treatment and activation of insulin receptor could be due to changes in probe's localization in the membrane. Especially because authors show in Fig1e, the spectra can change depending on the probe localization. Relatedly, quantum yield of NR should be significantly different when it is inside vs outside membrane. Authors should show QY for 1992-ACP-NR and 2031-ACP-NR with different PEG lengths and upon insulin treatment.

      Minor comments:

      • Fig 1d requires quantification
      • Voltage sensitivity of different PEG length of 2031-ACP probe should be added.
      • Fig 3a graph should show all data points, not only bar graphs. Also, the band in 3a for +CoA-PEG-NR is dimmer than other bands, is it specific to this particular gel since quantification does not show any difference?
      • Fig 4d, colour code is needed.
      • Fig 5b and Fig3d are basically the same experiments in terms of control measurement, why is the difference in 3b is 0.04 GP unit while it is 0.007 GP unit?
      • Why is inhibitor data so noisy?

      Significance

      Overall, this is a very useful approach, and this line of research will yield very useful tools to shed light on how lipids surrounding proteins can change their function. Major advance of the paper is the new chemical biology tool. There is also biological data on how insulin can change the insulin receptor's membrane environment which is contradictory to some old literature claiming that InsR becomes more "rafty" upon insulin treatment (e.g., PMID: 11751579).

      If this type of tagging proves robust and reproducible (limitations and concerns listed above and below), it could be used by other researchers to tag their protein of interest and investigate the lipid environment around those proteins.

      The downside of this method is that the probe requires ACP tag, a relatively less used tag than others in biology, therefore researchers interested in using this probe should have their proteins with ACP tag. Moreover, the linker length and ACP-tag position are quite crucial parameters (and probably should be optimized for each protein). Longer PEG lengths cannot report on changes efficiently (Fig3b), while shorter lengths are prone to artefacts as they can go out of membrane (Fig1 and Fig2). This might limit its widespread use.

      Referees cross-commenting

      I agree with all comments and concerns of other reviewers. I see the usability and potential of this new technology along with its limitations as all three reviewers pointed out.

    3. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Summary:

      Techniques to probe the local environment of membrane proteins are sparse, although the influence of lipids on the membrane protein's function are known since many years. Therefore, the paper by Umebayashi et al. is important. The environment-sensitive dye Nile red (NR) coupled to a membrane protein is an appropriate sensor for monitoring the local membrane fluidity. Linking of Nile red to the receptor via a flexible tether was achieved with the acyl carrier protein (ACP)-tag method. Experiments showed that depending on the ACP site a certain linker length is required to have NR inserted in the membrane and thus be an effective sensor for lipid disorder. This technology could be of general usability to study the environment of membrane proteins in the context of their function. As an example, the technique allowed insulin induced membrane disorder in the close insulin receptor vicinity to be observed. Further, results suggested that tyrosine activity is required for this disorder to happen. The experimental results appear to be complete and controls were made.

      Major comments:

      1) Sometimes technical terms are used without explanation: What is the GP value? What is ACP-IR? The spectrum was measured in number of rois? The reader can find those abbreveations out, but it would be nice to have them defined.

      2) Fig. 1d) is confusing. The ACP-IR labelling is evident in 3 panels, but there is no difference in the color (emission spectra of 1992-ACP-IR vs 2031-ACP-IR should be visible??). The DAPI staining is very different. When doing the latter, how difficult is it to get the staining equal?

      3) How can one interpret Fig. 4: a) Control goes over 4 frames, at 240" insulin is added, and 10 frames should show a fluctuation difference? b) A color shift from blue to green is visible after insulin addition. But it is faint - difficult to assess from the pseudo color scheme. What does 1000 pixel top/1000 pixel bottom mean in c). Is it an attempt to better visualize the fluctuation? It is difficult to recognize a difference before and after adding insulin. d) It seems that the kymograph set should show this. What is the color scale? Why is 3 so untypical, i.e., no change? Box 6 is also peculiar: the left side does not show a strong change upon insulin administration, the right side does. Why?

      4) How is the kymogram calculated? The legend says 'The horizontal dimension represents the averaged ZNCC inside the rectangular area, and the vertical dimension represents time'. The averaged ZNCC is a single value, so it is not clear why the kymogram shows a variation from left to right. May it be the ZNCC was averaged just vertically?

      5) When calculating cross-correlation values on images, they need to be aligned. What fraction of the total image does the selected 19x19 box represent? As described, I imagine that a rolling CC over 19x19 pixels is calculated over an image from the time lapse series comparing it with the reference Iave(x,y). Compared to the 3x3 median filtered CP image, the ZNCC image should then be much more blurred??

      Minor comment:

      On page 16 supplementary is not spelled properly.

      Significance

      The key point of this paper is convincing and the new technology appears to have a lot of potential. It can be applied to study membrane protein function in the context of its environment, the lipid bilayer.

      Membrane fluidity measurements have been developed (e.g., using fluorescent probes like laurdan). However, the trick to link a probe like nile red by ACP technology to the insulin receptor and to observe its activity is quite new.

      A most recent description of such a technology is in TrAC Trends in Analytical Chemistry Volume 133, December 2020, 116092.

      Referees cross-commenting

      All comments are constructive and important. The paper is important but needs to be amended as proposed.

    1. Author Response

      Reviewer #2 (Public Review):

      -Were there any post-translational modifications (phosphorylation etc) or endogenous lipids that need to be quantified to make sense of the data?

      A percentage of receptors could be phosphorylated; therefore, our results represent the average behavior of the population. This is a noteworthy point and we have now explicitly discussed this idea in the revised the manuscript.

      In the in vivo experiments, heterogeneity in PTMs or local lipid environment of receptors could affect conformational change at the individual receptor level. For our analysis we integrate the intensities over the whole cell membrane, so the results represent the average behavior. Likewise, in the single-molecule FRET experiments many individual receptors are included in the analysis. Additionally, since the receptors are purified in the in vitro experiments, there is no further change in PTMs with application of drugs. We have added a sentence in the discussion to highlight the potential heterogeneity in PTMs and local lipid environment. We have also added a sentence to the methods to clarify how in vivo experiments are analyzed.

      Added to line 512 in discussion section: “Potential sources of heterogeneity arising from differences in post-translational modifications or differences in the local lipid environment, may affect receptor conformation. Therefore, our results represent the average of a heterogeneous population of such receptors.”

      Changed line 667 to: “ROIs used for analysis included the whole cell membrane for individual cells.”

      -mGLUR2 is a dimer. I was expecting that at 15 uM of Glutamate, for example, one might see effects of a single protomer-bound receptor. If I'm not mistaken, some class C receptors don't activate their CRDs until both ligand binding sites in the VFT are bound. Looking at all of the profiles in the VFT, CRD, and 7TM, I don't see any evidence of the 2-site binding of glutamate at the VFT. Presumably, there are Hill slopes for all of these profiles?

      Based on our previous work with the wildtype and with the receptor containing one glutamate binding deficient monomer, and available structures, indeed CRD domains do not significantly visit the active state unless both VFT domains are bound to glutamate and in the closed conformation. However, because activations involve progression through 2 intermediate states, we still expect to see FRET change even when both VFT domains are not occupied simultaneously. We have now revised Table 1 to included Hill slope. This data shows that cooperativity is generally observed for the FRET sensors for all the ligands tested.

      Reviewer #3 (Public Review):

      -The main concerns I had were with respect to labelling stoichiometry of the mixed Cy3/Cy5 compounds or SNAP-tag labels. How was this controlled? Clearly, both label cells, as shown in supplemental data and the single molecule FRET data support that both sites are labelled. Are there any concerns about larger molecular complexes such as oligomers that may confound the simple interpretation of interactions between the dimers?

      Among class C GPCRs, only GABA receptors have been shown to be able to potentially form efficient oligomers. Subunit counting experiments have shown that mGluR2 is predominantly dimer (> 90%) on the plasma membrane for the experimental conditions used in this manuscript (Levitz et al., 2016). The same result was obtained from live-cell FRET utilizing a dimer trafficking-control system (Maurel et al., 2008). This work also demonstrated that FRET occurred strictly for dimeric receptors labeled by both donor and acceptor fluorophores and not between neighboring receptors at the plasma membrane. Thus, receptors labeled with donor-only or acceptor-only do not contribute to the relative ΔFRET signal in response to treatment.

      -Some additional context might be a discussion of approaches used and results obtained for other types of conformational biosensors for GPCRs in other classes? Can we learn anything by comparison?

      We have revised the manuscript to include further discussion of results obtained from the use of other conformational sensors.

      Added to line 502: “Recent experiments have shown that GPCRs are dynamic (Nygaard et al., 2013) and undergo transition between multiple conformational states, including multiple intermediate states. For class A GPCRs, studies using conformational biosensors based on nuclear magnetic resonance (NMR) spectroscopy (Huang et al., 2021), double electron-electron resonance (DEER) spectroscopy (Wingler et al., 2019), smFRET (Gregorio et al., 2017), and fluorescent enhancement (Wei et al., 2022) have revealed the importance of conformational dynamics for receptor activation, ligand efficacy, and biased signaling.”

      Added to line 536: “Interestingly, the regulation of intermediate state occupancy has recently been shown to be a mechanism of allosteric modulation for other classes of GPCRs as well. NMR studies on the μ-opioid receptor (Kaneko et al., 2022) and cannabinoid receptor 1 (Wang et al., 2021) revealed that PAMs and NAMs regulate receptor function by acting on intermediate conformations in a manner similar to our findings for BINA and MNI-137. Collectively, these results suggest that designing compounds that regulate intermediate state occupancy is a plausible strategy for the development of allosteric modulators for mGluR2 and other families of GPCRs.”

    2. Reviewer #3 (Public Review):

      The authors used a combination of site-specific labelling at distinct sites within the mGluR2- the VFT domain in the ligand binding site, ECL2 (newly developed here), and the cysteine-rich domain (CRD) the latter of which is located between the VFT and ECL2. Using live cell FRET based on SNAP-tagged or unnatural amino acids, site-labeled with Cy3 or Cy5 tags, they validate that orthosteric ligands generate FRET changes consistent with their know efficacies and potencies, validating them for use in studying the effects of allosteric modulators. They next use single-molecule FRET to study the effects of the allosteric modulators on the receptor in the presence or absence of the orthosteric ligand, glutamate.

      Major strengths include the careful design, conduct, and analysis of the experiments and the validation of the effects of orthosteric ligands alone before proceeding to measurements of allosteric effects. They produce some very interesting results with the allosteric modulators in both experimental formats - the whole cell FRET consistent with known allosteric effects and the single molecule FRET identifying some independent effects of the allosteric modulators - this was quite striking. The approach is scalable to other GPCRs and to other membrane proteins in general.

      The main concerns I had were with respect to labelling stoichiometry of the mixed Cy3/Cy5 compounds or SNAP-tag labels. How was this controlled? Clearly, both label cells, as shown in supplemental data and the single molecule FRET data support that both sites are labelled. Are there any concerns about larger molecular complexes such as oligomers that may confound the simple interpretation of interactions between the dimers?

      Some additional context might be a discussion of approaches used and results obtained for other types of conformational biosensors for GPCRs in other classes? Can we learn anything by comparison?

    1. Reviewer #3 (Public Review):

      In this manuscript Houy and coworkers report new experiments regarding the role of phorbolester-activated Munc13 paralogs, Munc13-1 and ubMunc13-2, on the secretion response of mouse chromaffin cells. They report that expression of either paralog enhanced secretion. Using single knock outs (Figs. 1, 2) or with the expression of either paralog (Figs 3, 4) they found that treatment with the phorbolester PMA was stimulatory when ubMunc13-2 was the predominating paralog, but inhibitory when Munc13-1 dominated. The opposing PMA effects in the presence of either Munc13-1 or ubMunc13-2 were interpreted in the context of a potential competition of both proteins in essential priming reactions (Fig. 5). In simultaneous fluorescence recordings of EGFP tagged Munc13 variants they studied the Ca2+- and PMA-dependent translocation of Munc13 to the plasma membrane (PM). They found that only Munc13-2 (Fig. 3) but not Munc13-1 (Figs. 4, 5) is translocated to the PM in response an intracellular Ca2+-elevation. In this context, they also report that Ca2+ -dependent recruitment of ubMunc13-2 is independent of Synaptotagmin-7 (Fig. 6) and that in the absence of Synaptotagmin-7, ubMunc13-2-dependent secretion is inhibited by PMA (Fig. 7). Based on these results the authors argue that ubMunc13-2, Synaptotagmin-7 and DAG/phorbolester form a stimulatory entity to facilitate dense core vesicle fusion.<br /> Although the manuscript presents interesting observations, some conclusions appear to be compromised by methodological and conceptual concerns.

      Major criticism<br /> 1. In order to track Munc13 translocation the authors have chosen EGFP-tagged variants which overlap in the emission with the standard FuraII/Furaptra emission. Consequently, the authors omitted Ca2+-imaging in these experiments and thereby lost crucial information regarding the development of [Ca]I before and after the uncaging flash. These parameters are of central importance for the Ca2+-dependent priming and exocytosis timing, respectively. This is particularly worrisome, because in several experiments with Munc13 expression hardly any RRP component is apparent in the displayed capacitance traces, which may indicate insufficient Ca2+-dependent vesicle priming (Fig. 4). Under proper calcium control, both Ashery et al 2000 (Fig. 2) and Betz et al 2001 (Fig. 6) reported that Munc13-1 overexpression in wt chromaffin cells causes at least a 300% increase in the size of the EB compared to wt cells. Performing the same experiment, but without calcium imaging, the authors in Fig4-Sup1 show hardly any increase in the size of the EB (violet trace Fig4-Sup1) but a rather strong increase in the sustained phase of exocytosis, a phenotype that could be a result of low intracellular pre-flash calcium levels leading to insufficient vesicle priming. I do not understand why the authors have not chosen any other red-shifted protein tag to prevent such uncertainties. Furthermore, the display of the capacitance traces in several figures does not allow the appreciation of changes in the EB size or its components (e.g. RRP).<br /> 2. The authors speculate about the possibility, that PMA treatment PMA-treatment of Unc13b KO cells may lead to spontaneous release, depleting the cells of secretory vesicles. To test this, they determined the integrated CgA-fluorescence over the entire cell (Fig. 1M, N) rather than analyzing submembrane CgA-fluorescence. With the latter strategy, they will be able to focus on a potential subcellular depletion of release-ready vesicles.<br /> 3. After showing a detailed analysis of the exocytotic burst components and their kinetics in Fig. 1 and 2 the authors argue on page 9 Line 275 'Since the measurements above indicated that the main effect of PMA is on secretion amplitude, not kinetics (see also (Nagy et al., 2006)), we only distinguished between burst secretion (first 1s secretion after Ca2+ uncaging, corresponding approximately to RRP and SRP fusion) and sustained secretion (last 4 s of secretion), as well as total secretion (the sum of burst and sustained release). '<br /> I have some concerns with this argumentation because the expression of Munc13 paralogs apparently leads to changes in the burst components and/or it kinetics (e.g. Fig. 4B compare to Fig. 1 or 2). In fact, these differences cannot be directly appreciated, because experiments like in Fig. 3 and 4 lack the littermate wt control without and with PMA.<br /> Moreover, Munc13 expression leads to a disproportionate increase in the sustained phase of release, which is not present with PMA.<br /> I would recommend at least to include detailed analyses of the exocytotic burst components and their kinetics to address these uncertainties.

      4. As central hypothesis, the authors propose that they have identified a unique stimulatory triad of ubMunc13-2, Syt7 and DAG/phorbolesters, which is needed for dense core vesicle priming and fusion. For example, in contrast to the behavior of wt cells (e.g. Fig 1A) phorbolester treatment becomes inhibitory in cells lacking Syt7 and expressing ubMunc13-2 (Fig. 7). Nonetheless, previously published data by Sorensen's group, obtained under similar preflash [Ca]I conditions (Tawfik et al., 2021; Fig 6-figure supplement 2 E-H), clearly show that PMA strongly potentiates exocytosis even in the absence of Syt7. Therefore, these previous findings by Tawfik et al. clearly counter the central hypothesis of the manuscript. The authors should clarify these disparate results.

    1. Author Response:

      Reviewer #1 (Public Review):

      The manuscript by Kanca et al. presents a variety of valuable resources for the use of the Drosophila research community. As an update to the ongoing work of the Drosophila Gene Disruption Project, it includes hundreds of new transgenic fly lines each of which simultaneously knocks out a targeted gene and generates a driver that expresses the Gal4 transcription factor specifically in the pattern of that gene. The "KozakGal4" approach described supplements previous approaches of the GDP, including the powerful "CRIMIC" method, which inserts a synthetic exon containing a T2AGal4 module into an intron of the targeted gene. In the KozakGal4 method, the coding sequence of the native gene is completely replaced by Gal4, which the authors point out will allow them to target genes lacking (suitable) introns. In the KozakGal4 method, gene replacement is accomplished by targeted excision of the native gene using CRISPR-based technology and subsequent incorporation of a Gal4-encoding cassette by homologous recombination. The vectors developed by the authors to effect gene replacement are elegantly optimized to include all components necessary for native gene excision and efficient recombination of Gal4. These components include the guide RNAS (sgRNAs) that cleave flanking regions of the native gene, an sgRNA that liberates the Gal4 cassette from the vector, and short synthetic homology arms that provide effective, site-specific recombination. Importantly, the vectors are designed so that all gene-specific components can be synthesized in a single fragment that can be readily incorporated into the vector backbone followed by insertion of the Gal4 cassette.

      Overall, the technical advances described in the manuscript are impressive and the utility of the method is well demonstrated. The one exception is in the validation of Gal4 expression fidelity. As the authors note, fidelity could be compromised if regulatory information is removed along with sequences in and around a targeted gene. In addition, the introduction of new DNA at a particular locus may alter the regulation of gene expression. In any case, establishing the fidelity of expression of KozakGal4 lines is important and the data presented on this point is both confusing and incomplete. Rather than directly comparing the expression of selected KozakGal4 lines against the expression of the endogenous gene (e.g. by immunostaining, in situ hybridization, or by comparing tissue-specific reporter expression against expression in microarray-derived datasets such as Fly Atlas or modEncode), the authors use two indirect methods to demonstrate fidelity. One method uses VNC scRNAseq data together with the expression patterns of T2AGal4 lines that target genes co-expressed (at least in certain cell types) with the KozakGal4 line, while the other method uses phenotypic rescue by driving UAS-cDNA transgenes. The demonstrations are at best suggestive, and the rescue results presented are minimal, with no description of phenotypes, methods used to assay them, or quantification of rescue. There is thus insufficient information to form a judgment about fidelity and a more direct demonstration is needed.

      We appreciate that the manuscript can be strengthened by adding supporting evidence about the fidelity of GAL4 expression to the expression pattern of the targeted gene. The direct comparison of the GAL4 expression pattern to the expression pattern of the gene is a complex issue. The seemingly straightforward experiments of comparing the GAL4‐UAS reporter fluorescent protein expression pattern to the antibody staining of the targeted gene product suffers from multiple technical and practical issues: 1) Majority of the genes that we targeted are understudied and do not have a readily available antibody that would work for immunostaining. 2)Even if the antibodies were available, and even if the antibodies were completely specific, the staining pattern would likely be different from the GAL4‐UAS reporter expression pattern due to the subcellular localization of the gene product differing from the subcellular localization of the reporter. 3) GAL4‐UAS system introduces very high level of amplification of the signal compared to the expression of the gene product. We have reported the extent of this difference in the Lee et al. 2018 eLife paper where we used RMCE to convert the same MiMIC lines to EGFP protein trap alleles or T2AGAL4 gene trap alleles. The signals that we could detect in larval or adult brains looked qualitatively different. Comparing the expression pattern of the targeted genes product to the KozakGAL4‐UAS reporter gene signal would suffer from the same issue.<br /> To overcome these issues, we decided to compare GAL4 mRNA expression pattern of KozakGAL4 alleles to the mRNA expression pattern of the targeted gene. We employed smiFISH (single molecule Fluorescent In‐Situ Hybridization) in 3rd instar larval brains for 8 genes. We crossed the KozakGAL4 alleles of these genes to yw flies and performed co‐staining of GAL4 mRNA and targeted genes mRNA. In 7 cases where we could detect the mRNA expression of the gene product reliably, GAL4 mRNA expression pattern was overlapping with the mRNA expression pattern of the targeted gene, suggesting the transcriptional regulation of KozakGAL4 in the locus reflects the transcriptional regulation of the targeted gene. We note that the signal to noise level is quite low for some of the in situ hybridization results. Hence, we attenuated the language about the expression patterns of KozakGAL4 alleles reflecting the expression domain of the targeted genes by adding that there is a caveat that the regulatory elements in the coding regions and UTRs would be removed in these alleles. We include the smiFISH results as a supplementary figure and we add a paragraph describing methodology to the text.

      The manuscript could be strengthened in a couple of other spots as well. There is little to no description in either the Introduction or Results/Discussion of similar knock-out/knock-in approaches, although gene-specific knock-ins of Gal4 have been generated in Drosophila using homologous recombination for some time-typically into the site of ATG start codons. CRISPR technology has only facilitated this approach, which has also been used to create gene-specific cre knock-ins in rodents. This is of potential interest since the authors mention that their approach can be generalized for use in other animals. A short overview of existing knock-in approaches and their limitations relative to KozakGal4 would therefore be useful. Also, the authors motivate the need for the KozakGal4 method by asserting that over 50% of Drosophila genes lack "suitable" coding introns for the integration of artificial T2AGal4 exons such as CRIMIC. This seems to unnecessarily overstate the actual need. The authors define a "suitable" gene as one that has an intron common to all its isoforms that is at least 100 nt long. The length requirement is justified based on the need for suitable sgRNA targets within the intron, but it's possible to use sgRNA targets outside the intron (as long as the homology domains replace this sequence). Also, the requirement of a sufficiently long intron common to all isoforms is quite stringent and could be relaxed if multiple T2AGal4 lines were made to target multiple isoforms. Presumably, multiple KozakGal4 lines will, in fact, also be required for genes that have multiple transcription start sites, if the expression patterns of all isoforms are to be reproduced. In general, there's no doubt about the utility of the KozakGal4 approach, but a more balanced presentation of its merits relative to other approaches seems warranted.

      We agree with the reviewers that the presence of 100 nt long coding intron in all annotated isoforms is a relatively stringent criterion for deeming a gene to be a suitable target for T2AGAL4 methods. This requirement can indeed be relaxed if the same gene is targeted with multiple T2AGAL4 alleles. Nevertheless, for the GDP project, our aim is to generate genetic reagents for as many conserved genes as possible to make them accessible to the research community. Multiple T2AGAL4 that target individual splice isoforms can be done by the laboratories that work on those genes, using the methodology that we describe in this paper. We attenuate the language about the intron length requirements and included our justification for this requirement for the GDP project in the text.

      Reviewer #2 (Public Review):

      In this interesting paper, Kanca and coworkers present a set of updated constructs for the replacement of gene coding regions for instance by a Gal4 expression cassette or a GFP protein trap allele, enabling multiple research applications with the generated fly strains. The novel design now allows for the CRISPR-based targeting of almost any gene in Drosophila. The authors apply these novel tools and generate hundreds of fly lines that complement the pool of already existing strains in the Drosophila Gene Disruption Project. The authors report a high success rate for their HDR-mediated gene targeting strategy and show that they can even target genes that previously proved to be difficult to engineer. The authors validate the expression patterns of a set of lines - supported even by single-cell sequencing experiments - and provide strong evidence that the updated toolkit functions as expected.

      What may confuse the reader is that there are different targeting strategies that are presented with a strong focus on the validation of the expression cassettes used in combination with a specific targeting strategy (i.e., KozakGal4 or GFP protein trap). This leaves the reader with the impression that the insertion of a particular expression cassette would require a tailored targeting strategy, which is not the case. In fact, the majority of the paper deals with the description and extensive validation of small updates on already published methods for the insertion for the generation of additional KO/Gal4 or eGFP trap lines. However, neither the updated knock-in/knock-out strategies described for the insertion of the KOZAKGal4 cassette at the beginning of the results section nor the experiments to GFP tag proteins at different positions in the open reading frames (Figure 5) are of sufficient novelty and technical advancement.

      What really warrants publication is the very elegant and universal method described in Figure 4 that requires only a single vector to be injected into fly embryos. The method is suited to precisely engineer any gene at will in combination with any HDR template. The very smart vector design allows for the directed insertion of custom and commercially synthesized HDR constructs as well as of a specific guide required to target and cut the gene of interest. This makes the method versatile, fast and cheaper with the benefit of being very efficient. This gRNA_int200 targeting strategy will be of broad interest, is straightforward to use and is expected to have a large impact - far beyond the fly community.

      We thank the reviewer for the constructive criticism and for seeing the benefits in our methodology. Although the KozakGAL4 and GFP knock‐ins in the genome are not conceptually new, the combination of our vector design makes the application of these concepts straightforward. Additionally, the extent of application and verification of GAL4 knock‐ins was limited compared to what we include in this manuscript which prompted us to include the KozakGAL4 and GFP knock‐in methodology in this manuscript.

    2. Reviewer #2 (Public Review):

      In this interesting paper, Kanca and coworkers present a set of updated constructs for the replacement of gene coding regions for instance by a Gal4 expression cassette or a GFP protein trap allele, enabling multiple research applications with the generated fly strains. The novel design now allows for the CRISPR-based targeting of almost any gene in Drosophila. The authors apply these novel tools and generate hundreds of fly lines that complement the pool of already existing strains in the Drosophila Gene Disruption Project. The authors report a high success rate for their HDR-mediated gene targeting strategy and show that they can even target genes that previously proved to be difficult to engineer. The authors validate the expression patterns of a set of lines - supported even by single-cell sequencing experiments - and provide strong evidence that the updated toolkit functions as expected.

      What may confuse the reader is that there are different targeting strategies that are presented with a strong focus on the validation of the expression cassettes used in combination with a specific targeting strategy (i.e., KozakGal4 or GFP protein trap). This leaves the reader with the impression that the insertion of a particular expression cassette would require a tailored targeting strategy, which is not the case.<br /> In fact, the majority of the paper deals with the description and extensive validation of small updates on already published methods for the insertion for the generation of additional KO/Gal4 or eGFP trap lines. However, neither the updated knock-in/knock-out strategies described for the insertion of the KOZAKGal4 cassette at the beginning of the results section nor the experiments to GFP tag proteins at different positions in the open reading frames (Figure 5) are of sufficient novelty and technical advancement.

      What really warrants publication is the very elegant and universal method described in Figure 4 that requires only a single vector to be injected into fly embryos. The method is suited to precisely engineer any gene at will in combination with any HDR template. The very smart vector design allows for the directed insertion of custom and commercially synthesized HDR constructs as well as of a specific guide required to target and cut the gene of interest. This makes the method versatile, fast and cheaper with the benefit of being very efficient. This gRNA_int200 targeting strategy will be of broad interest, is straightforward to use and is expected to have a large impact - far beyond the fly community.

    1. The meta description is a snippet of up to about 155 characters – a tag in HTML – which summarizes a page’s content.

      What is meta description? The meta description is a snippet of up to about 155 characters – a tag in HTML – which summarizes a page’s content.

    1. n the IndieWeb we’ve talked a bunch about following people rather than feeds, and wanting to be able to see that in one place rather than going to each service.

      I don't love this, of course, even as I've taped on every Indieweb accoutrement to my own site. It's so prescriptive -- like the converse of the idea that one should slice up one's own posts into neat tag-based filtered feeds for the convenience of The Consumer. Maybe I like that there's some friction in getting from my hypertexting to my more social nattering. To say it must be otherwise feels... real-name-policy-esque.

    1. Reviewer #2 (Public Review):

      Motile cilia generate rhythmic beating or rotational motion to drive cells or produce extracellular fluid flow. Cilia is made of nine microtubule doublets forming a spoke-like structure and it is known that dynein motor proteins, which connects adjacent microtubule doublet, are the driving force of ciliary motion. However the molecular mechanism to generate motion is still unclear. The authors proved that a pair of microtubules stably linked by DNA-origami and driven by outer dynein arms (ODA) causes beating motion. They employed in vitro motility assay and negative stain TEM to characterize this complex. They demonstrated stable linking of microtubules and ODAs anchored on the both microtubules are essential for oscillatory motion and bending of the microtubules.

      Strength<br /> This is an interesting work, addressing an important question in the motile cilia community: what is the minimum system to generate a beating motion? It is an established fact that dynein power stroke on the microtubule doublet is the driving force of the beating motion. It was also known that the radial spoke and the central pair are essential for ciliary motion under the physiological condition, but cilia without radial spokes and the central pair can beat under some special conditions (Yagi and Kamiya, 2000). Therefore in the mechanistic point of view, they are not prerequisite. It is generally thought that fixed connection between adjacent microtubules by nexin converts sliding motion of dyneins to bending, but it was never experimentally investigated. Here the authors successfully enabled a simple system of nexin-like inter-microtubule linkage using DNA origami technique to generate oscillatory and beating motions. This enables an interesting system where ODAs form groups, anchored on two microtubules, orienting oppositely and therefore cause tag-of-war type force generation. The authors demonstrated this system under constraints by DNA origami generates oscillatory and beating motions.<br /> The authors carefully coordinated the experiments to demonstrate oscillations using optical tweezers and sophisticated data analysis (Fourier analysis and a step-finding algorithm). They also proved, using negative stain EM, that this system contains two groups of ODAs forming arrays with opposite polarity on the parallel microtubules.<br /> The manuscript is carefully organized with impressive movies. Geometrical and motility analyses of individual ODAs used for statistics are provided in the supplementary source files. They appropriately cited similar past works from Kamiya and Shingyoji groups (they employed systems closer to the physiological axoneme to reproduce beating) and clarify the differences from this study.

      Weakness<br /> The authors claim this system mimics two pairs of doublets at the opposite sites from 9+2 cilia structure by having two groups of ODAs between two microtubules facing opposite directions within the pair. It is not exactly the case. In the real axoneme, ODA makes continuous array along the entire length of doublets, which means at any point there are ODAs facing opposite directions. In their system, opposite ODAs cannot exist at the same point (therefore the scheme of Dynein-MT complex of Fig.1B is slightly misleading). If they want to project their result to the ciliary beating model, more insight/explanation would be necessary. For example, arrays of dyneins at certain positions within the long array along one doublet are activated and generate force, while dyneins at different positions are activated on another doublet at the opposite site of the axoneme. This makes the distribution of dyneins and their orientations similar to the system described in this work. Such a localized activation, shown in physiological cilia by Ishikawa and Nicastro groups, may require other regulatory proteins.<br /> They attempted to reveal conformational change of ODAs induced by power stroke using negative stain EM images, which is less convincing compared to the past cryo-ET works (Ishikawa, Nicastro, Pigino groups) and negative stain EM of sea urchin outer dyneins (Hirose group), where the tail and head parts were clearly defined from the 3D map or 2D averages of two-dynein ODAs. Probably three heavy chains and associated proteins hinder detailed visualization of the tail structure. Because of this, Fig.2C is not clear enough to prove conformational change of ODA. This reviewer imagines refined subaverage (probably with larger datasets) is necessary. It is not clear, from the inset of Fig.2 supplement3, how to define the end of the tail for the length measurement, which is the basis for the authors to claim conformational change (Line263-265). The appearance of the tail would be altered, seen from even slightly different view angles. Comparison with 2D projection from apo- and nucleotide-bound 3-headed ODA structures from EM databank will help.

      In Fig.5B (where the oscillation occurs), the microtubule was once driven >150nm unidirectionally and went back to the original position, before oscillation starts. Is it always the case that relatively long unidirectional motion and return precede oscillation? In Fig.7B, where the authors claim no oscillation happened, only one unidirectional motion was shown. Did oscillation not happen after MT returned to the original position?

      Line284-290: More characterization of bending motion will be necessary (and should be possible). How high frequency is it? Do they confirm that other systems (either without DNA-origami or without ODAs arraying oppositely) cannot generate repetitive beating?

    1. Author Response

      Reviewer #1 (Public Review):

      The authors attempt to optimize the FluoroSpot assay to allow for the assessment of cross-reactive antibodies targeting conserved epitopes shared by multi-allelic antigens and those specific to unique antigen variant at the B cells level. This is a critical aspect to consider when identifying targets of a broad range of cross-reactive antibody for vaccine development and the antigen VAR2CSA used in this work is one that will benefit from the method described in the manuscript.

      Overall, this is a method manuscript with extensive detail of the assay validation process. The description of the assay performance steps using, first monoclonal antibodies and later hybridoma/immortalized B cells was important to understand conditions that can influence the antigen-antibody interactions in the assay. This multiplex approach can assess the cross-reactivity of antibody to up four allelic variants of an antigen with the possibility to explore the affinity of antibody to a particular variant using the RSV measurements. The validation of the assay with PBMC from malaria exposed donors both men and women (that naturally acquired high titer of antibodies to VAR2CSA during pregnancy) is a strength of this work as this is in the context of polyclonal antibodies with more heterogenous antibody binding specificities.

      The ability of the assay to detect cross-reactive antibodies using all four tags appear highly variable even in the context of monoclonal antibody targeting the homologous antigen labelled with all 4 tags.

      We understand the concern for variability, but we think that in general the assay was very consistent. Regardless of the configuration used, we detected strikingly comparable number of spots/well, especially when the homologous antigen labelled with four tags was used (Figure 2A). Similar consistency has been previously reported when a similar assay was used to study cross-reactivity in dengue-specific antibodies.

      Overall, it appears that the assessed antibody reactivity with TWIN tagged antigens was relatively low and this needs to be explained and discussed as the current multiplex method, as it is, might just be optimized for study of cross-reactive antibodies to 3 antigens.

      The LED380 (used to detect and visualize the TWIN tag) indeed gave more background than the other three detection channels. We normally observed a ring of fluorescence at the edge and the middle of the wells, accompanied by lower intensity of the spots. These two characteristics are apparent in the figures and RSV plots presented in the manuscript. In an attempt to reduce these issues, we attempted to substitute the TWIN tag for a BAM tag detected with a peptide-specific antibody (data not presented). However, that approach did not improve the readout and we therefore decided to keep the TWIN-StrepTactin pair for all the experiments. Importantly, even with these issues, routine manual inspection of the wells confirmed the Apex software automatically and efficiently counted “real” spots giving us confidence on the performance of the assay. We acknowledge that exclusion of the LED380 data would lead to higher assay accuracy. However, it would result in reduced ability to assess broad antibody cross-reactivity, which was the primary objective of our study. We have added text briefly discussing this to the revised manuscript (lines 154-160).

      As acknowledged by the authors, the validation of this assay on PBMC from only 10 donors (7 women and 3 men) is a caveat to the conclusion and increasing this number of donors (the authors have previously excelled in B cells analyses of PfEMP1 proteins and would have PBMC readily available) will strengthen the validity of this assay.

      We thank the reviewer for this comment and agree the number of donors tested is far from sufficient to provide any conclusive evidence regarding frequencies of VAR2CSA-specific and cross-reactive B cells in the context of placental malaria. However, we firmly believe that the validation of the assay – which was the objective of the study – is sufficient, especially because we included human B-cell lines isolated from donors naturally exposed to VAR2CSA-expressing parasites. Futures studies including more donors and full-length VAR2CSA antigens are certainly warranted. As the performance of assay has now been validated (this manuscript) to our satisfaction, we are indeed planning such studies.

      Reviewer #2 (Public Review):

      The manuscript describes the development of a laboratory-based assay as a tool designed to identify individuals who have developed broadly cross-reactive antibodies with specificity for regions that are common to multiple variants of a given protein (VAR2CSA) of Plasmodium falciparum, the parasite that causes malaria. The assay has potential application in other diseases for which the question ofacquisition of antibody-mediated immunity, either through natural exposure or through vaccination, remains unresolved.

      From a purely technical/methodological viewpoint, the work described is of high quality, relying primarily on the availability of custom-designed, in-house-derived protein and antibody reagents that had, for the most part, been validated through use in earlier studies. The authors demonstrate a high degree of rigour in the assay development steps, culminating in a convincing demonstration of the ability to accurately and reproducibly quantify cross-reactive antibody types under controlled conditions using well-characterized monoclonal antibodies.

      In a final step, the authors used the assay to assess the content of broadly cross-reactive antibodies in samples from a small number of malaria-exposed African men and women. Given that VAR2CSA is a parasite-derived protein that is exclusively and intimately involved in the manifestation of malaria during pregnancy, with specific localisation to the maternal placental space, the premise is that antibodies -including those with cross-reactive specificities - should be almost exclusively detectable in samples from women, either pregnant at the time of sampling or having been pregnant at least once. The assay functioned technically as expected, identifying antibodies predominantly in women rather than men, but it failed to identify broadly cross-reactive antibodies in the women's samples used, only revealing antibodies with specificity for just one of the different variants used. The latter result could have two mutually non-exclusive explanations. On the one hand, the small number of women's samples (7) screened in the assay could simply be insufficient, demanding the use of a much larger panel. On the other hand, for technical reasons the assay involves the use of only relatively restricted parts of the VAR2CSA protein, and this particular aspect may represent its primary limitation. In earlier work, the authors did identify broadly cross-reactive antibodies in samples from African women, but that work relied on the use of the whole VAR2CSA protein present in its natural state embedded in the membrane of the infected red cell, or as a complete protein produced in the laboratory. The important point being that the whole protein likely interacts with antibodies that recognize protein structures that the isolated smaller parts of the whole protein used in the assay fail to reproduce, and that the cross-reactive antibodies identified recognize these structures that are conserved across different VAR2CSAvariants. The authors recognize these potential weaknesses in their discussion of the results. It is also possible that VAR2CSA variants expressed by parasites from geographically-distinct regions (Africa, Asia, South America) are themselves distinct, and this aspect could also have affected the outcome, since the variant protein sequences used in the assay were derived from parasites originating in these different regions.

      The assay could find application in the malaria research field in the specific context of assessments of antibody responses to a range of different parasite proteins that are, or have been, considered candidates for vaccine development but for which their extensive inherent allelic polymorphism has effectively negated such efforts.

      We thank the reviewer for the kind evaluation. We fully acknowledge the need for more comprehensive studies to assess the robustness of the pilot data regarding antibody cross-reactivity after natural exposure in the present study, which was aimed to document the performance of the complicated multiplexed assay rather than to provide such evidence. As mentioned above, we are currently planning such a study. We also acknowledge the need to assess the degree of cross-reactivity to full-length antigens rather than domain-specific components of them. This is obviously particularly true for large, multi-domain antigens such as PfEMP1 (including VAR2CSA). Such an exercise is complicated by the need for appropriately tagged antigens. We are intrigued by the apparent discrepancy between the degree of antibody cross-reactivity in depletion experiments using individual DBL domains of VAR2CSA (low cross-reactivity) versus full-length VAR2CSA antigens (very substantial cross-reactivity) reported by Doritchamou et al., and are keen to apply our approach to explore that finding. Therefore, as also mentioned above, we are currently planning a study employing tagged full-length VAR2CSA allelic variants as well.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We thank the reviewers for their constructive comments and are pleased that all reviewers share our opinion, that the present study “makes an important contribution to the molecular architecture of mitochondria”, is in addition “an important advancement in our understanding of the mechanism by which Cqd1 regulates CoQ distribution” and will “thereby appealing to the broad readership of the journals”. We are convinced that addressing the important points raised by the reviewers will further strengthen the manuscript and result in additional significant insights in the molecular function of Cqd1.

      Reviewer #1:

      The major concerns affecting the conclusions are: 1) Experimental evidence is lacking on the contribution of contact site formation by Cqd1 to the effects on mitochondrial architecture and respiration-dependent growth. Determining the effects of the overexpression of the kinase-dead mutant on mitochondrial morphology and contact site formation with Por1-Om14 can address that.

      We thank reviewer #1 for raising these important points. Indeed, the various functions of Cqd1 might be independent from each other and so far we cannot distinguish between them. As suggested by the reviewer we will analyze the effect of overexpression of CQD1 in the Dups1 deletion mutant and make use of the point mutant in the conserved ATP binding domain which cannot complement the phenotype of the Dups1 Dcqd1 double deletion mutant. We generated a yeast mutant strain expressing Om14-3xHA in the absence of wild type Cqd1. Expression of the cqd1(E330A) mutant in the Om14-3xHA background and subsequent immunoprecipitation will allow us to test whether ATP binding is also essential for contact site formation. Preliminary experiments showed that the overexpression of cqd1(E330A) in the Dcqd1 deletion background results in a growth defect comparable to that caused by overexpression of CQD1 WT. Therefore, we think it might be more promising to analyze the interaction of Om14 and Cqd1 E330A at wild type level in order to avoid pleiotropic effects.

      In addition, we will further characterize the cqd1(E330A) mutant by analyzing the effect of its overexpression on mitochondrial morphology, cell growth and assembly of MICOS and F1FO ATP synthase in the Dcqd1 deletion background.

      2) Related to point #1, Cqd1 overexpression in deltaUsp1 cells could have addressed whether the role of Cqd1 in contact sites and mitochondrial architecture is independent of its role on CoQ distribution and phospholipid metabolism. Further characterization of the kinase-dead Cqd1 mutant on CoQ distribution, contact sites, mitochondrial archictecture and phsophsolipid metabolism might help discerning how these activities can be separated.

      We agree that the related points 1) and 2) raised by reviewer #1 are important and addressed our plans in the response on point 1).

      3) It is unclear how both Cqd1 overexpression and deletion induce mitochondrial fragmentation. Performing live cell imaging with a mitochondrial-phoactivatable GFP to measure mitochondrial fusion rates could help discerning the causes for fragmentation. It is a possibility that overexpression induced fragmentation by activating fission without changing fusion, while deletion induced fragmentation by blocking fusion.

      We thank reviewer #1 for bringing up this point. Perhaps our explanation in this respect was too short. Fig. 4E shows that deletion of CQD1 does not result in altered mitochondrial morphology, however, deletion of CQD1 in the Dups1 background leads to virtual complete fragmentation of the mitochondrial network. This is likely due to inhibition of mitochondrial fusion through disturbed processing of the fusion protein Mgm1 (see Fig. 4D). In contrast, overexpression of CQD1 does NOT result in formation of small mitochondrial fragments, but in formation of huge mitochondrial clusters which in addition contain a large proportion of ER membranes. So, we don’t think that this phenotype is related to either enhanced fission or reduced fusion. We will clarify this point in text of the revised manuscript.

      Minor comment:

      1) Figure 4 claims that mitochondrial function is impaired by ups1 deletion, which Cqd1 deletion exacerbates. However, no respiration data is shown in figure 1, only measurements of mitochondrial architecture are shown. Thus, oxygen consumption measurements are needed to claim effects on mitochondrial function.

      We did not want to claim that mitochondria lose respiratory competence upon simultaneous deletion of CQD1 and UPS1. Actually, our results indicate that the Dups1 Dcqd1 double deletion mutant grows like wild type on complete medium containing glycerol. Therefore, respiration is not impaired in this mutant. However, mitochondrial function is not restricted to ATP production by oxidative phosphorylation. The reviewer probably refers to Figure 4 where we show that mitochondrial biogenesis and dynamics are impaired in the Dups1 Dcqd1 double deletion mutant – the heading of the legend summarizes this as "mitochondrial function". We will be more precise in the revised version on this point and add a panel showing growth of the mutant strain on non-fermentable carbon source to avoid any further confusion.

      2) Some Western blots lack quantifications and statistical analyses of independent experiments.

      It is correct that some quantification and the respective statistics were missing in the initially submitted manuscript. We will add the requested information in the revised version of the manuscript.

      Reviewer #2:

      I have the following concerns for the authors to consider. (1) Although biochemical evidence shows that Cqd1 is likely a factor that forms CS structures in mitochondria, it would make the manuscript stronger if the authors can observe uneven distribution of Cqd1 in the mitochondrial membranes (assessed by fluorescent microscopy or ideally high-resolution microscopy) and the presence of Cqd1 in the region of close apposition of the OM and IM by immunogold labeling for electron microscopy.

      Two independent lines of evidence show that Cqd1 is a novel contact site protein: (i) it is found in the contact site fraction in density gradients (Fig. 6A), and (ii) it can be co-immunoprecipitated with outer membrane proteins (Fig. 6G, H, I). Furthermore, the co-IP is supported by cross-links of expected size (Fig. 6F). In sum, we feel that this is solid evidence to support our claim that Cqd1 is present in mitochondrial contact sites. However, it still might be interesting to check an uneven distribution of Cqd1 in mitochondria, as suggested by the reviewer. We will do this by 3D deconvolution fluorescence microscopy.

      (2) Since the structural characterization of Cqd1 is important to understand its interactions with the OM proteins and other UbiB protein kinase-like family proteins, Coq8 and Cqd2, take different orientations, the membrane topology of Cqd1 should be experimentally analyzed. The authors state, "two hydrophobic stretches can be identified in the Cqd1 sequence, of which the first one (amino acids 125-142) might be a bona fide transmembrane segment" (lines 97-100); then is Cqd1 a single membrane spanning protein or two-membrane spanning protein?  

      Unfortunately, it was not possible to test the location of the N terminus experimentally because an N-terminally tagged variant of Cqd1 (tag inserted between presequence and mature part) turned out to be unstable. We consider it very unlikely that the second hydrophobic stretch is a transmembrane domain as it is rather short (only 11 amino acids). Furthermore, several Cqd1 homologs in other fungi, including Yarrowia lipolytica, Aspergillus niger and Schizosaccharomyces pombe, are lacking the second hydrophobic stretch. Therefore, we propose that the major part of Cqd1 including the protein kinase-like domain is exposed to the intermembrane space. We will point out this more clearly in the revised manuscript.

      (3) The authors state, "conserved GxxxG dimerization motif (amino acids 504‐508)" (Fig. 1A caption), but this description needs a reference. The GxxxG motif was proposed to mediate transmembrane helix-helix association (https://doi.org/10.1006/jmbi.1999.3489), which is not consistent with the membrane topology proposed by the authors.

      We thank reviewer #2 for this comment. It is correct that GxxxG motifs are usually present in transmembrane a-helices. However, there is information available indicating that these motifs may also be present in soluble proteins and are stabilizing dimeric interactions for instance in the homodimeric Holliday-junction protein resolvase (Kleiger et al., 2002; doi: 10.1021/bi0200763.). However, as this point is not critical for our conclusions we will remove the discussion of the GxxxG motif from the revised manuscript.

      (4) What is the role of the kinase activity of Cqd1 in the CS formation? The effects of overexpression of Cqd1 (Fig. 7) should be tested for its E330A mutant.

      We also thank reviewer #2 for raising this important point similar to reviewer #1. Please see our response to point 1) of reviewer #1.

      (5) Is there stoichiometric as well as quantitative information on the 400 kD complex consisting of Cqd1, Por1 and Om14? Does the stoichiometry and amount of the complex depend on the growth condition? Does the complex contain other Por1 interacting IM proteins like Mdm31?

      We appreciate that reviewer #2 points out this important aspect. It might well be that the amount of the Cqd1 containing complex depends on growth conditions since its presence might be important for phospholipid homeostasis, CoQ distribution and mitochondrial architecture and morphology which for sure strongly depend on growth conditions. Therefore, we will try to analyze the amount of the Cqd1 complex present in mitochondria isolated from yeast cells grown on different media by BN-PAGE. So far we do not have any information on the stoichiometry of this complex and we feel that an analysis would go beyond the scope of this study. We agree with reviewer #2 that Mdm31 is an obvious candidate for an interaction partner of Cqd1. We actually tested this by co-immunoprecipitation using Cqd1-3xHA or Mdm31-3xHA. However, none of these approaches resulted in successful co-isolation of the potential interaction partner. We will mention this result in the revised manuscript.

      (6) For Fig. 7E, the authors state, "consistently, we observed dramatically increased mitochondria‐ER interactions Cqd1 overexpression", but this observation could be due to secondary effects because overexpression of Cqd1 itself already caused abnormal morphology of mitochondria.

      We thank reviewer #2 for bringing up this important point. To check whether the increased mitochondria‐ER interactions are a secondary effect due to altered mitochondrial morphology we will analyze the mitochondria‐ER interactions in other mitochondrial morphology mutants by fluorescence microscopy. This will reveal whether abnormal mitochondrial morphology generally leads to disturbed ER structure.

      (7) Since the antagonistic role of Cqd2 to Cqd1 was proposed, the results of the experiments for Cqd1 can be compared with those for Cqd2. For example, what will become of overexpression of Cqd2 instead of Cqd1 for Fig. 7? What is the lipid composition of the cqd1Dcqd2D double deletion mutant cells (the decreased PA level is recovered?)? Lines 424-425: In summary, overexpression of Cqd1 causes severe phenotypes on growth, formation of mitochondrial structural elements, and mitochondrial architecture and morphology. Is this phenotype affected by overexpression of Cqd2?

      This point raised by reviewer #2 is very interesting. Our preliminary experiments and previously published data (Tan et al., 2013) indicate that overexpression of Cqd2 is also toxic and results in the formation of huge mitochondrial clusters. Therefore, we will extend our study and analyze the effect of overexpression of CQD2, either alone or in combination with overexpression of CQD1.

      Reviewer #3:

      1) The central point of the paper is that Cqd1 is part of a novel contact site between the inner and the outer membrane. Om14 and Por1 were identified as outer membrane components of this contact site by immunoprecipitation. The data look convincing but they were generated from targeted experiments to test the involvement of suspected proteins. Ideally, one would like to see a cross-linking mass spectrometry (XL-MS) experiment that identifies the physical interactions of Cqd1 without bias.

      We thank reviewer #3 for acknowledging the presented data as convincing. Considering the significant amount of experiments planned for the revised version of the manuscript, we hope that reviewer #3 agrees that this point is not essential.

      2) Could an analogous blot of the MICOS complex be added to Figure 6D?

      Of course, we are happy to include BN-PAGE analysis showing the running behavior of MICOS next to the Cqd1 containing complex in Fig. 6D.

      3) In the Introduction, a host of contact sites is mentioned, which are partly from older papers. I'm not sure whether this is the accepted view of the field. Also, newer data suggest that the permeability transition pore is derived from complex V rather than ANT, CK, and VDAC. The authors should double check in order to represent the current state of the art

      We thank reviewer #3 for this comment. We will update this part according to the more recent literature.

    1. 将第一原理这个概念带火的是埃隆∙马斯克——一个改变游戏规则,不断颠覆传统的创业者

      第一原理是马斯克的标签tag,就像多元思维模型是查理芒格的一样!

    Tags

    Annotators

    1. The addressing system that many digital note taking systems offer is reminiscent of Luhmann's paper system where it served a particular use. Many might ask themselves if they really need this functionality in digital contexts where text search and other affordances can be more directly useful.

      Frequently missed by many, perhaps because they're befuddled by the complex branching numbering system which gets more publicity, Luhmann's paper-based system had a highly useful and simple subject heading index (see: https://niklas-luhmann-archiv.de/bestand/zettelkasten/zettel/ZK_2_SW1_001_V, for example) which can be replicated using either #tags or [[wikilinks]] within tools like Obsidian. Of course having an index doesn't preclude the incredible usefulness of directly linking one idea to potentially multiple others in some branching tree-like or network structure.

      Note that one highly valuable feature of Luhmann's paper version was that the totality of cards were linked to a minimum of at least one other card by the default that they were placed into the file itself. Those putting notes into Obsidian often place them into their system as singlet, un-linked notes as a default, and this can lead to problems down the road. However this can be mitigated by utilizing topical or subject headings on individual cards which allows for searching on a heading and then cross-linking individual ideas as appropriate.

      As an example, because two cards may be tagged with "archaeology" doesn't necessarily mean they're closely related as ideas. This tends to decrease in likelihood if one is an archaeologist and a large proportion of cards might contain that tag, but will simultaneously create more value over time as generic tags increase in number but the specific ideas cross link in small numbers. Similarly as one delves more deeply into archaeology, one will also come up with more granular and useful sub-tags (like Zooarcheology, Paleobotany, Archeopedology, Forensic Archeology, Archeoastronomy, Geoarcheology, etc.) as their knowledge in sub areas increases.

      Concretely, one might expect that the subject heading "sociology" would be nearly useless to Luhmann as that was the overarching topic of both of his zettelkästen (I & II), whereas "Autonomie" was much more specific and useful for cross linking a smaller handful of potentially related ideas in the future.

      Looking beyond Luhmann can be highly helpful in designing and using one's own system. I'd recommend taking a look at John Locke's work on indexing (1685) (https://publicdomainreview.org/collection/john-lockes-method-for-common-place-books-1685 is an interesting source, though you're obviously applying it to (digital) cards and not a notebook) or Ross Ashby's hybrid notebook/index card system which is also available online (http://www.rossashby.info/journal/index.html) as an example.

      Another helpful tip some are sure to appreciate in systems that have an auto-complete function is simply starting to write a wikilink with various related subject heading words that may appear within your system. You'll then be presented with potential options of things to link to serendipitously that you may not have otherwise considered. Within a digital zettelkasten, the popularly used DYAC (Damn You Auto Complete) may turn into Bless You Auto Complete.

    1. SciScore for 10.1101/2022.06.01.494385: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: Sera were collected at the U.S. Food and Drug Administration with written consent under an approved Institutional Review Board (IRB) protocol (FDA IRB Study # 2021-CBER-045).<br>IRB: Sera were collected at the U.S. Food and Drug Administration with written consent under an approved Institutional Review Board (IRB) protocol (FDA IRB Study # 2021-CBER-045).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Membranes were probed for the V5-tag and γ-actin using V5 epitope tag antibody (Novus Biologicals, Centennial, CO), and mouse gamma actin polyclonal antibody (Thermofisher), respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>V5-tag</div><div>suggested: (Novus Cat# NB100-62264, RRID:AB_965837)</div></div><div style="margin-bottom:8px"><div>V5 epitope tag antibody (Novus Biologicals, Centennial, CO)</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>mouse gamma actin</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">ACE2 genes of various species (African green monkey (AGM), Chinese rufous horseshoe bat (Rhinolophus sinicus), ferret, mouse, Chinese hamster, Syrian golden hamster, white-tailed deer, swine, bovine, and pangolin) with a C-terminal V5 tag were synthesized by GenScript as described previously 42. 293T (ATCC, Manassas, VA, USA; Cat no: CRL-11268), 293T.ACE2 (BEI Resources, Manassas, VA, USA; Cat no: NR-52511) 64 and 293T.ACE2.TMPRSS2 cells stably expressing human angiotensin-converting enzyme 2 (ACE2) and transmembrane serine protease 2 (TMPRSS2) (BEI Resources, Manassas, VA, USA; Cat no: NR-55293) 34 were maintained at 37°C in Dulbecco’s modified eagle medium (DMEM) supplemented with high glucose, L-glutamine, minimal essential media (MEM) non-essential amino acids, penicillin/streptomycin, HEPES, and 10% fetal bovine serum (FBS).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T.ACE2.TMPRSS2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudoviruses comprising the spike glycoprotein and a firefly luciferase (FLuc) reporter gene packaged within HIV capsid were produced in 293T cells by co-transfection of 5 μg of pCMVΔR8.2, 5 μg of pHR’CMVLuc and 0.5 μg of pVRC8400 or 4 μg of pcDNA3.1(+) encoding a codon-optimized spike gene.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Soluble ACE2 Protein Production: His-tagged soluble human ACE2 was produced in FreeStyle™ 293-F cells by transfecting soluble human ACE2 (1-741 aa) expression vector plasmid DNA using 293fectin (Thermo Fisher) and purified using HiTrap Chelating column charged with nickel (GE healthcare) according to the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293-F</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmids and Cell Lines: Codon-optimized, full-length open reading frames of the spike genes of B.1 (D614G) and Omicron variants in the study were synthesized into pVRC8400 (B.1, BA.1, BA.2, and BA.3) or pcDNA3.1(+) (BA.1.1) were obtained from the Vaccine Research Center (National Institutes of Health, Bethesda, MD) and GenScript (Piscataway, NJ, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pVRC8400</div><div>suggested: RRID:Addgene_63163)</div></div><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The HIV gag/pol packaging (pCMVΔR8.2) and firefly luciferase encoding transfer vector (pHR’CMV-Luc) plasmids 62,63 were obtained from the Vaccine Research Center (National Institutes of Health, Bethesda, MD, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHR’CMV-Luc</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudoviruses comprising the spike glycoprotein and a firefly luciferase (FLuc) reporter gene packaged within HIV capsid were produced in 293T cells by co-transfection of 5 μg of pCMVΔR8.2, 5 μg of pHR’CMVLuc and 0.5 μg of pVRC8400 or 4 μg of pcDNA3.1(+) encoding a codon-optimized spike gene.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMVΔR8.2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Titers were calculated using a nonlinear regression curve fit (GraphPad Prism Software Inc., La Jolla, CA, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The ACE2 concentration causing a 50% reduction of luciferase activity compared to untreated control was reported as the IC50 using a nonlinear regression curve fit (GraphPad Prism software Inc., La Jolla, CA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:


      Our study has several caveats, including the use of pseudoviruses instead of authentic SARS-CoV-2 for conducting experiments. However, our findings using pseudoviruses agree with those reported using authentic SARS-CoV-2. For instance, authentic BA.1 /BA.1.1 VOCs were shown to undergo attenuated replication in TMPRSS2-expressing cells compared to ancestral Wuhan-Hu-1, and Alpha, Beta, and Delta VOCs 6,36. These reports also showed greater sensitivity of BA.1 pseudovirus entry to endosomal inhibitor E64d. While we used pseudovirus entry assays to determine Omicron variant usage of ACE2 receptors of various animal species, it remains unknown whether there may be intrinsic and/or innate host-specific factors that might act to inhibit live Omicron VOCs at an entry or post entry step. Furthermore, although we identified RBM substitutions in Omicron spike that conferred the ability to use mouse or horseshoe bat ACE2, we didn’t confirm ACE2 substitutions that permit or prevent Omicron spike binding. For instance, introducing K35E substitution in horseshoe bat ACE2 should permit Omicron variants’ usage. Finally, analysis of a limited number of serum samples and short follow up after the receipt of three doses of the Pfizer/BNT162b2 mRNA vaccine do not give us insights into the durability of the antibody response. While studies of antibody durability are ongoing, our findings indicate that three dose immunization with the Pfizer/BNT162b2 will likely contribute to protection from sever...


      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.06.01.494101: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Protein samples were resolved by SDS polyacrylamide gel electrophoresis and transferred onto a nitrocellulose membrane using Trans-Blot Turbo Transfer System (Bio-Rad, Hercules, CA), followed by blocking for 1 h with 5% nonfat milk in Tris-buffered saline-Tween 20 buffer and probing with antibodies against Strep Tag (SAB2702215, Sigma-Aldrich), γ-catenin (sc-514115, Santa Cruz Biotechnology) and GAPDH (A00084, GenScript) (Supplementary Table 6).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>γ-catenin</div><div>suggested: (Immunological Sciences Cat# AB-90215, RRID:AB_2892157)</div></div><div style="margin-bottom:8px"><div>sc-514115, Santa Cruz Biotechnology</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>GAPDH</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The washed membranes were incubated with secondary antibody StarBright Blue 700 Goat anti-mouse IgG (Bio-rad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Coverslips were washed three times with PBS before secondary anti-mouse antibodies incubation (1:1000 dilution).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For staining, cells were resuspended in PBS 0.1% BSA 0.01% NaN3 containing the monoclonal antibody PE mouse anti-human CD54 (BD Pharmingen) or its isotype control at a concentration of 1/500.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human CD54</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The primary anti-ZO-1 antibody (ref. 61-7300, Invitrogen) was diluted at 1:100 in PBS containing 1% BSA and incubated for 3 h at RT.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-ZO-1</div><div>suggested: (Innovative Research Cat# 61-7300, RRID:AB_138452)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The secondary antibody (anti-rabbit IgG-FITC, ref. 9887, Sigma) was diluted 1:200 in PBS and incubated for 1 h at RT.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: (Sigma-Aldrich Cat# F9887, RRID:AB_259816)</div></div><div style="margin-bottom:8px"><div>anti-rabbit IgG-FITC</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, VSV-G pseudotyped ORF7a or ORF7b lentivirus was produced by co-transfection of HEK293T cells with the pLVX-ORF7a or pLVX-ORF7b plasmids, pCMV-Gag-Pol and pCMV-VSV-G using Lipofectamine 2000 Reagent (Thermo Fisher Scientific) as per manufacturer instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">RNA isolation and sequencing: WT A549, A549-ORF7a and A549-ORF7b cells were seeded (3×10E5) in 6-well plates and lysed using RLT buffer for RNA isolation (RNeasy mini kit, Qiagen).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549-ORF7b</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 24 h incubation, A549 cells were labeled with calcein-AM.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549</div><div>suggested: NCI-DTP Cat# A549, RRID:CVCL_0023)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Lentivirus production, cell culture and transduction: ORF7a or ORF7b coding sequences (codon-optimized for mammalian expression) were cloned into pLVX-EF1α-IRES-Puro Cloning and Expression Lentivector (System Biosciences) to generate pseudotyped lentiviral particles encoding the ORF7a or ORF7b accessory proteins of SARS-CoV-2 (Wuhan-Hu-1 isolate) at the CNIC (Centro Nacional de Investigaciones Cardiovasculares) Viral Vector Unit (ViVU).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLVX-EF1α-IRES-Puro</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, VSV-G pseudotyped ORF7a or ORF7b lentivirus was produced by co-transfection of HEK293T cells with the pLVX-ORF7a or pLVX-ORF7b plasmids, pCMV-Gag-Pol and pCMV-VSV-G using Lipofectamine 2000 Reagent (Thermo Fisher Scientific) as per manufacturer instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLVX-ORF7a</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pLVX-ORF7b</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pCMV-Gag-Pol</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pCMV-VSV-G</div><div>suggested: RRID:Addgene_8454)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Raw counts were transformed with the vst function in the DESeq2 package (Love et al., 2014) of the R software version 3.6.3 (R Core Team, 2020), and subsequent PCA was performed with the prcomp function.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>DESeq2</div><div>suggested: (DESeq, RRID:SCR_000154)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Finally, the PCA graph was made with Graphad Prism software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Graphad Prism</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All sequencing data sets are available in the NCBI BioProject database under accession number PRJNA841835.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BioProject</div><div>suggested: (NCBI BioProject, RRID:SCR_004801)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Enrichment analyses were carried out by selecting the genomics sources: KEGG Pathway, GO Biological Processes, Reactome Gene Sets, Canonical Pathways, and CORUM.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GO Biological</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Relative expression results were calculated using GenEx6 Pro software (MultiD-Göteborg, Sweden), based on the Cq values obtained.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GenEx6 Pro</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For these experiments, a CytoFLEX flow cytometer (Beckman Coulter) was used and data was analyzed using FlowJo v10 (BD Biosciences).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.05.27.493767: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The pGEX-6P-1-nsp5 (or Mpro) plasmid was a kind gift from Dr. Martin Walsh, Diamond Light Source. pGBWm4046979 (coding for full-length nsp7, NCBI Reference Sequence: YP_009725303.1, codon-optimized, with an initial Met and a cleavable C- terminal TEV 6x-His tag was a gift from Ginkgo Bioworks (Addgene plasmid 145611; http://n2t.net/ addgene:145611; RRID: Addgene_145611).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pGEX-6P-1-nsp5</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pGBWm4046979</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_145611)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">pGBWm4046852 (coding for full- length nsp8, NCBI Reference Sequence: YP_009725304.1, codon-optimized, with an initial Met and a cleavable C-terminal TEV 6x-His tag) was a gift from Ginkgo Bioworks (Addgene plasmid 145584; http://n2t.net/ addgene:145584; RRID: Addgene_145584).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pGBWm4046852</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_145584)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The gene encoding SARS-CoV-2 nsp10 was cloned into the pGEX-6P-1 vector to generate an expression construct containing an N-terminal GST tag and an HRV 3C protease cleavage site (GST3CNsp10).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pGEX-6P-1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmids for codon-optimized pET-28a- His6-nsp7-8 and pET-28a-His6-nsp7-11 (with an HRV 3C protease cleavage site between the 6x- His tag and the coding sequence) were obtained from GenScript (Piscataway, NJ).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pET-28a-</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pET-28a-His6-nsp7-11</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The pGEX- 6P-1-nsp5 expression plasmid was transformed into E. coli Rosetta gami competent cells and cultured in LB media at 37 °C with 100 μg/mL ampicillin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pGEX-</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>6P-1-nsp5</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The gene encoding SARS-CoV-2 nsp10 was cloned into the pGEX-6P-1 vector to generate an expression construct containing an N-terminal GST tag and an HRV 3C protease cleavage site (GST3CNsp10).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: (Active Motif Cat# 91351, RRID:AB_2847848)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The gel band intensity for nsp7-11 was calculated using ImageJ software (https://imagej.nih.gov/ij/index.html) and plotted against the concentration of binders using the GraphPad Prism Version 9.3.1 (GraphPad Software, La Jolla California USA, www.graphpad.com).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Crosslink spectral matches found in Proteome Discoverer were exported and converted to sequence spectrum list format using Excel (Microsoft).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Proteome Discoverer</div><div>suggested: (Proteome Discoverer, RRID:SCR_014477)</div></div><div style="margin-bottom:8px"><div>Excel</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The data was reduced using BioXTAS RAW 2.0.3 (81).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BioXTAS</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">They are also provided in the SM as PyMOL sessions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMOL</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
  5. May 2022
    1. ever attempted commenced operations. Now that the telescope has been successfully deployed in its unique position in space, its advanced instruments will be able to gather data on questions that scientists once could only dream of answering. Is there life on other planets?

      Yeah!

    1. SciScore for 10.1101/2022.05.27.493400: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The mammalian cell line HEK 293/T served as host for recombinant production of the glycoprotein.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293/T</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, pCAGGS based, NCBI accession number: LT727518) was chosen for the mammalian expression system.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAGGS</div><div>suggested: RRID:Addgene_127347)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The amplicon was digested with the respective restriction enzymes (ThermoFisher) and ligated with T4 Ligase (ThermoFisher) into the linearised πα-SHP-H vector to clone πα-SHP-H–Sgene with an N-terminal octahistidin tag.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>πα-SHP-H</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Raw data (dot mean fluorescence intensity) was processed by GraphPad Prism 9 (GraphPad Software, USA)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. A shiny tag is defined by: A name such as span, div, h1 …, accessed with tag$name. Some attributes, which can be accessed with tag$attribs. Children, which can be accessed with tag$children. A class, namely shiny.tag.

      Shiny tags are stored in R as a list with three name values: name ( name of tag), attribute (list of key pairs), children (other html components inside), class usually R object class shiny.tag

    1. SciScore for 10.1101/2022.05.27.493682: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Euthanasia Agents: At the end point of the experiment, all remaining animals in the monoclonal antibody-administered group received an overdose of isoflurane and were humanely euthanized.<br>IACUC: Ethics statement: This study was approved by the Experimental Animal Welfare and Ethical Review Board of Wuhan Institute of Biological Products Co.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Male K18-hACE2 mice (6–8 weeks old, purchased from GemPharmatech Co., Ltd. Company.) were randomly distributed into groups (n = 3–6 mice per group).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Male K18-hACE2 mice (6–8 weeks old, purchased from GemPharmatech Co., Ltd. Company.) were randomly distributed into groups (n = 3–6 mice per group).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then cells were stained with anti-mouse IgG Taxes red conjugated antibody and anti-human IgG FITC-conjugated antibody (Sigma, USA) for another 30 min then analyzed by FACS Aria II (BD, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody Binding Kinetics Measured by SPR: The binding kinetics of mAbs to SARS-CoV-2 Delta-RBD or Omicron-RBD monomer were analyzed using SPR (Biacore 8K; GE Healthcare).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Delta-RBD</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells, Viruses and Proteins: Cell lines (HEK293T and Vero E6 cells) were initially acquired from the American Type Culture Collection (ATCC; USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK293T-hACE2-cells were generated via the overexpression of the human ACE2 receptor in HEK293T cells and were used in the neutralization assays of pseudoviruses.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T-hACE2-cells</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then mixtures were added to 2.5 × 105 HEK293T cells expressing ACE2 and incubated at 4 °C for another hour.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: RRID:CVCL_HA71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK293-hACE2 cells (2.5 × 104 cells/100μL per well) were then added into the mixture and incubated at 37 °C in a humidified atmosphere with 5% CO2 for 23 h to 25 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293-hACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Male K18-hACE2 mice (6–8 weeks old, purchased from GemPharmatech Co., Ltd. Company.) were randomly distributed into groups (n = 3–6 mice per group).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>K18-hACE2</div><div>suggested: RRID:IMSR_GPT:T037657)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The SARS-CoV-2 Spike ectodomain (1-1208) with a C-terminal Strep tag for purification and a foldon tag for trimerization was inserted into the pFastBac-Dual vector (Invitrogen) and was expressed using Bac-to-Bac baculovirus system (Invitrogen).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pFastBac-Dual</div><div>suggested: RRID:Addgene_137166)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The cDNA encoding SARS-CoV-2 Omicron Spike was synthesized (GenBank ID: ULC25168.1) and cloned into the pCAG vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAG</div><div>suggested: RRID:Addgene_74288)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All of these data were analyzed using Flow Jo.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Flow Jo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All statistical analysis was performed using GraphPad Prism 8.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Coot v.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Coot</div><div>suggested: (Coot, RRID:SCR_014222)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Figures were generated using PyMOL 2.0.779</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMOL</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.05.26.493517: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Spike proteins were captured through their C-terminal His-tag over an anti-His antibody surface.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-His</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For each residue within the RBD, the frequency of antibody recognition was calculated as the number of contact antibodies32.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antibodies32</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The structures of antibody-spike complexes for modeling were also obtained from PDB (7L5B (2-15), 6XDG (REGN10933), and 7KMG (LY-CoV555)).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>REGN10933</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Heavy chain variable (VH) and light chain variable (VL) genes for each antibody were synthesized (GenScript), then transfected into Expi293 cells (Thermo Fisher Scientific), and purified from the supernatant by affinity purification using rProtein A Sepharose (GE).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Expi293</div><div>suggested: RRID:CVCL_D615)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A14527); Vero-E6 cells were obtained from the ATCC (</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">CRL-1586); HEK293T cells were obtained from the ATCC (CRL-3216).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Neutralization curves and IC50 values were derived by fitting a nonlinear five-parameter dose–response curve to the data in GraphPad Prism v.9.2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">PyMOL v.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMOL</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. Our build bots do it by parsing your HTML files directly at deploy time, so there’s no need for you to make an API call or include extra JavaScript on your site. # HTML forms Code an HTML form into any page on your site, add data-netlify="true" or a netlify attribute to the <form> tag

      gross

    1. SciScore for 10.1101/2022.05.26.493539: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To measure the surface expression level of S protein, effector cells were stained with rabbit anti-SARS-CoV-2 S S1/S2 polyclonal antibody (Thermo Fisher Scientific, Cat# PA5-112048, 1:100)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 S</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Normal rabbit IgG (SouthernBiotech, Cat# 0111-01, 1:100) was used as negative controls, and APC-conjugated goat anti-rabbit IgG polyclonal antibody (Jackson ImmunoResearch, Cat# 111-136-144, 1:50) was used as a secondary antibody.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit IgG</div><div>suggested: (Jackson ImmunoResearch Labs Cat# 111-136-144, RRID:AB_2337987)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The deparaffinized sections were exposed to EnVision FLEX target retrieval solution high pH (Agilent, Cat# K8004) for 20 minutes at 97°C to activate, and mouse anti-SARS-CoV-2 N monoclonal antibody (clone 1035111, R&D systems, Cat# MAB10474-SP, 1:400) was used as a primary antibody.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 N</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell culture: HEK293T cells (a human embryonic kidney cell line; ATCC, CRL-3216)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, HEK293 cells (a human embryonic kidney cell line; ATCC, CRL-1573) and HOS-ACE2/TMPRSS2 cells (HOS cells stably expressing human ACE2 and TMPRSS2) (Ferreira et al., 2021; Ozono et al., 2021) were maintained in DMEM (high glucose) (Sigma-Aldrich, Cat# 6429-500ML) containing 10% fetal bovine serum (FBS, Sigma-Aldrich Cat# 172012-500ML), and 1% penicillin-streptomycin (PS) (Sigma-Aldrich, Cat# P4333-100ML).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HOS-ACE2/TMPRSS2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK293-ACE2/TMPRSS2 cells (HEK293 cells stably expressing human ACE2 and TMPRSS2) (Motozono et al., 2021) was maintained in DMEM (high glucose) containing 10% FBS, 1 µg/ml puromycin, 200 ng/ml hygromycin (Nacalai Tesque, Cat# 09287-84) and 1% PS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293-ACE2/TMPRSS2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>HEK293</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK293-C34 cells (IFNAR1 KO HEK293 cells expressing human ACE2 and TMPRSS2 by doxycycline treatment) (Torii et al., 2021) were maintained in DMEM (high glucose) containing 10% FBS, 10 μg/ml blasticidin (InvivoGen, Cat# ant-bl-1) and 1% PS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293-C34</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero cells [an African green monkey (Chlorocebus sabaeus) kidney cell line; JCRB Cell Bank, JCRB0111] were maintained in Eagle’s minimum essential medium (EMEM) (Sigma-Aldrich, Cat# M4655-500ML) containing 10% FBS and 1% PS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">VeroE6/TMPRSS2 cells (VeroE6 cells stably expressing human TMPRSS2; JCRB Cell Bank, JCRB1819) (Matsuyama et al., 2020) were maintained in DMEM (low glucose) (Wako, Cat# 041-29775) containing 10% FBS, G418 (1 mg/ml; Nacalai Tesque, Cat# G8168-10ML) and 1% PS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Calu-3 cells (a human lung epithelial cell line; ATCC, HTB-55) were maintained in EMEM (Sigma-Aldrich, Cat# M4655-500ML) containing 20% FBS and 1% PS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: ATCC Cat# HTB-55, RRID:CVCL_0609)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Calu-3/DSP1-7 cells (Calu-3 cells stably expressing DSP1-7) (Yamamoto et al., 2020) were maintained in EMEM (Wako, Cat# 056-08385) containing 20% FBS and 1% PS. 293S GnTI(-) cells (HEK293S cells lacking N-acetylglucosaminyltransferase (Kubota et al., 2016) were maintained in DMEM (Nacalai tesque, #08458-16 containing 2% FBS without PS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293S</div><div>suggested: RRID:CVCL_A784)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, the amount of pseudoviruses prepared was quantified by the HiBiT assay using Nano Glo HiBiT lytic detection system (Promega,Cat# N3040) as previously described (Ozono et al., 2021; Ozono et al., 2020), and the same amount of pseudoviruses (normalized to the HiBiT value, which indicates the amount of p24 HIV-1 antigen) was inoculated into HOS-ACE2/TMPRSS2 cells, HEK293-ACE2 cells or HEK293-ACE2/TMPRSS2 and viral infectivity was measured as described above (see “Neutralization assay” section).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293-ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">On day 3 (24 hours posttransfection), 16,000 effector cells were detached and reseeded into 96-well black plates (PerkinElmer, Cat# 6005225), and target cells (VeroE6/TMPRSS2 or Calu-3/DSP1-7 cells) were reseeded at a density of 1,000,000 cells/2 ml/well in 6-well plates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3/DSP1-7</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 infection: One day before infection, Vero cells (10,000 cells) and VeroE6/TMPRSS2 cells (10,000 cells) were seeded into a 96-well plate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6/TMPRSS2</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Preparation of mouse sera: BALB/c mice (female, 7 weeks old) were immunized with 1 μg SARS-CoV-2 BA.2 RBD protein in 50% AddaVax (Invivogen, Cat# vac-adx-10) at day 0 and 14.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/c</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The resulting PCR fragment was digested with KpnI and NotI and inserted into the corresponding site of the pCAGGS vector (Niwa et al., 1991).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAGGS</div><div>suggested: RRID:Addgene_127347)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2 S RBD (residues 322-536) was cloned into the expression vector pHLsec containing the N-terminal secretion signal sequence and the C-terminal His6-tag sequence (Aricescu et al., 2006).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHLsec</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">kit (Roche, Cat# KK2601) and assembled in vivo by yeast [Saccharomyces cerevisiae strain EBY100 (ATCC, MYA-4941)] homologous recombination with pJYDC1 plasmid (Addgene, Cat# 162458) as previously described (Dejnirattisai et al., 2022; Kimura et al., 2022a; Kimura et al., 2022b; Motozono et al., 2021; Yamasoba et al., 2022a; Zahradnik et al., 2021a)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pJYDC1</div><div>suggested: RRID:Addgene_162458)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To prepare effector cells, HEK293 cells were cotransfected with the S-expression plasmids (500 ng) and pDSP8-11 (500 ng) using PEI Max (Polysciences, Cat# 24765-1).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pDSP8-11</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To prepare target cells, HEK293 and HEK293-ACE2/TMPRSS2 cells were transfected with pDSP1-7 (500 ng) (Kondo et al., 2011).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pDSP1-7</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sequencing reads were trimmed using fastp v0.21.0 (Chen et al., 2018) and subsequently mapped to the viral genome sequences of a lineage A isolate (strain WK-521; GISAID ID: EPI_ISL_408667) (Matsuyama et al., 2020) using BWA-MEM v0.7.17 (Li and Durbin, 2009).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BWA-MEM</div><div>suggested: (Sniffles, RRID:SCR_017619)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Variant calling, filtering, and annotation were performed using SAMtools v1.9 (Li et al., 2009) and snpEff v5.0e (Cingolani et al., 2012).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SAMtools</div><div>suggested: (SAMTOOLS, RRID:SCR_002105)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The viral genome sequences were mapped to the reference sequence of Wuhan-Hu-1 (GenBank accession number: NC_045512.2) using Minimap2 v2.17 (Li, 2018) and subsequently converted to a multiple sequence alignment according to the GISAID phylogenetic analysis pipeline (https://github.com/roblanf/sarscov2phylo).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Minimap2</div><div>suggested: (Minimap2, RRID:SCR_018550)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Tree reconstruction was performed by RAxML v8.2.12 (Stamatakis, 2014) under the GTRCAT substitution model.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RAxML</div><div>suggested: (RAxML, RRID:SCR_006086)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Parameter estimation was performed via the MCMC approach implemented in CmdStan v2.28.1 (https://mc-stan.org) with CmdStanr v0.4.0 (https://mc-stan.org/cmdstanr/).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CmdStan</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>https://mc-stan.org</div><div>suggested: (Stan, RRID:SCR_018459)</div></div><div style="margin-bottom:8px"><div>CmdStanr</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The assay of each serum was performed in triplicate, and the 50% neutralization titer (NT50) was calculated using Prism 9 software v9.1.1 (GraphPad Software).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">RBD expression and ACE2 signal were recorded by using a FACS S3e cell sorter device (Bio-Rad), background binding signals were subtracted and data were fitted to a standard noncooperative Hill equation by nonlinear least-squares regression using Python v3.7 (https://www.python.org) as previously described (Kimura et al., 2022a; Kimura et al., 2022b; Motozono et al., 2021; Yamasoba et al., 2022a; Zahradnik et al., 2021b).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div><div style="margin-bottom:8px"><div>https://www.python.org</div><div>suggested: (CVXOPT - Python Software for Convex Optimization, RRID:SCR_002918)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Surface expression level of S proteins (Figures 3C and S2B) was measured using FACS Canto II (BD Biosciences) and the data were analyzed using FlowJo software v10.7.1 (BD Biosciences).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The size of syncytium (GFP-positive area) was measured using Fiji software v2.2.0 (ImageJ) as previously described (Suzuki et al., 2022; Yamasoba et al., 2022a).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Fiji</div><div>suggested: (Fiji, RRID:SCR_002285)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The stained cells were washed with tap water and dried, and the size of plaques was measured using Fiji software v2.2.0 (ImageJ).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Images were incorporated as virtual slide by NDP.scan software v3.2.4 (Hamamatsu Photonics).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NDP.scan</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">These analyses were performed in R v4.1.2 (https://www.r-project.org/).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>https://www.r-project.org/</div><div>suggested: (R Project for Statistical Computing, RRID:SCR_001905)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code and data.

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      In this manuscript, the authors address the important topic of post-transcriptional gene regulation using the larval nervous system in Drosophila. They utilize a novel approach taking advantage of existing protein trap library, which permits use of the same smFISH probe to detect an array of 200 RNAs and visualize their corresponding protein expression. Furthermore, the authors developed a computational pipeline to visualize and analyze the resulting data, which should enhance the application of this method by other researchers. A major strength of the data comes from the analysis of multiple cell types in distinct compartments of the nervous system, cell types (neuron, glia, neuroblast), and subcellular domains. From the cumulative data, the authors are able to describe several interesting observations relating to cell-specific post-transcriptional regulation, regulation within a central-neuroblast lineage and glial post-transcriptional regulation, among others.

      However, in spite of these strengths, there are several concerns related to the organization and interpretation of the manuscript that the authors should address in order to improve the manuscript:

      General concerns:

      1. The approach relies on gene traps that often fail to be made homozygous, presumably due to deleterious function of the YFP insert. This is an obvious limitation of the study, which the authors address, but do so insufficiently by only analyzing a single case Dlg1. The authors should report how many of the 200 YFP-traps can produce viable homozygous animals, whether phenotypes can be observed, and any other relevant information to assess the functional properties of the tagged genes.
      2. The term "discordant" is used for non-congruous RNA/Protein levels in soma and distal processes, and sometimes the two are analyzed in the same figure (e.g Fig 3A). When it is stated that 98% of genes are discordant, this is an over-simplification as what the authors describe as "discordant" is expected to occur frequently in the distal process, but less often in the soma (which is what the authors find when presenting the data for individual compartments - Fig 3B-C). This is confusing because the observation means completely different things in the two compartments, though both are interesting to describe. These analyses, and their interpretation, should be kept separate.
      3. There is not enough emphasis placed on the cell-type specific regulation of RNAs. There are very few studies that have investigated how localization of individual RNAs changes in different cell types or regions of the nervous system, and the authors find that this is quite prevalent. Therefore, the rather superficial analysis of these data fails to take advantage of a major strength of the data. For example, for the discordant genes that differ in neuropil localization between different regions of the CNS, what types of molecules do they encode, what is their function in neurons (if known), and why might they be required locally in one region of the CNS but not the other?
      4. The authors conclude that mRNA and protein co-localization in glia processes shows that mRNA localization makes a major contribution of the proteome in processes. However, there is not enough evidence for such conclusion since neither translation of these mRNAs nor lack of protein trafficking from the somas was shown.
      5. An important caveat of this technique that should be discussed is the lack of knowledge about the translation of these mRNAs, if the mRNA that is being detected is the same as the one that is translated. While the authors emphasize the discordance between mRNA and protein localization, it is not possible to know whether these mRNAs are being translated where they are found, e.g. soma vs neuropil. Moreover, there are many examples (e.g. BDNF) where the isoform influences the subcellular localization of the mRNA. There is no way of studying the isoforms here, and we could be looking for a different mRNA isoform localized to a specific compartment compared to the protein. These points must be discussed.

      Minor suggestions:

      • The authors should identify GO terms to understand what types of molecules are subjected to RNA regulation. They provide a supplementary table for all genes, but it would be useful to have a chart showing the proportion of different GO terms represented in the overall gene set, genes that show cell-specific regulation, genes that show neuron vs glia specific regulation, etc.
      • "However, post-transcriptional regulation can also manifest itself within a cell, so that a protein is localised to a distinct site from the mRNA that encodes it". While subcellular RNA localization may represent a regulatory layer, I do not agree that proteins that function in the cell at a different location than their translation site represents regulation per se. Many such cases exist for proteins that are trafficked!
      • "The majority of individual puncta appearing in the dlg1::YFP line (51% in the brain, 64% in larval muscles". Why is the agreement between YFP and endogenous FISH so low? Do many individual RNAs fail to hybridize? This should be discussed.
      • "However, one gene, indy, is highly transcribed in neuroblasts and a single ganglion mother cell before it is rapidly shut off (Figure S1A)". This figure does not exist. Where are the data?
      • The authors should be consistent about calling perineurial or perineural glia (both correct) in their images and text.
      • "We only observe a minority of localised axonal mRNAs that lack the protein they encode at the axon extremities, in contrast to our findings in the mushroom body, optic lobe, and ventral nerve cord neuropils" These results are not contrasted, as in all neuropils the minority of localized mRNAs are those lacking their corresponding proteins. For example, 9% in NMJ vs 7.5% in OL neuropil according to Fig. 1B. What is conflicting with the conclusion?
      • "These results suggest that motor axons are more selective than the other neuronal extensions in the mRNAs that are transported over their very long distances from the soma to the neuromuscular synapse" The current literature says that the same mechanism (cis-elements) is used to transport mRNAs to subcellular compartments, which would be inconsistent with the idea of motor axons being "more selective" than other neurons for the same mRNA, but just a result of fewer mRNAs being found in motor neurons: 34.% of the mRNAs are found in motor neurons soma vs 83% in OL soma, 86.5% in VNC soma, and 70.5% in MB soma. To get to this conclusion, the authors should show that mRNAs previously found in the neuronal extensions of other neurons are not found in the axons of motor neurons but are still expressed in thesir somas. They might want to suggest different RBPs involved in the transport or discussing the very long distance they need to travel which can influence their detection in the tips. Figures
      • Figure 1. Experimental approach summary
        • Some colors do not show well and should be changed, e.g: grey in Fig. 1A, and Fig. 1B probe sites indicated in light blue and pink within the introns of dlg1.
        • Fig. 1E': There appears to be a large discrepancy in co-detection % for CNS and muscle in the graph judging by the size of circles, yet in the text, it is stated that there is average of 51% and 64% in the two, respectively. I don't see any green circles with over 25% agreement in the graph. Are the colors correct here?
        • Fig. 1D-I: It's difficult to identify where the zoomed panels come from. E has its own square (indicating zoom in E'). Please make this square dashed or a different color in E so it is clear F and G do not come from there.
        • Comparing Fig. 1F vs K: Why does there appear to be so much more dlg1 mRNA in the YFP-tag condition? If this is due to selection of imaging area, please choose a more similar region to image so the RNA levels are comparable. Otherwise it indicates the YFP-tag line has more RNA expression, which is likely not the case.
      • Figure 2. Analysis pipeline overview
        • The lines for the first two zoomed panels are switched: The optic lobe is going to VNC and vice-versa.
      • Figure 3. Overall summary of results
        • Figure 3A: Soma/Neuropil/muscle should be separate or at least ordered such that they are next to each other to facilitate direct comparison of genes in the same region of the cell in neurons from different CNS areas. Why are glia not included in this summary? A third color should be used to indicate when there is neither mRNA nor protein expression.
        • "Compiling all the information together shows that there are that 196/200 or 98% of the genes show discordance between RNA and protein expression" However, 5 genes shown in Fig. 3A do not show "discordance": CG9650, cup, Lasb, rg, and vsg!!
      • Figure 4. Neuroblast lineage analysis
        • Is clustering around the NB sufficient to determine lineage relationship? There seems to be other neurons around the NB.
        • More examples should be shown for the post-transcriptional category, as it is the most interesting category, and there are many different possible outcomes. Are there cases of transcriptional control and post-transcriptional regulation? Are there cases where the youngest neurons (closer to the NB) in the progeny are expressing the protein while the oldest are not? If not, could this be an artifact from a slow translation and the protein being detected only after building up in the cell? Top1 protein (Fig. 4D) seems to be less expressed in the youngest neurons.
        • "The transcription rate of these genes, as indicated by the relative intensity of smFISH nuclear transcription foci, is similar across the neuroblast lineage, however protein signal is only detectable in a minority of the progeny cells (Figure 4E)". Many nuclei lack clear large spots, but have small spots indicative of RNA; how is this interpreted? Do they lack transcription, or is this due failure of the smFISH to capture all transcription sites? Were transcripts actually counted to assess cell-specific differences? This should be possible with smFISH
      • Figure 5. RNA synaptic localization
        • A have global analysis comparison of all neuropil areas would be welcome in this figure.
        • "Surprisingly, another 59 transcripts are present at synapses without detectable levels of protein (Figure 5E-H)" This text does not correspond to Fig 5E-H but 5I-L. Where is the text about 5E-H?
        • For Fig. 5J and 5N RNA appears scattered regularly throughout the entire panel area. How sure are the authors that this is not due to poor signal/noise? For example, perhaps too much probe being used for these targets.
        • Fig. 5R is not cited in the text.
      • Figure 6. RNA localization in glia
        • For Fig. 6B-G it is hard to tell if there is any overlap of the RNA and Glia. Maybe show multiple zoomed-in merged images and/or highlight the structures with lines that are present in all panels.
        • For Fig. 6L-O: How reproducible is this small amount of RNA puncta in the NMJ glia? Is this possibly biologically important?
        • Why do cartoons labelling subnuclear/perinuclear glia in Fig.6 and Fig.S6 show different localization?
        • The cartoons seem to extrapolate from the data: While in Fig 6B-D, we see neither the big bright spot of transcription in the glial nucleus nor as many transcripts in the neuropil, they are both present in the cartoon. In Fig. 6E-G there is no indication of cortical glia soma nor the transcription spot only in glia nuclei.
        • "To assess glial localisation for the 200 genes of interest, we used a pan-glial gal4 driving a membrane mCherry marker (repo-GAL4>UAS-mcd8-mCherry) to learn the expression pattern of all glial cells, and then classified the pattern in the YFP lines (without the marker) based on knowledge of that expression pattern. We validated this approach by combining the RFP marker" Did the authors use mCherry or RFP for these experiments? Also, the previous sentence is redundant.
      • Figure 7. RNA localization at neuromuscular synapse
        • RNA for these genes seems far too spread throughout the muscle to draw any conclusions
        • Also with so many RNAs distributed in the muscle, specific localization of RNA molecule to the precise PSD would have no conceivable benefit
        • I suggest drawing lines around the protein expression to facilitate visualization of the mRNA localization for panels B, F and J. It is especially hard to conclude anything from panels B and F.
        • Light grey with white dots is hard to see in the cartoons
      • Figure 8. Role of khc and activity in sgg localization
        • Presumably there is a huge number of developmental problems associated with this mutant that could cause decrease in sgg localization
        • If the authors include this, then they should characterize the mutant NMJs: what is the change in size, synapse number, etc..
        • Is there more sgg accumulated in soma as a result of less transport? Is sgg being expressed at the same level?
        • Fig. 8F-H: Why is Dlg1 accumulated in the entire axon, not just the presume synapse?
        • Fig. 8J: Why is sgg signal occurring in circles disconnected from the main axon? The authors should show a different image

      Significance

      This is a significant and complex paper that contributes with novel tools to an important issue

    1. indie thinkers are making a living from conducting online research; tools are becoming more integrated; apps encourage active creation over passive collection of knowledge. This 40-page report reviews the current state of the

      indie thinkers

    1. SciScore for 10.1101/2022.05.23.493138: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Polarization Anisotropy: Fluorescent RNA was ordered from IDT as a 10-nt degenerate sequence (random nucleotide at every position) with a 3’-FAM modification.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, a codon-optimized synthetic DNA (Integrated DNA Technologies, IDT) was inserted into a pET28 expression vector by Gibson assembly, fused to DNA encoding an N-terminal 6xHis-SUMO tag.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pET28</div><div>suggested: RRID:Addgene_21766)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The template for in vitro transcription of 5’-600 RNA was a synthetic DNA (IDT), inserted by Gibson assembly into a pUC18 vector with a 5’ T7 promoter sequence.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pUC18</div><div>suggested: RRID:Addgene_50004)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data from three independent N protein titrations were fit to a one-site binding curve using GraphPad Prism to determine KD.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.05.22.492693: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After blocking with 3% albumin (Sigma-Aldrich) and primary antibody incubation RAGE (ab3611, Abcam), ACE2 (XXX), ADAM17 (ab2051, Abcam)), TMPRSS2 (ab109131, Abcam), the membranes were incubated with an anti-rabbit peroxidase-conjugated secondary antibody (GE healthcare).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>ADAM17</div><div>suggested: (Abcam Cat# ab2051, RRID:AB_302796)</div></div><div style="margin-bottom:8px"><div>TMPRSS2</div><div>suggested: (Abcam Cat# ab109131, RRID:AB_10863728)</div></div><div style="margin-bottom:8px"><div>anti-rabbit peroxidase-conjugated secondary</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">500 μg of protein lysate was incubated with Anti-6X His tag® antibody [HIS.H8] (ab18184, Abcam) overnight at 4°C, anti-Mouse IgG (Invitrogen) was used as isotype control.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-6X</div><div>suggested: (Abcam Cat# ab18184, RRID:AB_444306)</div></div><div style="margin-bottom:8px"><div>anti-Mouse IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">P4417-100TAB-Sigma-Aldrich) plus 1% Bovine Serum Albumin (BSA) (Cat.A9647-500G-Sigma-Aldrich) and 0,02% NP-40 alternative (Cat.492016-100ML) for 1h at room temperature prior to overnight incubation at 4°C with primary antibody 1:100 (6xHisTag clone#HIS.H8 Cat.ab18184-Abcam or SARS-CoV-2 spike polyclonal antibody, GeneTex).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>6xHisTag</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were collected and stained using primary RAGE antibody 1:100 (PA5-24787, Thermo Scientific) for FACS analysis.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RAGE</div><div>suggested: (Thermo Fisher Scientific Cat# PA5-24787, RRID:AB_2542287)</div></div><div style="margin-bottom:8px"><div>PA5-24787</div><div>suggested: (Thermo Fisher Scientific Cat# PA5-24787, RRID:AB_2542287)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">1 × 105 THP-1 cells were seeded on a 24-well plate in their culture medium.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>THP-1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">THP1 and Monocytes infection with SARS-CoV-2: THP1 cells were plated at 5×105 cell/ml in 48-well plates in 200 μl of RPMI-1640 supplemented with 1% fetal bovine serum (FBS) (Euroclone).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>THP1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell culture supernatants were collected 24, 48, 72 and 144 h post-infection and stored at – 80°C until the determination of the viral titers by a plaque-forming assay in Vero cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: CLS Cat# 605372/p622_VERO, RRID:CVCL_0059)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The following day, cells were pretreated or not with 2μM Azeliragon (Cat.S6415-Selleckchem) for 30 minutes before adding 100 ng/mL of Sars-CoV-2 spike protein (RBD, HisTag) (Cat. ZO3483-1-GenScript) or infected using Heat-inactivated SARS-CoV-2 (VR-1986HK, ATCC) at 4 TCID50/mL for 2h at 37°C 5%CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VR-1986HK</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sequencing: Different library types were pooled at different ratios based on their targeted reads per cell and the nanomolarity of the library pools was confirmed using the Agilent Bioanalyzer 2100.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Agilent Bioanalyzer</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Separately for the two selected categories of disease severity (mild vs severe/critical), the pseudo-bulk counts were then fitted with a generalised linear model using the EdgeR package, to identify those genes characterised by a well-defined decreasing or increasing trend of the expression over the sample time-points.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>EdgeR</div><div>suggested: (edgeR, RRID:SCR_012802)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Among these sets, the GO:0050786 genelist was then expanded using the Cytoscape ‘stringApp’ (81) in order to identify among the nearest neighbours with confidence score > 0.7 the ones showing the highest absolute FC values in Myeloid cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Cytoscape</div><div>suggested: (Cytoscape, RRID:SCR_003032)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The GSEA has been done with the clusterProfiler library (82, 83), using gene lists ranked by the FDR of the differential analysis and the sign of the logFC.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GSEA</div><div>suggested: (SeqGSEA, RRID:SCR_005724)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The gating strategy and the relative analysis were performed with FlowJo software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code and data.

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.05.21.492554: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: A blood sample was taken following consent at least 14 days after symptom onset.<br>IRB: Sera from Beta, Gamma and Delta and BA.1 infected cases: Beta and Delta samples from UK infected cases were collected under the “Innate and adaptive immunity against SARS-CoV-2 in healthcare worker family and household members” protocol affiliated to the Gastro-intestinal illness in Oxford: COVID sub study discussed above and approved by the University of Oxford Central University Research Ethics Committee.<br>Field Sample Permit: The study was approved by the Human Research Ethics Committee of the University of the Witwatersrand (reference number 200313) and conducted in accordance with Good Clinical Practice guidelines.<br>IACUC: Gamma samples were provided by the International Reference Laboratory for Coronavirus at FIOCRUZ (WHO) as part of the national surveillance for coronavirus and had the approval of the FIOCRUZ ethical committee (CEP 4.128.241) to continuously receive and analyse samples of COVID-19 suspected cases for virological surveillance.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">The mean age of vaccinees was 37 years (range 22-66), 21 male and 35 female.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">AstraZeneca-Oxford vaccine study procedures and sample processing: Full details of the randomized controlled trial of ChAdOx1 nCoV-19 (AZD1222), were previously published (PMID: 33220855/PMID: 32702298).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">EXPERIMENTAL MODEL AND SUBJECT DETAILS: Bacterial Strains and Cell Culture: Vero (ATCC CCL-81) and VeroE6/TMPRSS2 cells were cultured at 37 °C in Dulbecco’s Modified Eagle medium (DMEM) high glucose (Sigma-Aldrich) supplemented with 10% fetal bovine serum (FBS), 2 mM GlutaMAX (Gibco, 35050061) and 100rnU/ml of penicillin– streptomycin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>VeroE6/TMPRSS2</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK293T (ATCC CRL- 11268) cells were cultured in DMEM high glucose (Sigma-Aldrich) supplemented with 10% FBS, 1% 100X Mem Neaa (Gibco) and 1% 100X L-Glutamine (Gibco) at 37 °C with 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: ATCC Cat# CRL-11268, RRID:CVCL_1926)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The resulting S gene-carrying pcDNA3.1 was used for generating pseudoviral particles together with the lentiviral packaging vector and transfer vector encoding luciferase reporter.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The gene fragment was amplified with pNeoRBD333Omi_F (5’- GGTTGCGTAGCTGAAACCGGTCATCACCATCACCATCACACCAATCTGTGCCCTTTCGAC-3’) and pNeoRBD333_R (5’-GTGATGGTGGTGCTTGGTACCTTATTACTTCTTGCCGCACACGGTAGC-3’), and cloned into the pNeo vector (Supasa et al., 2021).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pNeo</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To generate the BA.4/5 RBD construct containing a BAP- His tag, the gene fragment was amplified with RBD333_F (5’- GCGTAGCTGAAACCGGCACCAATCTGTGCCCTTTCGAC-3’) and RBD333_BAP_R (5’-GTCATTCAGCAAGCTCTTCTTGCCGCACACGGTAGC-3’), and cloned into the pOPINTTGneo-BAP vector (Huo et al., 2020a).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pOPINTTGneo-BAP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To express biotinylated RBDs, the RBD-BAP plasmid was co-transfected with pDisplay-BirA-ER (Addgene plasmid 20856; coding for an ER-localized biotin ligase), in the presence of 0.8 mM D-biotin (Sigma-Aldrich).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RBD-BAP</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pDisplay-BirA-ER</div><div>suggested: RRID:Addgene_20856)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The sensorgrams were plotted using Prism9 (GraphPad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The percentage reduction was calculated and IC50 determined using the probit program from the SPSS package.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SPSS</div><div>suggested: (SPSS, RRID:SCR_002865)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04324606</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Active, not recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">A Study of a Candidate COVID-19 Vaccine (COV001)</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04400838</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Active, not recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Investigating a Vaccine Against COVID-19</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.05.21.492920: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: , Radiation Safety, and Animal Care and Use Committees.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Male golden Syrian hamsters (7 to 8 weeks of age) were purchased from Envigo (Haslett, MI).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The wells were washed and then incubated with rabbit anti-ERα (1:2000, 1 h, RT) and horseradish-conjugated secondary antibody (1:2000, 1 h, RT) that were provided with the kit.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-ERα</div><div>suggested: (Santa Cruz Biotechnology Cat# sc-542, RRID:AB_631470)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The cells were then incubated at 4°C overnight with 2 μg/ml each of anti-ERα(H222) rat IgG1 monoclonal antibody (mAb) (Santa Cruz Biotech, sc-5349, 1:100) and HA-probe (</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-ERα(H222</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>rat IgG1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Afterwards, the cells were washed 4 times with PBS + 0.1% Tween-20 (PBS-T) for 5 minutes and incubated at room temperature for 1 hour in the dark with a fluorescent secondary antibody mixture contaning mouse IgGk BP-CFL594 (Santa Cruz Biotech, sc-516178, 1:100) and anti-rat IgG AF488 (ThermoFisher Scientific, cat no. A-11006, 1:500).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rat IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then, cells were washed and were incubated with detector anti-BrdU antibody for 1 hour at RT.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-BrdU</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After the incubation cells were washed and incubated with the horseradish peroxidase conjugated goat anti-mouse antibody for 30 minutes at RT.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, 50 μl of standard were added to standard wells and 40 μl of sample-to-sample wells and then added 10 μl of anti-TRAP antibody to sample wells and 50 μl of streptavidin-HRP to sample wells and standard wells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-TRAP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 72 hours, cells were washed, fixed with 4% formaldehyde, permeabilized with 0.1% Triton X-100 in PBS and stained overnight at 4°C with ACE2 protein-specific antibody (Abcam Ab15348).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were then incubated with anti-rabbit secondary antibody (Alexa Fluor 536 anti-rabbit, Invitrogen Life Technologies) for 1 hour at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sections were then incubated with cocktails of primary antibodies: rabbit anti-SARS-CoV-2 Spike Protein (1:100, Invitrogen, #MA5-36087) + rat anti-ERα H222 (1:100, Santa Cruz Biotechnology, #sc53492) overnight at 4°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 Spike Protein ( 1:100 , Invitrogen , #MA5-36087 )</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sections were then incubated with the primary antibodies rat anti-ERα H222(1:100, Santa Cruz Biotechnology, #sc53492), diluted in 1% normal goat serum (NGS), 4% BSA, 0.02% saponin in PB at 4°C overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-ERα H222</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sections were rinsed and incubated overnight at 4°C in the secondary antibody Nanogold-Fab’ goat anti-rat-IgG (1:100</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rat-IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">On day one, slides were blocked with a peroxidase blocker (Bio SB Catalog No. BSB 0054), washed with an immunoDNA washer buffer (Bio SB, Catalog No. BSB 0150); then, incubated with 0.2 μg/mL of anti-SARS-CoV-2 spike glycoprotein antibody (abcam, Catalog No. ab272504) for 1 hour.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 spike glycoprotein</div><div>suggested: (Abcam Cat# ab272504, RRID:AB_2847845)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, MCF-7 nuclear extracts (5 μg; ab14860, Abcam) were treated with either S (0.01-300 nM; Acro Biosystems)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MCF-7</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Proliferation assays: MCF-7 and MDA-MB-23 cells were obtained from ATCC and growth in DMEM without phenol red, supplemented with 10% fetal bovine serum (FBS), penicillin/streptomycin at 37 °C in a 5% CO2 and 95% humidified atmosphere.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MDA-MB-23</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">TRAP activity by ELISA assay in RAW-OCs: RAW264.7 (murine macrophages ATCC, USA) were cultured as manufacturer’s protocol.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RAW264.7</div><div>suggested: CLS Cat# 400319/p462_RAW-2647, RRID:CVCL_0493)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">ACE2 expression in Calu-3 cells: Calu-3 cell line was obtained from ATCC and maintained in Eagle’s Minimum Essential Medium(EMEM; Lonza) supplemented with 10% fetal bovine serum (FBS), 1% L-glutamine and 1% penicillin/streptomycin solution at 37°C in a humidified atmosphere of 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The next day, cells in each well were transfected with 1.5 μl of ViaFect reagent (Promega, cat no. E498A) and 0.5 μg of empty pcDNA3.1 vector, or an expression vector for the wild-type (WT) SARS-CoV2 S with a C-terminal hemagglutinin (HA) epitope tag (pBOB-CAG-SARS-CoV2-S-HA) or the double mutant (R682S,R685S) SARS-CoV2 S with a C-terminal flag epitope tag (pCAGGS-SARS2-S-FKO).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div><div style="margin-bottom:8px"><div>pBOB-CAG-SARS-CoV2-S-HA</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">pBOB-CAG-SARS-CoV2-S-HA was a gift from Gerald Pao (Addgene plasmid # 141347; http://n2t.net/addgene:141347; RRID:Addgene_141347).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_141347)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">pCAGGS-SARS2-S-FKO (C-flag) was a gift from Hyeryun Choe & Michael Farzan (Addgene plasmid # 159364; http://n2t.net/addgene:159364; RRID:Addgene_159364).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_159364)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were fitted using the non-linear curve fitting routines in Prism® (Graphpad Software Inc).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Graphpad</div><div>suggested: (GraphPad, RRID:SCR_000306)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The digitized images were also analyzed using ProtoArray Prospector v5.2 and potential hits were identified using the software’s algorithm.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ProtoArray Prospector</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Protein binding responses were analyzed using BiaEval software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BiaEval</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Interactome analysis: The STRING database52, that integrates all known and predicted associations between proteins, including both physical interactions as well as functional associations has been used to analyses functional associations between biomolecules.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>STRING</div><div>suggested: (STRING, RRID:SCR_005223)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Images were prepared for presentation using ImageJ v.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After three washes, the Mouse/Rabbit PolyDetector Plus link &HRP label (Bio SB, Catalog No. BSB 0270) were applied.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Mouse/Rabbit PolyDetector Plus</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>PolyDetector</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.05.16.22275163: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: Individuals provide written, informed consent for collection of demographic and clinical variables as well as blood for biobanking on up to 5 occasions every 6 months</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plate containing the samples and standard curves were then incubated for 30 minutes at room temperature, washed, following which MSD SULFO-TAG-labelled goat anti-human IgG secondary antibody was added at a concentration of 1ug/ml and the plate was further incubated for one hour.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">These kits comprise 96 well plates, precoated with antigens, proprietary blocker, diluent, wash buffer, detection antibody, read buffer, control sera and reference standard.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antigens,</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In addition, assay performance was compared with the Abbott SARS-CoV-2 IgG assay and the Abbott SARS-CoV-2 IgG II assay, chemiluminescent microparticle immunoassays (CMIA) (Abbott laboratories, IL, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Abbott</div><div>suggested: (Abbott, RRID:SCR_010477)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:


      Although the CEPHR COVID19 Serology Assay has many advantages, it is not without limitations. The assay employs RBD derived from the Wuhan-Hu-1 reference strain of SARS-CoV-2. Although the test has been validated in convalescent plasma from individuals with confirmed SARS-CoV-2, these individuals were infected with the variants circulating in the first wave of infections in early 2020 and the performance of this assay against the different SARS-CoV-2 variants of concern (VOCs) that have emerged since is still under investigation. In addition, the vaccinated population was relatively small, with the majority of individuals less than 3 months from second dose vaccine. Given waning of post vaccine protection22, sensitivity of the assay may alter as time post vaccination increases. Additionally binding assays do not evaluate antibody function, such as neutralising capacity or antibody effector function, although these gold standard assays are time consuming and expensive and do not lend themselves to high throughput. However, correlation of the CEPHR COVID19 Serology Assay with these gold standard functional assays is ongoing. Despite these limitations, the CEPHR SARS-CoV-2 Serology Assay is a robust, customisable, multiplex serologic assay for the detection of several different IgG specific to SARS-CoV-2, with multiple potential real world applications and performance characteristics that support its further development for use in both research and clinical settings.


      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer #1 (Evidence, reproducibility and clarity (Required)): Excellent quality of cell biology and biochemistry. the additional supports are needed for the claim of actin elongation using different formin variants.

      Reviewer #1 (Significance (Required)): Ingrid Billault-Chaumartin and co-authors described interesting research that provides insights on formin-isoform specific function in fission yeast and a new role of Fus1 FH2 domain in cell-cell fusion event. While three formin isoforms have different localization, research proposed an additional dissection in their functional differences by having different functions in C-terminus, including FH1 FH2 and formin C-terminus. The work also described additional factors that regulate cell fusions from autotrophy effect and formin expression level, in addition to the well-accepted formin biochemical activities. Here are my comments regarding the strengths of the work and improvements that could further strengthen the story.

      Major comments 1. Fig.1 shows Cdc12C could recapitulate Fus1 function by ~80% if fused with Fus1C, whereas deletion of the C-terminal tail of Cdc12 following FH2 introduces drastic dysfunction. Together with Fig. 3, these results indicate Cdc12 Cter plays more important roles than Fus1 Cter for there respective functions. Such results suggested a Cter-mediated mechanism that differentiates the functions of three fission yeast formin isoforms. The authors examined contributions from the difference in FH1 (Figs 4,5) and FH2 residues (Fig. 6). Whereas the obvious phenotype of Cter was not further investigated and not much discussed. The Cter of budding yeast formins interacts with nucleation-promoting factors, Bud6 and Aip5. Although S. Pombe does not have orthologs of budding yeast Bud6 and Aip5, I wonder would the author discuss the potential contribution of Cter in differentiating S. Pombe formins.

      The reviewer is correct that the C-terminal tail region of Cdc12 beyond the FH1-FH2 domains has a strong influence on the ability of Cdc12C to replace Fus1C. This is one reason why we specifically investigated the possible role of Fus1 C-terminal tail, which is much shorter than that of Cdc12. We found that Fus1 C-terminal tail plays only very minor role in regulating Fus1 function, as described in Figure 3. We note that contrary to what the reviewer states, Bud6 exists in S. pombe and binds the C-terminal tail of the formin For3 (see Martin et al, MBoC 2007), but whether it binds Fus1 is unknown. We have expanded our discussion to include a paragraph on the role of formin C-termini.

      Because the manuscript is focused on the function of Fus1 formin, we did not explore further the role of the Cdc12 C-terminal tail. It was previously shown that this region of Cdc12 contains an oligomerization domain that promotes actin bundling (Bohnert et al, Genes and Dev 2013). It is thus likely that this helps Cdc12 FH1-FH2 perform well in replacement of Fus1. In fact, it is likely that oligomerization boosts formin function, as we have discovered that Fus1 N-terminus contains a disordered region that fulfils exactly this function. This is described in a distinct manuscript under review elsewhere and just deposited on BioRxiv (Billault-Chaumartin et al, BioRxiv 2022; DOI: 10.1101/2022.05.05.490810). We have now cited this point in the discussion.

      1. Here, the study focuses on the FH1 between Fus1 and Cdc12 to understand their different functions in actin polymerization. FH1 mediated actin elongation through its interaction with profilin via polyP. The transfer rate of G-actin from profilin and profilin sliding depends on the polyP patterns regarding the length of each polyp motif and their distance to FH2 (Naomi Courtemanche and Thomas D. Pollard, JBC, 2012). To better understand the mechanisms by which these engineered FH1 variants on both Fus1 and Cdc12 in Fig. 4, the author may want to list the sequence of these engineered FH1 domains, including the information of the number and length of polyp motifs, and discuss these patterns.

      This list and discussion were available in the initial paper that characterized each of the constructs in vitro (Scott et al, MBoC 2011). We have now re-drawn it in a supplemental figure for convenience (as also answered in response to minor point 2), which is already provided in the revised manuscript as Figure S1. (Previous supplementary figures are re-numbered S1>S2, S2>S3 and S3>S4).

      1. Figs.4,5 cell biology results do not directly support the point of specific elongation rate unless the LifeAct-labeled actin cable elongation speed could be followed and quantified. The fluorescent tagging of tropomyosin does not show the actin cable pattern, which makes it very difficult to be used to study actin cable dynamics, such as elongation. Therefore, I feel the data in current Fig. 4 and Fig. 5 could not claim the differences in actin elongation without a quantitative comparison of elongation rate. I suggest a CK666 treatment to increase the visibility of the actin cable pattern of LifeAct, used before in both fission and budding yeasts, which would allow the author to quantify the actin cable elongation rate. Another way is to use the TIRF assay used in this study, which would give a better quantitation of formin nucleation and profilin-aided elongation.

      We respectfully disagree with the reviewer on this point. All the constructs we use in vivo have been characterized in vitro and their elongation rate carefully measured (Scott et al, MBoC 2011). These values are thus known and can be directly compared to our results in vivo.

      Of course, it would be fantastic to be able to directly measure formin elongation rates in vivo, but we are not aware that this has been done in any system. The proxy experiments that the reviewer suggests would be good ones, but each faces technical challenges that make them impossible in our system. First, because the fusion focus is a structure that forms in response to cell-cell pheromonal communication, we cannot add CK-666 or any other drug during this phase, as this perturbs the pheromone signal. Indeed, we had shown that simple buffer wash leads to loss of the fusion focus (see Dudin et al, Genes and Dev 2016). Second, the fusion focus is at the contact site between partner cells, i-e somewhat distant (1-2µm) from the coverslip during imaging. It is thus impossible to use TIRF. Finally, the fusion focus is a tightly packed actin structure. This is the reason why (rather than use of the tropomyosin marker) we cannot image single actin filaments (or even bundles) of which we could follow the dynamics as has been done to measure the retrograde flow of actin cables in yeast.

      What we have done is to use a better tropomyosin tag, mNeonGreen-Cdc8, which was just described (Hatano et al, BioRxiv 2022; DOI: 10.1101/2022.05.19.492673) to quantify amounts of linear actin. Although this is not a measure of elongation rate, it would give some sense about amounts of polymer assembled. We have obtained images with mNeonGreen-Cdc8 of all experiments previously conducted with GFP-Cdc8 and have replaced them in Figure 4C, Figure 5E, Figure 6E and Figure S2B. We have also quantified the relevant strains. The relative intensities of mNeonGreen-Cdc8 at the fusion focus at fusion time reflect remarkably well the measured elongation rates of the various formin constructs characterized in vitro. These data are now provided as new panels Figure 4F and Figure 5F.

      1. I appreciated the detailed biochemical dissections of multiple aspects of WTFus1 and Fus1R1054E, although the biochemical assays could not identify the mechanism by which R1054E causes the cell fusion. In many cases, the formin functions are diverse in diverse biological processes and sophisticated that cannot be explained well only from its biochemical activities in actin polymerization, such as the bundling, nucleation, and elongation studied in this story regarding fusion. This exciting information allows us to think of more possibilities that might regulate formin function rather than a direct change of formin activities in actin polymerization. I think a discussion of different aspects of functional regulation of formin might inspire society to investigate new possibilities to solve the mysteries. For example, the changes in formin behaviors and functions could be regulated by stress-induced formin turnover by degradation, cell signaling-regulated formin clustering and complex assembly, and their potential relevance to recruit protein constituents for fusion progression.

      We have added a paragraph on the role of Fus1 C-terminus. If you feel we should expand more on the diverse modes of regulation of formins, we could, but we have so far kept the discussion centred around the points of investigation in this paper, whose aim was to probe how changes in nucleation and elongation rates, rather than other regulations, affect the in vivo function of Fus1.

      Minor comments. 1. There are two types of "C", one includes FH1/FH2 and one following FH2, used in the manuscript, and it is a bit confusing. Better to differentiate them that allows an easy following. Fig. 1 uses Cdc12C-deltaC, Fig. 3 uses Fus1-delta Cter.

      We have updated the nomenclature to make this clearer: the C-terminal region beyond the FH1-FH2 domains is now called Cter throughout the manuscript.

      1. It's better to specify the amino acid position on the schematic of formins, such as panel A in many figures. It's always more informative to compare formin activities by considering the domain lengths, especially for the C-terminal tail that is variable in lengths and sequences. With similar thoughts, I suggest a supplementary figure that lists the sequence of all FH1 domains variants and Cter domains, such as the FH2 domain in Fig. S1.

      We have made a supplementary figure (new Figure S1) listing all constructs with specific aa positions as well as the FH1 domain variants and their sequences (see also answer to point 2 above). We have not added the sequence of the Cter domains in this figure, as these are extremely divergent and not particularly informative at this point.

      1. "n" for the statistic needs to be provided for Fig. S3.

      We have added the information to the legend of the figure (now Fig S4).

      1. The SDS-PAGE staining gel of the purified recombinant proteins for biochemical assays should be provided, particularly for these newly reported mutant variants.

      This is now provided as new panel S4C. We show the purified recombinant Cdc122FH1-Fus1FH2 proteins, which are the newly reported ones.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)): In this study, Billaut-Chaumartin and colleagues investigate the molecular specialization of the S. pombe formin, Fus1. The authors systematically modulate the actin filament elongation and nucleation activities of Fus1 by expressing chimeric constructs that contain Formin Homology 1 and 2 domains from two other formins with known polymerization activities. By characterizing the architecture of the fusion focus and the efficiency of cell fusion, they find that both the elongation and nucleation properties of Fus1 are specifically tailored for its cellular role. Comparison of formin constructs with similar elongation and nucleation activities also reveals that the Fus1 FH2 domain possesses a specific property that promotes efficient cell fusion. Using sequence alignment and homology modeling, the authors identify R1054 as the residue that confers this novel, fusion-specific activity to Fus1, despite producing no effect on its bundling or polymerization properties in vitro.

      Overall, this study is well motivated, and the results support the conclusions that are drawn. I have only minor suggestions, as described below.

      Minor comments: (1) The schematic diagrams of the chimeric formin constructs are very helpful. However, it is difficult to distinguish the colors from one another, especially in the case of the Cdc12FH1-Fus1FH2 variant, which requires discernment of the relatively small purple region within the dark blue molecule. Would it be possible to modify the colors to increase their contrast? Similarly, the blue and gray data sets in Figure 3B are very difficult to discern.

      We have changed the colours to improve contrasts.

      (2) The affinities (Kd) with which the formins bind the barbed ends as described in the second-to-last paragraph on page 8, in Figure Legend 7G, and in the "Analysis of pyrene data" section of the Materials and Methods should be defined as dissociation "constants", rather than dissociation "rates". Also, these affinities are lacking units in the following sentence on page 8.

      We have corrected this. The unit is nM.

      (3) When comparing the TIRF micrographs in Figure S3A, it looks as though both formins (but especially the R1054E variant) nucleate more filaments in the presence of profilin than in its absence. Is this a reproducible effect? If so, can the authors provide an explanation for this?

      There is strong variability in the filament numbers observed by TIRF in replicate experiments, which makes it difficult to use this technique to determine the nucleation efficiency. This may be due for instance to the stickiness of the glass, which may influence the number of observed filaments. We have measured the number of filaments after 130s of polymerization for each condition to test whether there are any significant differences between conditions despite overall variability. The measurements suggest that the addition of profilin increases the number of actin filaments. However, these results should be taken very carefully due to the experimental variations (very large error bars). Additionally, because Fus1-associated filaments are very short in absence of profilin, it is quite likely that this influences their crowding at the glass surface compared to longer filaments (in presence of profilin). Since in TIRF we can only observe the filaments at the glass surface, we may miss a portion of short Fus1-bound actin filaments in absence of profilin.

      For these reasons, and because the possible role of profilin in modulating nucleation efficiency by formins is not the object of the work here, would thus prefer not to include this graph in the manuscript.

      Reviewer #2 (Significance (Required)): This study contributes a key advancement towards understanding how the polymerization activities of formins are tailored to support diverse and specific cellular functions. The results in this study nicely complement and expand upon similar recent work that dissected the polymerization requirements of the formin Cdc12, which mediates cytokinetic ring assembly in S. pombe, and For2, which drives the assembly of apical networks that are necessary for polarized growth in Physcomitrella patens. As such, this work will likely be of significant interest to scientists who study mechanisms of actin dynamics regulation. The identification of R1054 as a residue that confers a novel regulatory activity to the FH2 domain of Fus1 will also likely be of great interest to biochemists and other scientists who study formins at the molecular level.

      My expertise is in the field of formins and actin polymerization.

    1. To select an element tag or attribute defined in a specific namespace, you declare a namespace prefix with an @namespace rule, then use it in your selector. The namespace is separated from the tag name with a | (vertical bar or pipe) character; if there is no tag name in the selector, use a universal * selector:

      ```css @namespace svg "http://www.w3.org/2000/svg";

      a { / These rules would apply to any a elements. / text-decoration: underline; color: purple; } svg|a { / These rules would apply to SVG a elements, but not HTML links. / stroke: purple; } svg| { / These rules apply to all SVG-namespaced elements, but not HTML elements. */ mix-blend-mode: multiply; } ```

    1. Reviewer #2 (Public Review):

      In this manuscript by Ma et al., the authors develop a mass cytometry that includes 5 heavy metal conjugated lectins. After some validation of this panel, the authors use the panel to analyze human PBMCs, tonsils and endometrial CD4 T cells before and after infection with an HIV virus with HSA reporter tag. They found that HIV infection was associated with higher levels of staining with 4 out of 5 lectins (sialic acid and fucose binders). Using the PP-SLIDE algorithm they previously developed, and they predicted that HIV preferentially infected higher cells with higher lectin binding and led to an increase in staining after infection. To validate this hypothesis, sorting of high vs. low lectin staining cells was performed to show that cells with higher lectin staining also had higher rates of HIV infection. They also used sialidase to reduce sialic acid levels and showed that it reduced HIV infection in PBMCs from two different donors. In addition to the development, validation and demonstration of mass cytometry lectin staining, the finding that glycosylation can influence HIV infectivity is novel and could open up new avenues for investigation. I think this work will be generally useful to the mass cytometry and HIV communities.

    1. GWG, Some random thoughts:

      Your challenge question is tough, not just for the mere discovery portion, but for the multiple other functions involved, particularly a "submit/reply" portion and a separate "I want to subscribe to something for future updates".

      I can't think of any sites that do both of these functionalities at the same time. They're almost always a two step process, and quite often, after the submission part, few people ever revisit the original challenge to see further updates and follow along. The lack of an easy subscribe function is the downfall of the second part. A system that allowed one to do both a cross-site submit/subscribe simultaneously would be ideal UI, but that seems a harder problem, especially as subscribe isn't well implemented in IndieWeb spaces with a one click and done set up.

      Silo based spaces where you're subscribed to the people who might also participate might drip feed you some responses, but I don't think that even micro.blog has something that you could use to follow the daily photo challenges by does it?

      Other examples: https://daily.ds106.us/ is a good example of a sort of /planet that does regular challenges and has a back end that aggregates responses (usually from Twitter). I imagine that people are subscribed to the main feed of the daily challenges, but I don't imagine that many are subscribed to the comments feed (is there even one?)

      Maxwell's Sith Lord Challenge is one of the few I've seen in the personal site space that has aggregated responses at https://www.maxwelljoslyn.com/sithlordchallenge. I don't think it has an easy way to subscribe to the responses though an h-feed of responses on the page might work in a reader? Maybe he's got some thoughts about how this worked out.

      Ongoing challenges, like a 30 day photography challenge for example, are even harder because they're an ongoing one that either requires a central repository to collect, curate, and display them (indieweb.xyz, or a similar planet) or require something that can collect one or more of a variety of submitted feeds and then display them or allow a feed(s) of them. I've seen something like this before with http://connectedcourses.net/ in the education space using RSS, but it took some time to not only set it up but to get people's sites to work with it. (It was manual and it definitely hurt as I recall.)

      I don't think of it as a challenge, but I often submit to the IndieWeb sub on indieweb.xyz and I'm also subscribed to its output as well. In this case it works as an example since this is one of its primary functions. It's not framed as a challenge, though it certainly could be. Here one could suggest that participants tag their posts with a particular hashtag for tracking, but in IndieWeb space they'd be "tagging" their posts with the planet's particular post URL and either manually or automatically pinging the Webmention endpoint.

      Another option that could help implement some fun in the system is to salmention all the prior submissions on each submission as an update mechanism, but one would need to have a way to unsubscribe to this as it could be(come) a spam vector.

    1. Using JSX is not mandatory for writing React. Under the hood, it's running createElement, which takes the tag, object containing the properties, and children of the component and renders the same information. The below code will have the same output as the JSX above.

      JSX的底层实现逻辑实际上是调用了React.createElement函数

    1. Reviewer #1 (Public Review):

      In this manuscript, authors found Halo tag become resistant to lysosome degradation upon ligand binding, using this unique property, they developed a highly sensitive assay to monitor the autophagy flux. Measuring autophagy flux is one of the most important assays for studying autophagy, there are a few widely used assays to monitor the autophagy flux, such as p62 degradation, and LC3 processing, however, each of them has its own limitation, which is well known in the field. In this regard, this assay provides a simple, straight forward and sensitive assay for measuring autophagy flux, which I personally think is very likely it will be widely used by the autophagy community. This is a well-controlled, rigorous study and the manuscript is clearly written.

    2. Reviewer #2 (Public Review):

      Yim et al have utilised the HaloTag system to generate tools and assays to measure autophagy flux. The assays are highly accessible and straight forward to conduct. The study does not have any major weaknesses, with all key conclusions strongly supported by clear data. A major strength of the study is the robustness of the assay and its ease of use across SDS-PAGE and imaging techniques that I expect will help with its uptake by the research community. The assay utilises the HaLo tag and its inherent stability within lysosomes once pulsed with a HaLo ligand. This enables analysis of autophagy flux over a set period of time. The approach is highly complementary to the recently published study by Rudinskiy et al (2022) MBoC, but also includes additional tools to measure different types of selective autophagy and bulk autophagy. The inclusion of limitations of their approach within the discussion will be very useful for researchers planning to use the assay in their work. Overall, this is an excellent study that has generated very valuable tools for the study of autophagy.

    3. Reviewer #3 (Public Review):

      Monitoring autophagy induction and flux in mammalian cells is challenging and depends largely on the mammalian ATG8 proteins (LC3 and GABARAP), typically tagged at the N-terminus with a small tag (HA, flag, myc) or a range of fluorescent tags. When autophagy is induced these ATG8 proteins get captured into autophagosomes and delivered to lysosomes for degradation. Monitoring flux by western blots relies on a molecular weight shift caused by lipidation, and quantification of loss of signal from degradation (analysis of initiation), or accumulation by the addition of inhibition of lysosomal inhibitors (analyses of flux). Fluorescent tags provide similar results but the measurements rely on counting degradation sensitive or resistant fluorescent signals. Image-based analysis is more challenging than western blot but both require significant optimization. In this manuscript these existing assays are modified by the use of a probe (Halo tag) again appended to the N-terminus of ATG8s which becomes resistant to lysosomal degradation after binding a ligand (TMR). The ligand can be pulsed-in to allow detection of acute induction of autophagy eliminating the background from basal accumulation. Generation of the Halo-TMR is then monitored by western blot or using an in gel-fluorescent assay. The authors present data which shows the adaptability of the system for imaging analysis, and for both quantitative analysis using western blot and imaging of selective autophagy or bulk, non-selective autophagy. The authors have developed a robust, useful alternative to existing assay and present the results in a careful, well described brief manuscript. These modifications are important for the field and for those who require quantitative results. The drawbacks are similar to existing assays and will usually require the generation of stable cell lines because over-expressed ATG8s can aggregate and confound the measurements.

    1. SciScore for 10.1101/2022.05.13.491770: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">4 colonies from each transformed plate were randomly picked and the insert was checked by performing colony PCR using nested PCR primers.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were incubated with an anti-SARS-CoV spike primary antibody directly conjugated with alexaflour-647 (CR3022-AF647) for up to 4 hours at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV spike</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Ten million PBMCs of select COVID-19 recovered donors were stained with RBD-Alexa Fluor 488 for 1 hour at 4°C, followed by washing with PBS containing 2% FBS (FACS buffer) and incubation with efluor780 Fixable Viability (Live Dead) dye (Life Technologies, #65-0865-14) and anti-human CD3, CD19, CD20, CD27, CD38 and IgD antibodies (BD Biosciences) for 30 minutes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human CD3</div><div>suggested: (RayBiotech Cat# CS-11-0105, RRID:AB_1227994)</div></div><div style="margin-bottom:8px"><div>CD19</div><div>suggested: (Agilent Cat# TC67401, RRID:AB_579635)</div></div><div style="margin-bottom:8px"><div>CD20</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD27 , CD38</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgD</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">mAb antibody binding was then detected with 50 μl/well of MSD SULFO-TAG anti-human IgG antibody (diluted 1:200) incubated for one hour at room temperature with shaking at 700rpm.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, 100 pfu of SARS-CoV-2 (2019-nCoV/USA_WA1/2020), Alpha, Beta, Gamma, Delta and Omicron (BA.1 and BA.2) were used on Vero TMPRSS2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero TMPRSS2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">IC50 titers were calculated by non-linear regression analysis using the 4PL sigmoidal dose curve equation on Prism 9 (Graphpad Software).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Graphpad</div><div>suggested: (GraphPad, RRID:SCR_000306)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were analyzed using FlowJo software 10</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">CryoEM data analysis and model building: CryoEM movies were motion-corrected either in Motioncorr2 in Relion3.0 (30) or using Patch motion correction implemented in Cryosparc v3.3.1 (31).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Cryosparc</div><div>suggested: (cryoSPARC, RRID:SCR_016501)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The combined Focused Map tool in Phenix was used to integrate high resolution locally refined maps into an overall map.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Phenix</div><div>suggested: (Phenix, RRID:SCR_014224)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Glycans with visible density were modelled in Coot (36).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Coot</div><div>suggested: (Coot, RRID:SCR_014222)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Model validation was performed using Molprobity (37).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Molprobity</div><div>suggested: (MolProbity, RRID:SCR_014226)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Figures were prepared in ChimeraX(34) and PyMOL (39).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMOL</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. Instead of being parsed, it was `import`-ed and `include`-d

      Flems does something like this:

      To allow you to use Flems with only a single file to be required the javascript and the html for the iframe runtime has been merged into a single file disguised as flems.html. It works by having the javascript code contained in html comments and the html code contained in javascript comments. In that way if loaded like javascript the html is ignored and when loaded as html the javascript part is ignored.

      https://github.com/porsager/flems#html-script-tag

    1. SciScore for 10.1101/2022.05.10.491349: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Protein expression of Nsp15 variants: WT Nsp15 was previously synthesized by Genscript (Piscataway, NJ), and contains an N-terminal His tag with thrombin and TEV cleavage sites in pET14b [28].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pET14b</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The sequences of Nsp15 isolates were then aligned to that of the original Wuhan isolate (GenBank NC_045512.2) using the nucmer command from MUMmer 4.0 package [53] with default parameters.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MUMmer</div><div>suggested: (MUMmer, RRID:SCR_018171)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.05.10.491295: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: The study was carried out following a protocol approved by the ANSES/EnvA/UPEC Ethics Committee (CE2A-16) and authorized by the French ministry of Research under the number APAFIS#25384-2020041515287655 v6 in accordance with the French and European regulations.<br>IRB: The study was carried out following a protocol approved by the ANSES/EnvA/UPEC Ethics Committee (CE2A-16) and authorized by the French ministry of Research under the number APAFIS#25384-2020041515287655 v6 in accordance with the French and European regulations.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Golden Syrian hamster infections and assessment of αREPs antiviral activity: Hamster infections: Thirty-two specific-pathogen-free (SPF) 8 weeks-old Golden Syrian hamsters (Mesocricetus auratus, males, provided by Janvier-Labs, Le Genest-Saint-Isle, France) housed under BSL-III conditions were kept according to the standards of French law for animal experimentation.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The sections were then incubated overnight in PBS with 0.2% BSA and 0.05% Tween-20 with primary antibodies directed against SARS-CoV-2 Nucleocapsid Protein (1:500; mouse monoclonal, # ZMS1075, Merck);</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2 Nucleocapsid Protein ( 1:500</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Fluorescence staining was performed using goat anti-rabbit Alexa-Fluor-488 (1:800; Molecular Probes – A32731; Invitrogen, Cergy Pontoise, France) and donkey anti-mouse Alexa-Fluor 555 (1:800; Molecular Probes – A32773; Invitrogen, Cergy Pontoise, France) secondary antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: (Thermo Fisher Scientific Cat# A32731, RRID:AB_2633280)</div></div><div style="margin-bottom:8px"><div>anti-mouse</div><div>suggested: (Thermo Fisher Scientific Cat# A32773, RRID:AB_2762848)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, HEK-293TT cells (106 cells per P6 well) were transfected with plasmids encoding GAG-POL, F-LUC and SARS-CoV-2 spikes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-293TT</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viral stocks were prepared by propagation in Vero E6 cells in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 2% (v/v</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">This mixture was added to Vero-E6 cells (CRL-1586, ATCC) seeded in a 96-well plate one day before.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To prepare the virus working stocks, a 25cm2 culture flask of confluent VeroE6 TMPRSS2 cells growing with MEM medium with 2.5% FCS was inoculated at a multiplicity of infection (MOI) of 0.001.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6 TMPRSS2</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">EC50 and EC90 determination: One day prior to infection, 5×104 VeroE6/TMPRSS2 cells per well were seeded in 100 µL assay medium (containing 2.5% FCS) in 96 well culture plates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6/TMPRSS2</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS CoV-2 Beta (SA lineage B 1.351) was isolated in France in 2021, The strain is available through EVA GLOBAL: UVE/SARS-CoV-2/2021/FR/1299-ex SA (lineage B 1.351) at https://www.european-virus-archive.com/virus/sars-cov-2-uvesars-cov-22021fr1299-ex-sa-lineage-b-1351. Sars-Cov-2 Gamma (SARS-CoV-2/2021/JP/TY7-503 lineage P.1, ex Brazil) was isolated in Japan in January 2021.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Sars-Cov-2 Gamma</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Production of the receptor binding domain (RBD) of the SARS-CoV-2 spike: The RBD (223 amino acids starting at position 319 of the spike sequence) coding sequence was cloned in frame behind a sequence encoding a signal peptide and in front of a His-tag coding sequence in the eukaryotic pYD11 expression plasmid.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pYD11</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">αReps expression and purification: The αRep genes encoding the RBD binders were subcloned in the bacterial expression vector pQE81 and resulting plasmids used for transforming Rosetta cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pQE81</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The sections were then incubated overnight in PBS with 0.2% BSA and 0.05% Tween-20 with primary antibodies directed against SARS-CoV-2 Nucleocapsid Protein (1:500; mouse monoclonal, # ZMS1075, Merck);</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Merck)</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Images were quantified using ImageJ (Rasband, W.S., ImageJ, U. S. National Institutes of Health, Bethesda, Maryland, USA, http://imagej.nih.gov/ij/, 1997–2012) to threshold specific staining of SARS-CoV-2 in the dorso-medial area of the nasal cavity.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All data obtained were analyzed using GraphPad Prism 8 software (Graphpad software).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>Graphpad</div><div>suggested: (GraphPad, RRID:SCR_000306)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.05.09.491254: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: EXPERIMENTAL MODELS AND SUBJECT DETAILS: MATERIALS AND METHODS: Human subjects: This study was approved by the Institutional Review Board of the University of Hong Kong/Hospital Authority Hong Kong West Cluster (Ref No. UW 21-452).<br>Consent: Written informed consent and questionnaire of vaccination and infection were obtained from these subjects.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antigen-specific B cells: To characterize the SARS-CoV-2 Spike-specific B cells, PBMCs from each vaccinee were first stained with an antibody cocktail contained dead cell dye (Zombie aquae), CD3-Pacific Blue, CD14-Pacific Blue, CD56-Pacific Blue, CD19-BV785, IgD-BV605, IgG-PE, CD27-BV711, CD21-PE/Cy7, CD38-Percp/Cy5.5, CD11C-APC/Fire750 and His-tag Spike protein.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgD-BV605, IgG-PE</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD38-Percp/Cy5.5</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD11C-APC/Fire750</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>His-tag Spike protein.</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were then washed with FACS buffer (PBS with 2% FBS) and further stained with the secondary antibodies including APC anti-His and DyLight 488 anti-his antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-His</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, different SARS-CoV-2 pseudotyped viruses were generated through co-transfection of 293T cells with 2 plasmids, pSARS-CoV-2 S and pNL4-3Luc_Env_Vpr, carrying the optimized SARS-CoV-2 S gene and a human immunodeficiency virus type 1 backbone, respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plasma-virus mixtures were then added into pre-seeded HEK293T-hACE2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T-hACE2</div><div>suggested: RRID:CVCL_A7UK)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, different SARS-CoV-2 pseudotyped viruses were generated through co-transfection of 293T cells with 2 plasmids, pSARS-CoV-2 S and pNL4-3Luc_Env_Vpr, carrying the optimized SARS-CoV-2 S gene and a human immunodeficiency virus type 1 backbone, respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pNL4-3Luc_Env_Vpr</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For intracellular staining, cells were fixed and permeabilized with BD Cytofix/Cytoperm (BD Biosciences) prior to staining with the mAbs against IFN-γ-PE, TNF-α-AF488 and IL-2-PE-Cy7.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BD Cytofix/Cytoperm</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Stained cells were acquired by FACSAriaIII Flow Cytometer (BD Biosciences) and analyzed with FlowJo software (v10.6) (BD Bioscience).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Correlation plots and heatmap visualizations: Correlograms plotting the Spearman rank correlation coefficient (r), between all parameter pairs were generated with the corrplot package (v0.84) (Wei and Sikmo, 2017) running under R (v3.6.1) in Rstudio (1.1.456).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Rstudio</div><div>suggested: (RStudio, RRID:SCR_000432)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Spearman rank two-tailed P values were calculated using corr.test (psych v1.8.12) and graphed (ggplot2 v3.1.1) based on *p<0.05, **p<0.01, ***p<0.001.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ggplot2</div><div>suggested: (ggplot2, RRID:SCR_014601)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Statistical analysis was performed using PRISM 8.0.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PRISM</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:


      Limitations of the study: There are some limitations in our study. First, we were unable to obtain blood samples from our subjects after they became infected and quarantined. We, therefore, could not determine the B and T cell activation post BA.2 infection. Nevertheless, vaccine breakthrough infections often recall rapid NAbs and T responses against various VOCs, including Omicron (Collier et al., 2022; Suntronwong et al., 2022; Zhou et al., 2022). Second, most of our infected vaccinees were confirmed infection by self-RAT, thus the effect of different vaccine regimens on controlling viral loads was not determined. It remains necessary to compare the dynamics and magnitudes of recalled immune responses among vaccinees with BA.2 breakthrough infection patients in the future. In summary, we report that 3×BNT and 3×CorV provided better protection against SARS-COV-2 BA.2 than 2×BNT and 2×CorV. High frequencies of S-specific activated memory B cells and cross-reactive T cell responses induced by the third vaccination are critical for protection and illness reduction during the Omicron BA.2 breakthrough infection.


      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.05.10.491301: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: All experiments with mice, hamsters, and macaques were carried out in accordance with the Regulations in the Guide for the Care and Use of Laboratory Animals of the Ministry of Science and Technology of the People’s Republic of China.<br>IACUC: All animal procedures were approved by the Institutional Animal Care and Use Committee of the Institute of Medical Biology, Chinese Academy of Medical Science.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">The 6- to 8-year-old male or female rhesus macaque experiments were performed in the animal biosafety level 4 (ABSL-4) facility at Wuhan Institute of Virology (WIV), Hubei, China.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The following primary antibodies were used in this study: anti-SARS-CoV-2 (2019-nCoV) Spike Antibody (40589-T62, Sino Biological), and anti-GAPDH Antibody (60004, Proteintech).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-GAPDH</div><div>suggested: (Proteintech Cat# 60004-1-Ig, RRID:AB_2107436)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The secondary antibodies used were Peroxidase AffiniPure Goat Anti-Rabbit IgG (H+L) (111-035-003, Jackson ImmunoResearch), Peroxidase</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-Rabbit IgG</div><div>suggested: (Jackson ImmunoResearch Labs Cat# 111-035-003, RRID:AB_2313567)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For determination of S-specific antibody response, plates were incubated with goat anti-mouse IgG HRP (for mouse sera, Proteintech Cat: SA00001-1) or goat anti-Syrian hamster IgG HRP (for hamster sera, abcam Cat: ab6892) or goat anti-monkey IgG HRP (for NHP sera, Invitrogen Cat: PA1-84631) at 37°C for 1 hour and then substrate tetramethylbenzidine (TMB) solution (Invitrogen) was used to develop.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgG</div><div>suggested: (Proteintech Cat# SA00001-1, RRID:AB_2722565)</div></div><div style="margin-bottom:8px"><div>anti-Syrian hamster IgG</div><div>suggested: (Abcam Cat# ab6892, RRID:AB_955427)</div></div><div style="margin-bottom:8px"><div>anti-monkey IgG</div><div>suggested: (Thermo Fisher Scientific Cat# PA1-84631, RRID:AB_933605)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines and antibodies: HEK 293F cells were grown in FreeStyle Media (Gibco-Thermo Fisher Scientific) and transiently transfected using polyethylenimine (PEI) (Polysciences, Inc.) in an 8% CO2 environment at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293F</div><div>suggested: RRID:CVCL_6642)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK 293A and Vero E6 cells were maintained in high glucose DMEM(GIBCO) supplemented with 10% FBS(GIBCO) and 1% penicillin/streptomycin (P/S) (GIBCO) in a 5% CO2 environment at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293A</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Virus titration: Virus titrations were performed by endpoint titration in Vero E6 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 1 hour of incubation, 100 μL mixtures were inoculated onto monolayer Vero cells in a 24- well plate for 1 hour with shaking every 15 minutes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Animal vaccination and serum collection: Mice: For mouse vaccination, groups of 6- to 8-week-old female BALB/c mice or female K18-hACE2 Transgenic Mice were intramuscularly immunized with LNP vaccine candidates or a placebo in 50 μL, and 3 weeks later, a second dose was administered to boost the immune responses.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/c</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cloning, expression, and preparation of the RQ3013 encoded Spike proteins: The gene encoding the RQ3013 was fused with a C-terminal twin Strep-tag (LEVLFQGPSGS WSHPQFEK GGGSGGGSGGSA WSHPQFEK) and cloned into a mammalian cell expression vector pcDNA3.1.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The resulting plasmid, pcDNA3.1-RQ3013-Twinstrep, was transformed into HEK 293F cells using polyethylenimine (PEI) in FreeStyle Media (Gibco-Thermo Fisher Scientific).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1-RQ3013-Twinstrep</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Other procedures of cryo-EM data processing were performed within RELION v3.1 or CryoSPARC v3 using the dose-weighted micrographs23, 24.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RELION</div><div>suggested: (RELION, RRID:SCR_016274)</div></div><div style="margin-bottom:8px"><div>CryoSPARC</div><div>suggested: (cryoSPARC, RRID:SCR_016501)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, the initial templates were fit into the map using Chimera and Coot28, followed by a ten-cycle rigid body refinement using Phenix.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Phenix</div><div>suggested: (Phenix, RRID:SCR_014224)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then, a combined manual refinement and real-space refinement were carried out for both prefusion state and postfusion state S structures in Coot and Phenix29.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Coot</div><div>suggested: (Coot, RRID:SCR_014222)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The dose-response curves were plotted from viral RNA copies versus the drug concentrations using GraphPad Prism 8.0 software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical Analysis: All statistics data were performed and graphed using GraphPad Prism8.0.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Manuscript number: RC-2021-01219

      Corresponding author(s): Rajan, Akhila

      1) General Statements [optional]

      This section is optional. Insert here any general statements you wish to make about the goal of the study or about the reviews.

      The goal of this study is to:

      • Define how prolonged exposure to a high-sugar diet (HSD) regime alters both the lipid landscape and feeding behavior.
      • Determine how changes in lipid classes within the adipose tissue regulates feeding behavior. Key findings:

      In this study, by taking an unbiased systems level and genetic approach, we reveal that phospholipid status of the fat tissue controls global satiety sensing.

      Impact of Key findings:

      By uncovering a critical role for adipose tissue phospholipid balance as a key regulator of organismal feeding, our work raises the possibility that the rate-limiting enzymes in phospholipid synthesis, including Pect, are potential targets for therapeutic interventions for obesity and feeding disorders.

      Peer review comments:

      This study has immensely benefited from the thoughtful peer-review of three reviewers. As per their recommendations, we have performed a major revision by performing additional experiments (see summary table below in next section) and strived to address the major concerns raised. Based on our reading, there were two major concerns that overlapped between all three reviewers raised. They are as follows:

      • Does the genetic disruption of Pect in fly fat body alter phospholipid levels? Two reviewers (#2 and #3) recommended that we perform lipidomic analyses on adult flies with adipose tissue specific knockdown of For the revised version, we have completed this lipidomic experiment, and present results as a new main Figure 6, Supplemental S7 and S9.
      • Is the dampened HSD induced hunger-driven feeding (HDF) behavior because of increased baseline feeding (#1 and #3)? In addition, reviewer #1, asked us whether HSD flies experience an energy-deficit? In other words, we were asked to uncouple whether what we observed was HSD-driven allostasis or indeed, as we had interpreted, that HSD dampened hunger-driven feeding response.

      Hence, they recommended that we:

      1. Re-analyze our hunger-driven feeding datasets and present non-normalized data (also requested by Reviewer #3) and show baseline feeding behavior on HSD. To address this, we have completed this analysis and present our results in Figure 1B-D and S1.
      2. Determine whether the HSD fed flies display an energy deficit on starvation. To this end, we performed an assayed starvation-induced fat mobilization on HSD, results for this are now presented on Figure 1E-G and S2. Conclusions after the revision:

      First, it is important to note here that the additional experiments have not caused a significant revision of the major conclusions of the original version of our study. In fact, we hope that the revised version provides clarity and further substantiation to our original arguments.

      • The lipidomics experiments on Pect fat-specific knock-down flies show that reducing Pect in fat-body causes a significant reduction in certain PE lipid species (PE 36.2 specifically- Figure 6B). This is consistent with a prior report on lipidomics of the Pect null allele by Tom Clandinin’s group (PMID: 30737130). Furthermore, we note that when Pect is knocked down in the fat body, there is a significant increase in two other classes of phospholipids LPC and LPE (Figure 6A). Together, this suggests that an imbalance in phospholipid composition in the absence of Pect activity in fat.
      • The starvation-induced fat mobilization experiments show that despite being fed a prolonged HSD, adult flies sense starvation and effectively mobilize fat stores, at a level comparable to Normal food (NF) fed adult flies, suggesting that even despite HSD exposure, adult flies experience an energy deficit on starvation.
      • In our non-normalized data, we find that the baseline feeding events are not significantly altered between HSD and NF-fed flies (Figure 1D). This suggests that the effects we observe are not due to an increase in the “denominator”, but a dampening of hunger-driven feeding on HSD. With regard to our original version, all three peer-reviewers found that the study was interesting, significant, important, and novel – Reviewer #1: “The work is potentially novel and interesting”; #2 : “I find the study to be potentially very important - the authors combine a longitudinal study that would be difficult in any other model with the powerful genetic tools available in the fly. The conclusions are mostly convincing”; #3: “This manuscript demonstrates how fat body Pect levels affect HSD induced changes in hunger-driven feeding response. I agree with all the reviewers points; potentially very interesting”. But had requested that we provide further substantiation and clarification.

      We sincerely hope that the peer-reviewers find that our revised version with additional new experimental datasets, improved data visualization, and the presentation of non-normalized raw data points, makes this study clear, compelling, and well-substantiated.

      • Point-by-point description of the revisions This section is mandatory. *Please insert a point-by-point reply describing the revisions that were already carried out and included in the transferred manuscript. *

      Below we summarize in Part A, the key experiments that were performed to address the major concerns. In Part B, we provide a point-point response to each reviewer with embedded datasets.

      Part a:

      We performed several new experiments, including:

      • To address the primary concern of Reviewer #1 regarding whether the HSD flies have a similar energy deficit to Normal food (NF) fed flies, we performed analysis of stored neutral fat Triacylglycerol (TAG) reserves and how HSD fed flies mobilized fat stores on starvation. We present these results in Figure 1E-G, S2. These results show that HSD-flies despite accumulating more TAG (S2), breakdown a similar amount of fat reserves as NF-fed flies on starvation at any time-point (Figure 1E-G). This suggests that HSD-fed flies do sense and respond to energy deficit.
      • To address concerns of reviewer #2 and #3 on whether Pect genetic manipulation affects specific phospholipid classes, we performed lipidomic analyses. The table below summarizes the new 3 new figures and 4 supplemental figures (blue text are all new figure numbers and figure panels) and three new Supplementary files as per reviewer’s request.

      Figure #

      Main point

      New datasets in revision

      Companion Supplement

      1

      HSD alters feeding behavior, but flies still breakdown TAG on starvation.

      TAG storage and breakdown over longitudinal HSD shows that HSD and NF fed flies show similar levels of TAG breakdown on starvation, despite consistently elevated TAG on HSD. This supports the idea that flies do sense starvation even on HSD, but there is a uncoupling of the feeding behavior after Day 14. Revised the data representation of Figure 1 to show non-normalized data over time. S1 and S2 companions are new in the revision. Panels 1D to 1E are new for the revision.

      S1- Raw data of feeding events plotted.

      S2 Elevated TAG at all time points.

      2

      HSD causes insulin resistance

      S3A added to show that insulin transcript levels remain the same in response to reviewer #3’s concerns.

      S3

      3

      Phospholipid concentration raw data from lipidomic on Day 7 and Day 14 HSD suggest that PC, PE levels are increased on Day 14 HSD.

      Figure 3 revamped to show new data visualization and non-normalized raw data to address Reviewer #2’s major concerns. S4A and S4B added. In addition Supplementary File 1 and 2 provided with raw lipidomics data as per reviewer #2’s request.

      S4.

      S4A- non normalized raw data of all other lipid classes on HSD.

      S4B- fatty acid species data on Day 14 added as per request of rev.#2.

      4

      HSD regulate Apo-I levels in the IPCs and phenocopies Pect KD.

      Added Figure 4A to show that HSD phenocopies Pect-KD in terms of delivery to brain

      S5 showing the validation of the Apo-I antibody.

      S6 validation of Pect KD and over-expression and Pect mRNA levels dysregulation on HSD.

      5

      Pect RNAi is insulin resistant

      N/A

      N/A

      6

      Pect knockdown shows significant increase in LPC and LPE, and a non-significant reduction in PC, PE levels. Specifically, the PE lipid class PE36.2 is downregulated.

      Fig 6, S7, S9 are completely new based on reviewer #2 and #3 requests. In addition Supplementary File 3 provided with raw lipidomics data as per reviewer #2’s request

      S7, S8, S9#.

      S7- new Pect KD other classes

      S8- new PE classes for day 14 and Pect associated classes.

      S9- Pect OE lipidomics

      7

      Pisd and Pect activity in adipocytes are required for hunger-driven feeding behavior in normal diets

      Pisd RNAi data was moved from supplement to main figure.

      N/A

      Note on revised text: We have revised text not only in the results section, but also as per reviewer #2’s recommendation, we have revamped our introduction and discussion as well. Since the manuscript has been significantly revised to include a main figure 6, fully altered Figure 1 and 3, multiple new supplemental figures, the changes in text are extensive. Hence, they are unmarked in the main text. Nonetheless, we hope that the reviewers will be able to evaluate these changes, as we have provided the specific locations in text and embed key figures in the point-point response below.

      __Part B: __Point-Point responses to reviewer comments.

      Reviewer #1 comments in Blue, author response in black.

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      In this manuscript, Kelly et al. show that the difference between the feeding behavior of fed and starved flies (hunger-driven feeding; HDF) is absent in animals fed a high-sugar diet (HSD) for two weeks or more. The disappearance of HDF with HSD coincides with changes in phospholipid profiles caused by HSD. Furthermore, RNAi-mediated downregulation of Pect in the fat body-a key enzyme in the PE biosynthesis pathway-phenocopies physiological effects of HSD. Moreover, downregulation or overexpression in the fat body abolishes or induces HDF, respectively, abolishes or induces HDF, respectively, independent of HSD treatment.

      Overall, the manuscript is well-written and the phenotypes are clear. However, I have major concerns regarding the authors' interpretation of the data and their conclusion. Most importantly, while it is clear that the authors' high-sugar dietary treatment affects feeding behavior and physiology, I am not convinced that the changes can be considered "hunger-driven"-which is central to the main point of the manuscript. Therefore, it is my recommendation that the authors substantially revise the manuscript by either showing additional/re-analyzed data that rule out alternative hypotheses, or rewriting the manuscript keeping alternative interpretations in mind.

      We are thankful to this reviewer for their thoughtful critique, and constructive and specific suggestions on how we can redress these concerns. We have taken on board the concerns of this reviewer regarding our interpretation of whether the changes in feeding behavior can be considered hunger-driven or not. Based on their advice, we have made significant changes by addressing: i) does HSD increased baseline feeding- we now show non-normalized raw data and data supports conclusion that baseline feeding is not higher; ii) whether HSD- fed flies can sense an energy deficit at levels similar to NF fed flies- we show that HSD flies sense energy deficit. We have provided detailed response below, and we hope the reviewer finds the additional datasets and re-analyzed data are consistent with the interpretation that prolonged HSD dampens starvation induced feeding. In addition to this key concern this reviewer has made a many other salient points that we have addressed with additional data or by clarifying the text.

      Major comments: 1) The data do not sufficiently show that the long-term HSD regime disrupts "hunger-sensing." The manuscript should address alternative hypotheses by showing raw instead of normalized data, rewriting the manuscript with a new central conclusion, or running additional experiments that actually show a defect in hunger-driven response. a. The main results that the authors rely on for the argument is that the ratio of feeding events that the starved and non-starved flies eat is different between the groups fed normal or HSD. However, because the authors only show normalized data (normalized to non-starved flies; Fig. 1), it is difficult to tell whether the change is due to a chronically increased feeding in non-starved HSD flies-maybe in perpetual hunger-like allostasis-or dampened starvation response. Indeed, the data shown in Fig S1 show that flies fed HSD for as short as 5 days show more frequent feeding events compared to age-matched controls fed normal food. It is possible that because the HSD-fed flies eat more than NF-fed flies, even without being starved, the ratio of starved/non-starved feeding is lower in the HSD-fed group-due to changes in the denominator, rather than the numerator.

      We have taken onboard this concern regarding presenting only normalized data, and that clouded the interpretation and left open other possibilities. In the completely revised figure 1 and S1. We now show non-normalized data, as a function of time. First we note that HSD-fed flies, do not show higher baseline feeding that NF fed flies, except on Day 10 of HSD, when there is a modest but significant elevation (Figure 1D).

      Nonetheless, on Day 10 HSD, flies still display increased hunger-driven feeding HDF (Figure 1C), it is only after Day 14 HSD that HSD dampens the starvation induced feeding.

      1. It is also possible that the HSD-fed flies are simply not in as big an energy deficit physiologically, due to the increased fat deposits they've accumulated (as the authors show later in the manuscript). It may take longer for the fat HSD flies to reach substantial energy deficiency than the NF flies, but they still may eventually be able to appropriately respond to hunger, just like NF flies. In such case, it would be a misnomer to call this behavioral change a 'defect in hunger-driven feeding behavior.' Maybe an experiment with a dose-response curve of "hunger driven feeding response" as a function of duration of starvation would help? Prompted by this reviewers question, we asked whether HSD fed flies, that have a higher baseline neutral fat store (Triacylglycerol-TAG) level, and if HSD-fed flies can sense energy deficit. For this, we revisited the longitudinal assays for neutral fat triacylglycerol (TAG) storage that our lab had generated, along with the HSD-HDF studies. We now present this evidence as Figure 1E-1G and Figure S2. Overall, our experiments point to the idea that adult flies fed HSD, are able to sense and mobilize TAG stores effectively throughout the 28-day time point that we analysed.

      First as shown in Figure S2, flies fed HSD display an increase in TAG levels. But it is to be noted that while TAG stores increase, the increase is not linear with time. This suggests that adult flies exposed to HSD store excess energy as TAG, but the increased TAG stores stay within a certain range despite the length of HSD exposure. This suggests that adult flies on HSD still display TAG homeostasis.

      Next, to directly address the reviewers point about HSD fed flies not sensing an energy deficit, we subject HSD-fed flies to an overnight starvation, same regime as used in the overnight feeding experiments, and asked whether they mobilize TAG. We noted that flies exposed to HSD breakdown TAG throughout the 28-day exposure at statistically significant levels for Day 3- Day 28, except on 14 and 21 days (Figure 1F). While there is TAG mobilization on Day 14 and 21, the difference is not statistically significant. Nonetheless, we note the same levels TAG breakdown for normal lab food (NF) fed flies on Day 14 and 21 (Figure 1E). Overall, HSD fed flies sense and display energy deficit, as measured by TAG store mobilization, throughout the 28 days of HSD exposure, at levels comparable to NF-fed flies (Figure 1G).

      Taken together, these results suggest that while HSD-fed flies experience an energy deficit on starvation, at levels comparable to NF-fed flies, throughout the 28-day time point assayed. But, their starvation driven feeding-response is dampened by Day 14 and by Day 28, the HSD-fed flies display more feeding events than HSD starved flies. These results are consistent with the interpretation that in HSD-fed flies the starvation-induced feeding behavior becomes desynchronized from the starvation induced TAG-mobilization, suggesting that there is an absence of hunger-driven feeding.

      2) How can you be sure that lower Dilp5 immunofluorescence is indicative of increased Dilp5 secretion? Wouldn't decreased production of dilp5 also have the same results?

      It has been shown previously in HSD fed larvae are hyperinsulinemic, i.e., they have 55% increase in circulating Dilp2 ( PMID: 22567167). Additionally, we have shown that ectopic activation of the insulin-producing neurons by expressing TRPA1, an ion channel that activates neurons, reduces Dilp5 accumulation without a change in Dilp5 mRNA levels (PMID: 32976758), suggesting that reduced Dilp5 accumulation, without alterations to mRNA levels is a proxy for increased secretion. Now, in response to this concern, in the revised manuscript, we have added qPCR data of Dilp2 and 5 (Figure S3A), which show no difference in expression levels after 14 days on HSD. Therefore, there is no dip in Dilp5 mRNA production. Given that Dilp2 and Dilp5 mRNA levels remain the same, but we see reduced Dilp5 accumulation, we interpret this to mean that Dilp5 secretion is increased.

      1. Also, the authors should state in the main text that it is Dilp5, not just any Dilp. Thanks for this suggestion and we have fixed this and referred to Dilp5 specifically throughout the text in the results section.

      3) Data presentation: a. Sometimes the data are normalized to NF (Fig 4B-C), sometimes not (ex. Fig 4A, S4C). Unless there is a specific rationale for the data transformation, it would be more appropriate to show untransformed data (ex. Fig 4A, S4C), especially as the authors use two-way ANOVA to determine significance. Only showing the differences implies comparison against a hypothetical mean (i.e. μ0=0), not between two group means.

      We thank the reviewers for bringing this issue to our attention. We updated all the figures to show untransformed data in the revised manuscript.

      1. Some figures show both individual data points and summary statistics (mean, SD, ... ex. Fig 2A)-which I believe is ideal-but some show only one or the other (ex. Fig 2B, no summary statistics; Fig. 3, no data points. The manuscript would read more convincing if data visualization is consistent across figures. We thank the reviewers for their feedback. We have made changes to all the figures in the revised manuscript to improve visual consistency.

      Minor comments: 1) High sugar diet: what is the actual sugar concentration in the NF v. HSD diets? The authors write that the HSD diet contains "30% more sugar" than the NF, but providing the final sugar concentrations-sucrose or others-would be informative for other scientists studying the effect of high sugar diets.

      We thank the reviewer for their suggestion and now we have updated the methods to include this sentence. “After 7 days, flies were either maintained on normal diet or moved to a high sugar diet (HSD), composed of the same composition as normal diet but with an additional 300g of sucrose per liter”.

      1. Additionally, the definition of HSD is inconsistent. Main text (Page 5, line 17) states that their HSD is "60% more sugar than normal media," whereas the figure legend (Fig 1) and the Methods state that the HSD contains "30% more sugar." We apologize for this egregious typo in the figure legend! We have now fixed this to say 30% HSD. Only 30% HSD was used throughout this study.

      2) Starvation medium: please provide justification for why the authors used 1% sucrose/agar for starvation medium, instead of plain agar/water that most labs use. At least clarify and provide a reference for the claim that the 1% sucrose/agar "is a minimal food media to elicit a starvation response."

      We are very grateful for this reviewer identifying this this methods description error and bring it to our attention. We used 0% sucrose agar for overnight starvation in this study as most labs do. The error occurred because we were using another manuscript from the lab to help draft the methods section (PMID: 29017032). In that study, where we assayed the effect of chronic starvation our lab used: “1% sucrose agar for 5 days at 25C”. However, in this current study, because we are testing acute effects of overnight starvation, we are using 0% sucrose agar.

      3) Pect mRNA level is higher with HSD. This is surprising because not only, as authors mention, is increased PC32.2 with HSD suggests lower Pect activity, but also because Pect RNAi phenocopies long-term HSD in HDF behavior, lipid morphology, FOXO accumulation in fat body. The authors speculate that the data "likely shown an upregulation in an attempt to mediate the Pect dysregulation occurring at the protein level." If that were true, a western blot may be informative. Zhao and Wang (2020, PLoS Genetics) generated a Pect antibody that seems compatible with western blot applications. That being said, I don't think such data is critical for the manuscript. I mention this simply as a suggestion for the authors. a. page 8, line 22-23, did you mean to write "Given how PC32.2 is elevated after 14 days of exposure to HSD, we assumed that Pect levels would be low for flies under HSD," not "high?" Otherwise the subsequent 2 sentences don't make sense.

      We agree that the most confusing aspect of the study was that Pect mRNA levels being very high on Day 14 HSD, but nonetheless the effects of Pect-KD phenocopied HSD. To resolve this, we have now performed lipidomic analyses on whole adult flies, when Pect is knocked-down (KD) by RNAi in the fat tissue. We now present a new dataset in Figure 6. Two striking changes occur. They are:

      1. Pect-KD shows increase in the phospholipid classes LPC and LPE (Figure 6A). In contrast, LPE is significantly downregulated on HSD Day 14 (Figure 3).
      2. Pect-KD shows a significant reduction in specific class of PE 36.2 (Figure 6B). Our data regarding increase in PE 36.2 agree with a previous lipidomic analyses of Pect mutant retina (PMID: 30737130). In contrast, PE 36.2 trends upwards on 14 day HSD (Figure S7C) though not significantly. On 14-day HSD consistent with extreme upregulation of Pect mRNA fed flies (Figure S6A; Pect mRNA 200-250 fold), PE trends upwards on 14-day HSD (Figure 3) and PE 36.2 trends higher (Figure S7C). We note that on the surface of it PE and LPE per se are contrasting between 14-day HSD lipidome and fat-specifc Pect-KD. But there is a significant commonality that under both states there is an imbalance of phospholipids classes PE and LPE. Hence, we propose that maintaining the compositional balance of phospholipid classes PE and LPE is critical to hunger-driven feeding and insulin sensitivity. Hence, either increase or decrease, of these key phospholipid species, may lead to abnormal hunger-driven feeding.

      We agree that a western blot would be informative as well, but we were unable to obtain the reagent from Dr. Wang’s group, precluding us from performing this request. See email snapshot.

      To ensure that we appropriately discuss and clarify this issue, we have now included a section in the discussion - Page 14 Lines 26-34- under the subtitle “The implications of relationship between Pect levels and HSD”. We have pasted an excerpt from that subsection below for this reviewers assessment.

      “Also, we note that over-expression of Pect cDNA in the fat-body does not alter phospholipid balance (Figure S9) and indeed improves HDF on HSD (Figure 7B). While this may appear inconsistent, it is critical to note that over-expression of Pect cDNA using UAS/Gal4 only increases Pect mRNA expression by 7-fold (Figure S6A), whereas HSD causes its upregulation by 250-fold (Figure S6B). Hence, we speculate that an increased ‘basal’ level of Pect such as by that provided by a cDNA over-expression in fat, may be protective to the negative effects of HSD (Figure 7B) without affecting overall phospholipid levels (Figure S9) , but extreme upregulation Pect on HSD affects the PE and LPE balance (Figure 3).”

      Reviewer #1 (Significance (Required)):

      The work is potentially novel and interesting, but at this stage it's difficult to interpret what the phenotype signifies. Although the manuscript could be revised simply by modifying the text, experimentally addressing the concerns would significantly improve the work.

      In sum, we hope we have addressed the key concern for Reviewer #1 as to whether the behavior we report here is indeed a dampening of starvation-induced feeding, or an effect of increase in baseline feeding. We hope that by reviewing our non-normalized data, they can appreciate that it is the former. Also, we hope that Reviewer #1 appreciates that we have strived to address the concerns by additional experiments, to clarify our findings and improve the impact of the work.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      This intriguing manuscript by Kelly and colleagues uses the fruit fly Drosophila melanogaster as a model to understand how diet-induced obesity alters the feeding response over time. In particular, the authors findings indicate that chronic exposure to a high-sugar diet significantly alters the starvation-induced feeding response. These behavioral studies are complemented by a lipidomics approach that reveals how a chronic high sugar affects many lipid species, including phospholipids. The authors then pursue mechanistic studies that indicate phospholipid metabolism within the fat body appears to remotely affect insulin secretion from the insulin producing cells. Moreover, the changes in phospholipid abundance are associated with changes in insulin-signaling, including increased insulin secretion from the IPCs and elevated levels of FOXO within the nucleus.

      I find the study to be potentially very important - the authors combine a longitudinal study that would be difficult in any other model with the powerful genetic tools available in the fly. The conclusions are mostly convincing, but a few follow-up experiments are required:

      We are grateful for the reviewers constructive, detail-oriented, and balanced feedback, and their recognition of the value of this study. Now, we have performed additional experiments to address the key concerns raised by all reviewers. We hope that on reading the revised version of our study, that the reviewer continues to feel positive about the message of this study and its potential impact.

      1. The key conclusions from the manuscript assume that manipulation of Pect expression levels alters phosphatidylethanolamine (PE) levels. However, the authors make no attempt to verify that the genetic experiments described herein actually affect PE levels. At a minimum, changes in PE levels should be verified for the Pect knockdown and overexpression lines. Similarly, there is no evidence that manipulation of either EAS or Pcyt2 induces the expected metabolic effects. I'm not asking that the longitudinal feeding experiments be repeated, simply that the authors measure the relevant lipid species, preferably with a targeted LC-MS approach.

      Prompted by this reviewer, we performed targeted LC-MS on whole adult flies, on normal diet, to assess lipid levels for fat-specific Pect-KD and overexpression. We decided to focus on Pect, as its knock-down even on normal diet causes a dampened hunger-driven feeding behavior (Figure 7A) and phenocopied a 14-day HSD feeding phenotype.

      We now present a new dataset in Figure 6. Two striking changes occur:

      They are:

      Pect-KD shows a significant reduction in specific class of PE 36.2 (Figure 6B). Our data regarding decrease in PE 36.2 agree with a previous lipidomic analyses of Pect mutant retina (PMID: 30737130). It is to be noted that though overall levels of all PE species trend downwards, like the Clandinin lab study on Pect (PMID: 30737130), we did not find a significant change in the overall PC and PE levels.

      • Pect-KD shows increase in the phospholipid classes LPC and LPE (Figure 6A). In contrast, LPE is significantly downregulated on HSD Day 14 (Figure 3). On 14-day HSD consistent with extreme upregulation of Pect mRNA fed flies (Figure S6A; Pect mRNA 200-250 fold), PE trends upwards on 14-day HSD (Figure 3) and PE 36.2 trends higher (Figure S7C). We note that on the surface of it PE and LPE per se are contrasting between 14-day HSD lipidome and fat-specifc Pect-KD. But there is a significant commonality that under both states there is an imbalance of phospholipids classes PE and LPE. Hence, we propose that maintaining the compositional balance of phospholipid classes PE and LPE is critical to hunger-driven feeding and insulin sensitivity. Hence, either increase or decrease, of these key phospholipid species, may lead to abnormal hunger-driven feeding.

      Finally, fat-specific Pect-OE did not cause significant changes to lipid species (Figure S9). This could either be due to the fact that in fat-specific Pect-OE flies under normal food and that we were assaying whole body lipid levels and not fat-specific lipid changes. But to counter that, even a 60% reduction in Pect mRNA levels (Figure S6A), was sufficient to produce an effect on whole body phospholipid balance (Figure 6). Hence, we speculate that by maintaining a basally higher (7-fold higher Pect mRNA level Figure S6A), might allow 14-day HSD-fed flies to buffer the negative effects of HSD and we predict that it might take longer to disrupt the phospholipid balance and HDF response.

      We have now included a section in the discussion - Page 14 Lines 26-34- under the subtitle “The implications of relationship between Pect levels and HSD”. We have pasted an excerpt from that subsection below for this reviewers assessment.

      “Also, we note that over-expression of Pect cDNA in the fat-body does not alter phospholipid balance (Figure S9) and indeed improves HDF on HSD (Figure 7B). While this may appear inconsistent, it is critical to note that over-expression of Pect cDNA using UAS/Gal4 only increases Pect mRNA expression by 7-fold (Figure S6A), whereas HSD causes its upregulation by 250-fold (Figure S6B). Hence, we speculate that an increased ‘basal’ level of Pect such as by that provided by a cDNA over-expression in fat, may be protective to the negative effects of HSD (Figure 7B) without affecting overall phospholipid levels (Figure S9), but extreme upregulation Pect on HSD affects the PE and LPE balance (Figure 3).”

      A central hypothesis in the study is that the HSD over a period of 14 days results in insulin resistant and that these changes are leading to changes in hunger dependent feeding. I would encourage the authors to determine if Foxo mutants are resistant to these HSD-induced effects on HFD.

      We thank the reviewers for this suggestion. However, given that dFOXO nuclear localization rather than expression levels regulate insulin sensitivity, we feel that disrupting dFOXO levels via mutation or knockdown will produce a plethora of indirect effects including developmental abnormalities (PMID: 24778227, PMID: 16179433, PMID: 29180716, PMID: 12893776). Our data suggest that chronic HSD treatment and Pect affect insulin sensitivity in fat tissue. However, we feel that investigating whether insulin sensitivity/FOXO signaling in fat tissue regulates feeding behavior is outside the scope of our work.

      1. In lines 25-30, the authors draw the conclusion that an increase in unsaturated fatty acid species is associated with the HSD and that these changes results in a more fluid lipid environment. While I agree with the model, the manuscript contains no evidence to support such a model. Either test the hypothesis or move the last line of the section to the discussion.

      We thank the reviewer for this important and insightful comment. We agree that the data we presented and discussed in the original version is at the moment speculative. Addressing the hypothesis that increase in unsaturated fatty acid species result in a more fluid lipid environment will require us to build tools and expertise. Hence, this hypothesis is better suited for exploration in a future study. Given this, we have moved this out of the results section into the Discussion section titled “HSD and fat-specific PECT-KD causes changes to phospholipid profile” (See excerpt below from page 13, lines 24-35).

      “In addition to changes in phospholipid classes, we found that HSD caused an increase in the concentration of PE and PC species with double bonds (Figure S4C and S4D). Double bonds create kinks in the lipid bilayer, leading to increased lipid membrane fluidity which impacts vesicle budding, endocytosis, and molecular transport14,92. Hence it is possible that a mechanism by which HSD induces changes to signaling is by altering the membrane biophysical properties, such as by increased fluidity, which would have a significant impact on numerous biological processes including synaptic firing and inter-organ vesicle transport.”

      Also, as per the reviewer’s guidance, given that we are speculating here, we have also shifted this dataset from Main figure 4 to supplement S4C and S4D.

      In addition, lines 25-30 state that FFAs are increased after 14 days of a HSD. Figure 3A shows the exact opposite - FFAs are significantly decreased in 14 day fed animals despite being elevated in the 7 day fed animals. This is an interesting result that warrants discussion. Moreover, I would encourage to examine the lipidomic data more carefully to ensure that the text accurately portrays the lipid profiles.

      We apologize for misstating that FFAs are decreased on 14-day HSD in the lines 25-30. It was an error and we have corrected this. We agree with the reviewer that the reduction of FFA on Day 14-HSD is an intriguing and unexpected observation that needs to be emphasized and further discussed. To this end, we have added figure S4B, wherein we have provided the difference in FFA concentration (by species) after days 7 and 14.

      Furthermore, we have discussed what the potential meaning of reduced FFA at Day 14 implies in page 12, lines 19-27 of the Discussion section titled “HSD and fat-specific PECT-KD causes changes to phospholipid profile”. We have stated the following-

      “We speculate that this reduction in FFA maybe due to their involvement in TAG biogenesis (PMID: 13843753). We were interested to see if the decrease in FFA correlated to a particular lipid species, as PE and PC are made from DAGs with specific fatty acid chains. However, further analysis of FFAs at the species level did not reveal any distinct patterns. The majority of FFA chains decreased in HSD, including 12.0, 16.0, 16.1, 18.0, 18.1, and 18.2 (Figure S4B). This data was more suggestive of a global decrease in FFA, likely being converted to TAG and DAG, rather than a specific fatty acid chain being depleted.”

      The processed lipidomics data should also be included as supplementary data table so that they can be independently analyzed by the reader.

      We thank the reviewer for this suggestion. As per the reviewers request, we have included the raw data as an attachment in our supplementary material (Supplementary Files 1-3.), so that interested readers can use the datasets generated in this study for future work and further analysis.

      Beyond these experimental suggestions, the manuscript needs significant editing for clarity. While I won't provide a comprehensive list, the authors need to provide accurate descriptions and annotation of genotypes (including w[1118], which is written as W1118), typos, and formatting. I've listed a few examples below:

      1. Page 3, Line 1 and 2: "...have been shown to impact feeding behavior and metabolism that leads to..." This is an awkward and grammatically incorrect sentence.
      2. Page 3, Lines 7-32 is one very large paragraph but contains concepts that should be broken down over at least three paragraphs.
      3. Page 3, Line 25: A description of the reaction catalyzed by Pect would be helpful for a manuscript focused on Pecte activity.
      4. Page 4, Line 10: "previously characterized method of eliciting diet induced feeding behavior." As stated in the text, the method is previously described yet the manuscript characterizing the method isn't cited.
      5. Figure legend 3 contains a random assortment of capitalized lipid species. Also, the names of lipid species are inappropriately broken into multiple names. Please use correct nomenclature throughout the manuscript.

      The list above is nowhere near comprehensive. The manuscript requires significant editing.

      We are grateful to the reviewer for drawing our attention to these errors. We have made significant edits to the revised manuscript to address the above-mentioned concerns, as well as made additional textual changes throughout and copyedited it. We hope that the reviewer will find the manuscript reads better and the clarity and preciseness is significantly improved.

      Reviewer #2 (Significance (Required)):

      I find the study to be potentially very important - the authors combine a longitudinal study that would be difficult in any other model with the powerful genetic tools available in the fly. The findings will significantly advance our understanding of how lipid metabolism links dietary nutrition with feeding behavior.

      Once again, we are grateful for this reviewer’s thoughtful critique and encouraging words regarding our work and its potential impact.

      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      Summary: This manuscript uses Drosophila to investigate how diet-induced obesity and the changes in the lipid metabolism of the fat boy modulate hunger-driven feeding (HDF) response. The authors first demonstrate that chronic exposure (14 days) of high sugar diet (HSD) suppresses HDF response. Through lipidome analysis, the authors identify a specific class of lipids to be elevated upon chronic HSD feeding. This coincided with the changes in expression of Pect, an enzyme that regulates the biosynthesis of these lipids. Modulating the expression of Pect specifically in the fat body affected HDF response.

      We thank this reviewer for their rigorous and thoughtful critique and for identifying a key issue with our original study pertaining to a gap in how Pect mRNA levels on 14-day HSD are elevated but the Pect-KD phenocopies the HDF. Now by performing whole-body adult fly lipidomic on fat-specific Pect-KD we have resolved this issue and provided clarity on role of Pect in maintaining phospholipid homeostasis and thus subsequently impacts hunger-driven feeding. We hope the reviewer finds that the revised manuscript provides further clarity to the functional link between Pect’s role in fat-body and hunger-driven feeding.

      Major comments: The author claim that the HDF response in HSD is distinct between early (5d, 7d) and chronic (day 14) HSD feeding. However, the data seem to indicate that HDF response is significantly decreased at all time points in HSD. For example, at day 5 HDF response was increased only 3-fold in HSD (Figure 1C) compared to around 50-fold increase in NF (Figure 1B). The scale of the Y-axis in Figure 1B and 1C is an order of magnitude different. Including the starved data (NFstv and HSDstv) in Figure S1, normalized to NF fed group, would better visualize the overall trends. Related to this, having the source data for the actual number of feeding events would be useful (e.g., to see the baseline changes in feeding in different time points in Figure 1 and the effect of genetic manipulations in Figure 7).

      As per the reviewers request, we now have modified our graphs to show source data (Figure S1) and show the raw feeding events.

      Then in the non-normalized graphs we plot, over a longitudinal time course, baseline and hunger-driven feeding events (Figure 1B-D). We also show that HSD fed flies do not display increased baseline feeding (Figure 1D) suggesting that the effect we see on HDF are no clouded by increased baseline feeding.

      Yes, the reviewer makes an important point that HDF response on HSD fed flies is of a lower magnitude than NF fed flies. We think that is a biologically meaningful observation, as it suggests that flies have a remarkably fine-tuned ability to coordinate food-intake with nutrient store levels.

      ­­Now we have included a paragraph in the Discussion, Page 11 Lines 23-27, that say the following to ensure the readers appreciate this salient point raised by this reviewer.

      *It is to be noted that the HDF response of HSD-fed flies (Figure 1C, Days 3-10) is of lower order of magnitude than the NF-fed flies. This suggests that that in addition to sensing an energy deficit and mobilizing fat stores (Figure 1F, 1G, S1), HSD fed flies calibrate their starvation-induced feeding to compensate only for the lost amount of fat. Overall, this suggests that flies have a remarkably fine-tuned ability to coordinate food-intake with nutrient store levels. *

      The association between fat body Pect level and phospholipid levels is not clear. Day 14 of HSD feeding shows high expression of Pect in the fat body and elevated levels of PC32.0 and PC32.2. The authors assume the high expression of Pect in the fat body is due to the compensatory response, but there are no data indicating downregulation of Pect levels at the earlier time points of HSD feeding. A previous study demonstrated that Pect mutant flies have lower levels of PC32.0 but higher PC32.2 (PMID: 30737130).

      We agree that one puzzling aspect of the original version of this study was that Pect mRNA levels being very high on Day 14 HSD, but nonetheless the effects of Pect-KD phenocopied HSD. To resolve this, prompted by Reviewer #2 and #3 concerns, for this revised version we have now performed lipidomic analyses on whole adult flies, when Pect is knocked down (KD) by RNAi in the fat tissue. We now present a new dataset in Figure 6. Two striking changes occu. They are:

      1. Pect-KD shows increase in the phospholipid classes LPC and LPE (Figure 6A). In contrast, LPE is significantly downregulated on HSD Day 14 (Figure 3).
      2. Pect-KD shows a significant reduction in specific class of PE 36.2 (Figure 6B). Our data regarding increase in PE 36.2 agree with a previous lipidomic analyses of Pect mutant retina (PMID: 30737130). In contrast, PE 36.2 trends upwards on 14 day HSD (Figure S7C) though not significantly. On 14-day HSD consistent with extreme upregulation of Pect mRNA fed flies (Figure S6A; Pect mRNA 200-250 fold), PE trends upwards on 14-day HSD (Figure 3) and PE 36.2 trends higher (Figure S7C). We note that on the surface of it PE and LPE per se are contrasting between 14-day HSD lipidome and fat-specifc Pect-KD. But there is a significant commonality that under both states there is an imbalance of phospholipids classes PE and LPE. Hence, we propose that maintaining the compositional balance of phospholipid classes PE and LPE is critical to hunger-driven feeding and insulin sensitivity. Hence, either increase or decrease, of these key phospholipid species, may lead to abnormal hunger-driven feeding.

      On day 14, HDF response was increased 70-fold in w1118 flies in NF (Figure 1B; w1118), but only 2.5-fold in lpp>LucRNAi control flies in NF (Figure 7A). This suggests that lpp-gal4 driver lines have a significant effect on HDF response. Using a different fat-body specific Gal4 line would be necessary to validate conclusions.

      Regards reduced HDF magnitude, in our experience using UAS-Gal4 reduces HDF response magnitude consistently and cannot be compared to w1118 which is more robust. To account for background differences, we use Uas-Gal4 with control RNAi. It clearly shows differences in HDF response on starvation, but Pect and Pisd RNAi does not (Figure 7A). Hence, given that this experiment internally controls for any changes in HDF response for UAS-Gal4>RNAi, we conclude that HDF response in disrupted in Pect and PISD KD (Figure 7).

      We only presented the Lpp-driver in our study, as this driver is the only fat-specific driver that has no leaky expression in other tissues, and is specific to fat as apolpp promoter used to generate this Gal4 line is only expressed in fat tissue (Eaton and colleagues, PMID: 22844248). Other widely used fat-specific drivers, including the pumpless-Gal4 (ppl-Gal4) driver has leaky expression in gut or other tissues (See Table 2 of this detailed study by Dr. Drummond- Barbosa https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7642949/). If the reviewer is aware of a fat-specific Gal4 line, other than Lpp-Gal4, which has a highly specific expression in the fat tissue without leaky expression in other tissues, then we are happy to take onboard the reviewer’s suggestion and try that fat-specific Gal4 that they suggest.

      HSD feeding promotes Pect expression (Figure S3C) and global changes in phospholipid levels (Figure 3, 4). Therefore, shouldn't Pect overexpression (not Pect RNAi) in a normal diet mimic HSD feeding state and promote loss of HDF response? Conversely shouldn't knockdown of Pect in HSD rescue loss of HDF response?

      We agree that a puzzling aspect is that Pect mRNA levels are significantly elevated in HSD Day-14, but Pect-KD showed displays the inappropriate HDF response. As we have described in our response to this reviewer on Page 19, we believe that Pect-KD and HSD disrupt PE and LPE balance overall but in different ways. Whereas Pect-OE using cDNA expression in fat body does not cause a significant change to any lipid class (Figure S9), and our results suggest that basally higher level of PECT is likely to be protective on HSD with respect to HDF(Figure 7B).

      To ensure that we appropriately discuss and clarify this issue, we have now included a section in the discussion - Page 14 Lines 26-33- under the subtitle “The implications of relationship between Pect levels and HSD”. We have pasted an excerpt from that subsection below for this reviewers assessment.

      “Also, we note that over-expression of Pect cDNA in the fat-body does not alter phospholipid balance (Figure S9) and indeed improves HDF on HSD (Figure 7B). While this may appear inconsistent, it is critical to note that over-expression of Pect cDNA using UAS/Gal4 only increases Pect mRNA expression by 7-fold (Figure S6A), whereas HSD causes its upregulation by 250-fold (Figure S6B). Hence, we speculate that an increased ‘basal’ level of Pect such as by that provided by a cDNA over-expression in fat, may be protective to the negative effects of HSD (Figure 7B) without affecting overall phospholipid levels (Figure S9) , but extreme upregulation Pect on HSD affects the PE and LPE balance (Figure 3).”

      We would have liked to test Pect protein expression on HSD, but since we were unable to access antibodies for Pect published in a prior study (PMID: 33064773) from Dr. Wang’s lab (see Page 10-11, of response to Reviewer #1). Hence, we were unable to test how the proteins levels of Pect correlate with the 250-fold increase mRNA expression.

      In conclusion, we hope the reviewer appreciates that our results regarding Pect function are consistent with the main conclusion that achieving the right phospholipid balance between PE and LPE, is critical for an organism to display an appropriate HDF response.

      Minor comments: All graphs should plot individual data points and showed as box and whisker plot as much as possible.

      Thanks for this suggestion, we have added individual data points to the vast majority of figures in the paper. We have made exceptions to graphs such as seen in figure 1 and FigureS4B-D where we find individual data points add an unnecessary layer of complexity. We hope these changes provide additional clarity and strength to the claims made in this manuscript.

      Data for day 14 missing in Figure S4A and S4B.

      We have provided Day 14 for the PC composition and PE composition, due to changes in Figures, they are now S7A and S7B.

      Reviewer #3 (Significance (Required)):

      The interactions between diet-induced obesity, peripheral tissue homeostasis and feeding behavior is an interesting topic that can be addressed using Drosophila. This manuscript demonstrates how fat body Pect levels affect HSD induced changes in hunger-driven feeding response. However, at this point, the functional association between fat body Pect level, global phospholipid level, and loss of hunger-driven feeding response in chronic HSD feeding is not clear.

      We hope the revised data, and discussion of the paper, provides well-substantiated functional association on the importance of maintaining phospholipid balance, driven by Pect enzyme, as a critical regulator of hunger-driven feeding behavior. As stated in the revised discussion, the key take home message of our manuscript is that on prolonged HSD exposure PC, PE and LPE levels are dysregulated, the loss of phospholipid homeostasis coincided with a loss of hunger-driven feeding. Following this lead on phospholipid imbalance, we then uncovered a critical requirement for the activity of the rate-limiting PE enzyme PECT within the fat tissue in controlling hunger-driven feeding.

    1. Reviewer #1 (Public Review):

      The work, mostly performed in yeast S. cerevisiae, shows that the knockout of DIP2 leads to accumulation in cells of some DAG subspecies (36:0 and 36:1), and also a deficit of similar TAG subspecies (something which mostly occurs, as they showed, in early to mid log growth phase). Accordingly, over-expression of DIP2 leads to the opposite outcome (lower DAG and higher TAG subspecies levels). ∆DIP2 cells showed increased ER stress and UPR, which can be counterbalanced by incubating cells with oleic acid. Moreover, the authors show that the absence of DIP2 causes vacuole fusion defects, which they ascribe to a localization of the protein in the vacuole and possibly to the fact that enhanced levels of DAG in the vacuole membrane can promote vacuole fusion. Although it is true that neither of these claims are fully supported by the experimental results, the data that the authors show serves as a starting point for future, more robust studies to test those claims. Finally, the authors show that the DBD1 domain is not necessary and that the two FLD domains are key for the observed lipid metabolism induced by DIP2 expression. Altogether this manuscript presents interesting new data on an uncharacterized protein that seems to be regulating the metabolism of relatively low abundant DAG/TAG subspecies in cells, and by doing so possibly control cell homeostasis.

    2. Reviewer #3 (Public Review):

      This study examines a family of poorly defined enzymes that contain fatty acyl-AMP ligase like domains (FAALs). The study reveals that these DISCO-interacting protein 2 (DIP2) enzymes are required to maintain a specific pool of diacylglycerol (DAG) lipids containing primarily C36 acyl chain lengths in budding yeast. Using primarily yeast, the study shows that deletion of ScDIP2 significantly increases C36 DAG pools while leaving the more abundant C32 and C34 DAG pools generally unaltered. Triglyceride (TAG) is also reduced in this deletion. Conversely, ScDIP2 over-expression promotes C36 inclusion in TAG. The ScDIP2 KO yeast manifests ER stress that can be relieved by the addition of oleic acid, but not other fatty acids. In the last section of the study, ScDIP2 is proposed to localize to the vacuole and mitochondria, where it maintains a specific DAG pool to enable proper vacuole morphology and fusion, as well as proper osmoregulation of the vacuole.

      This is a well executed study that begins to characterize a conserved and generally poorly understood family of enzymes. However, questions still remain about some of the conclusions of the study. There are two general issues with the study. The first is the specificity of the effect of loss of ScDIP2. The study beautifully shows that loss of ScDIP2 (or its over-expression) affects a specific sub-pool of DAG (mainly the C36 species). TAG levels are also somewhat lower. However, how ScDIP2 impacts other lipid precursors to DAG synthesis such as PA and lyso-PA is under-examined, and should be looked at as they can also affect ER stress. Whether the change in DAG/TAG is primarily driven by decreased synthesis versus increased lipolysis also required additional analysis.

      The second issue relates to how ScDIP2 relates to the yeast vacuole. It is proposed that some of the ScDIP2 enzyme is vacuole localized, and influences vacuole morphology. The evidence presented here does not strongly support that model. From imaging at least, it appears that ScDIP2 is primarily mitochondria localized. It is therefore possible that it influences vacuole lipid composition and morphology distally from the mitochondria. Resolving ScDIP2's native subcellular localization would strengthen the manuscript.

    1. Machine Tags

      A new kind of tags — machine tags — are supported now. A machine tag, e.g. meta:language=python consists of a namespace (meta), a key (language) and a value (python). Everyone can created machine tags, but the meta: namespace is protected and tags in there will be created by the site itself.

      The codesite itself uses machine tags to make various properties of recipes accessible to the search:

      • meta:language

        The programming language of the recipe, e.g. python, perl or tcl.

      • meta:min_$lang_$majorver

        Those tags describe the minimum language version. If a recipe requires Python 2.5 it would have the tag meta:min_python_2=5.

      • meta:license

        The license that was selected by the author, e.g. psf, mit or gpl.

      • meta:loc

        This tag contains a number describing the lines of code in a recipes. It counts only the number of lines in the code block but not any lines in the discussion of in comments. This makes it possible to search for short recipes with less than ten lines or very large ones.

      • meta:score

        The current score of the recipe. This is the same number that is displayed besides the recipe title and can only be influenced by voting on recipes. That way you could even search for down-voted recipes

      • meta:requires

        Stores information about additional requirements of the recipes, e.g. required python modules. You can find recipes using python's collections module that way.

      All those tags cannot be changed directly because they are generated from a recipe's properties.

    1. Your JavaScript, for the most part, is run whenever the JS file is run, or when the script tag is encountered in the HTML. If you are including your JavaScript at the top of your file, many of these DOM manipulation methods will not work because the JS code is being run before the nodes are created in the DOM. The simplest way to fix this is to include your JavaScript at the bottom of your HTML file so that it gets run after the DOM nodes are parsed and created.

      Sometimes you want the javascript to run after, so make sure to add "defer" in the <script src"js-file.js" defer></script>

    2. document.createElement(tagName, [options]) creates a new element of tag type tagName.

      const div = document.createElement("div")

      that will NOT put the element in the DOM, it just creates the possibility of it. You gotta put it manually.

    1. SciScore for 10.1101/2022.05.07.491022: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Contamination: Reagents: Cell lines: All cells were maintained in Dulbecco’s modified Eagle medium (DMEM) supplemented with 10% fetal calf serum (FCS), 100 U ml−1 penicillin and 100 mg ml−1 streptomycin and regularly tested and found to be mycoplasma free.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-rabbit IgG, HRP-linked Antibody (7074); Cyclin D3 Mouse mAb (DCS22, 2936); from Cell Signaling.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-rabbit IgG</div><div>suggested: (Cell Signaling Technology Cat# 7074, RRID:AB_2099233)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Goat anti-Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody: Alexa 488 (A-11001), Alexa 594 (A-11032), Alexa 647 (A-21236); Goat anti-Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody: Alexa 488 (A-11034), Alexa 405 (A-48254); Rabbit polyclonal SARS-CoV-2 Spike (PA1-41165); Rabbit monoclonal SARS-CoV-2 Nucleocapsid (MA5-29982) from Thermo Fisher Scientific.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Mouse IgG</div><div>suggested: (Thermo Fisher Scientific Cat# A-11001, RRID:AB_2534069)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Rabbit Polyclonal Cyclin A2 antibody (GTX103042); Rabbit Polyclonal Cyclin D1 antibody (N1C3, GTX108824); Rabbit Polyclonal Cyclin E1 antibody (GTX103045); Rabbit Polyclonal Cyclin B1 antibody (GTX100911); monoclonal SARS-CoV-2 Spike (GTX632604) from GeneTex.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Cyclin A2</div><div>suggested: (GeneTex Cat# GTX103042, RRID:AB_1949884)</div></div><div style="margin-bottom:8px"><div>Cyclin D1</div><div>suggested: (GeneTex Cat# GTX108824, RRID:AB_10618686)</div></div><div style="margin-bottom:8px"><div>Cyclin E1</div><div>suggested: (GeneTex Cat# GTX103045, RRID:AB_10731259)</div></div><div style="margin-bottom:8px"><div>Cyclin B1</div><div>suggested: (GeneTex Cat# GTX100911, RRID:AB_1949886)</div></div><div style="margin-bottom:8px"><div>GTX632604</div><div>suggested: (GeneTex Cat# GTX632604, RRID:AB_2864418)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">pre-cleared cell lysates were incubated with a-HA magnetic beads, MagStrep beads (IBA-Lifescience, Gottingen, Germany) or anti-cyclin D3 monoclonal antibody (sc-xx) bound Protein G Dynabeads for 1h at 4°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-cyclin D3</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Following cells were a gift from: A549 ACE2/TMPRSS2 40 Massimo Palmerini, Vero E6 ACE2/TMPRSS2 from Emma Thomson, HeLa-ACE2 from James Voss, 293T (a human embryonic kidney cell line, ATCC CRL-3216).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">293T GFP11 cells and Vero-GFP10 cells for Split GFP assay were a gift from Leo James41.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T GFP11</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Vero-GFP10</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">293Tv cells were transfected with pEXN-MNCX-Fucci, CMVi and pMD2.G.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293Tv</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmids: pBOB-EF1-FastFUCCI-Puro was a gift from Kevin Brindle & Duncan Jodrell (Addgene plasmid # 86849 ; http://n2t.net/addgene:86849 ; RRID:Addgene_86849) 29. pCMV5 cyclin D3 HA was obtained from MRC-PPU Reagents and Services. Rc/CMV cyclin D1 HA was a gift from Philip Hinds (Addgene plasmid # 8948 ; http://n2t.net/addgene:8948 ; RRID:Addgene_8948) 44. pLVX-EF1alpha-SARS-CoV-2-E-2xStrep-IRES-Puro (Addgene plasmid # 141385 ; http://n2t.net/addgene:141385 ; RRID:Addgene_141385); pLVX-EF1alpha-SARS-CoV-2-M-2xStrep-IRES-Puro (Addgene plasmid # 141386 ; http://n2t.net/addgene:141386 ; RRID:Addgene_141386).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_86849)</div></div><div style="margin-bottom:8px"><div>pCMV5</div><div>suggested: RRID:Addgene_15002)</div></div><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_8948)</div></div><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_141385)</div></div><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_141386)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">pLVX-EF1alpha-SARS-CoV-2-nsp9-2xStrep-IRES-Puro (Addgene plasmid # 141375 ; http://n2t.net/addgene:141375 ; RRID:Addgene_141375); pLVX-EF1alpha-SARS-CoV-2-N-2xStrep-IRES-Puro (Addgene plasmid # 141391 ; http://n2t.net/addgene:141391 ; RRID:Addgene_141391) were a gift from Nevan Krogan 34. pEXN-MNCX, MLV vector encoding N-terminal double HA tag 45.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_141375)</div></div><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_141391)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">pCAGGS_SARS-CoV-2_Spike was obtained from NIBS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAGGS_SARS-CoV-2_Spike</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell cycle analysis using fluorescence ubiquitination cell cycle indicator (Fucci): Fucci cassete was cloned from pBOB-EF1-FastFucci-Puro vector to pEXN-MNCX using BamHI/NotI restriction sites.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pEXN-MNCX</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">293Tv cells were transfected with pEXN-MNCX-Fucci, CMVi and pMD2.G.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pEXN-MNCX-Fucci</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pMD2.G</div><div>suggested: RRID:Addgene_12259)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell to cell fusion assay: 293T GFP11 cells were transfected with WT full length Spike, and/or with WT Envelope, Membrane, cyclin D3, and empty vector (pCDNA, to ensure equal amount of transfected DNA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCDNA</div><div>suggested: RRID:Addgene_66792)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Harmony (PerkinElmer, Waltham, MA, USA) and ImageJ software were used to measure MFI for each protein in each region.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell populations positive or negative for SARS-CoV-2 nucleocapsid staining were gated and Cdt1-RFP positive (G1 phase), Geminin-GFP positive (S/G2/M phase), and Cdt1-RFP/ Geminin-GFP positive (early S phase) populations were identified using flow cytometry using LSRFortessa X-20 (BD Biosciences, UK) and FlowJo software (Tree Star, OR, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      1. General Statements [optional]

      We would like to thank the reviewers for their helpful and constructive comments.

      2. Point-by-point description of the revisions

      Reviewer #1

      This reviewer thought our findings would be of interest to a broad range of scientists from both the centrosome and mitosis fields, but noted some important aspects for improvements.

      Additional Experiments (we number these points for ease of discussion).

        • Figure 3. The reviewer points out that because our analysis of Ana2-∆CC and Ana2-∆STAN mutant proteins was conducted in the presence of endogenous WT protein, we should be more cautious in our interpretation.* We agree and apologise for overstating these findings. We have now rewritten the title and text of this section to be more cautious (p11, para.2)
      1. Figure 5A. The reviewer wonders whether the reduced recruitment of Sas-6 in the presence of Ana2(12A) is due to reduced binding, and they request we test this biochemically. This is our favoured interpretation, but we have been unable to test this biochemically for two reasons. First, although we have successfully purified several recombinant Sas-6 and/or Ana2 fragments (Cottee et al., eLife, 2015), the full-length proteins are poorly behaved (tending to precipitate, likely due to their inherent ability to self-oligomerise). Thus, we have been unable to reconstitute their interaction in vitro*. Second, as we show here, the proteins are normally expressed in embryos at surprisingly low concentrations (~5-20nM), and we can detect no interaction between them in coimmunoprecipitation experiments from embryo extracts (not shown). Indeed, this concentration is so low that Sas-6 does not even appear to form a homo-dimer in the embryo, even though Sas-6 clearly functions as a homo-dimer in centriole assembly (new Figure S4A). We now explain these points, and state that our favoured hypothesis that Ana2(12A) has reduced affinity for Sas-6 (or other core duplication proteins) remains to be tested (p22, para.2).

      2. The Reviewer wonders if all 12 of the potential Cdk1 phosphorylation sites that we mutate in Ana2(12A) are important in vivo, and whether we have tested whether mutating fewer sites (e.g. the two sites [S284/T301] that we show are phosphorylated by Cdk1/Cyclin B in vitro) might be sufficient to recapitulate the Ana2(12A) phenotype. *We have now tested this by mutating just the S284/T301 sites to Alanine [Ana2(2A)], but the results were not very informative (Reviewer Figure 1 [RF1]). Whereas Ana2(12A) is recruited to centrioles for a longer period and to higher levels than WT Ana2 (Figure 4A), Ana2(2A) is recruited to centrioles for a normal period but to lower levels (RF1A,B). The interpretation of this result is complicated because western blots show that Ana2(2A) is also present at lower-levels than normal (RF1B). Thus, it is clear that Ana2(2A) does not recapitulate well the behaviour of Ana2(12A). We have decided not to present this data as it is difficult to interpret and it does not change any of our conclusions.

      3. Figure 6. The reviewer asks whether the 12A mutations impair the interaction with Plk4, influence Plk4’s kinase activity or the ability of Plk4 to phosphorylate Ana2. These are excellent questions but, for the same reasons described in point 2 above, we cannot address them biochemically as we cannot purify well-behaved recombinant full-length Ana2 or active Plk4 in vitro, and both proteins are present at such low levels in the embryo that we cannot detect any interaction between them in embryo extracts. We are working hard to reconstitute in vitro* systems to probe these important points, but it may be sometime before we are able to do so.

      4. Figure 7. The reviewer suggests that the 12D/E phosphomimetic substitutions introduce more negative charge than the putative phosphorylation of Ser/Thr residues and they ask if the Ana2(2D/E) [stated as Ana2(3D/E)] is, like the Ana2(12D/E) mutant, not efficiently recruited to centrioles.* This is a fair comment, but we have not analysed an Ana2(2D/E) mutant because, as described in point 3 above, the Ana2(2A) mutant did not recapitulate well the Ana2(12A) phenotype.

      Minor comments

        • Figure S1. The reviewer requests that we show that the mNG tag on its own is not recruited to centrioles.* We do not show this (as it would create a lot of white space in this Figure), but now state that mNG and dNG do not detectably localise to centrioles (p7, para.1).
        • Figure S4C.* We have included the missing error bars (now Figure S4B).
        • Figure S5A. The reviewer asks about the expression levels of the Ana2(12A) mutant, which are not shown in this Figure. They also state that the expression levels of the transgenes shown in Figure 5A are not similar.* The expression level of Ana2(12A) is shown in Figure S9, as this data was analysed independently of the other mutant proteins shown in Figure S5. We agree that it was overly simplifying the situation to state that the expression levels of WT Ana2-mNG, eAna2(∆CC)-mNG and eAna2(∆STAN)-mNG were “similar” (Figure S5), and we now specifically mention the differences between them (p11, para.3). Reviewer #2

      This reviewer found this a rigorous study that advances our understanding of the regulation of centriole duplication, but raised some minor points.

      Minor Points

      The reviewer requests that we mention the literature describing how Ana2/STIL can influence the abundance and centriolar localisation of Plk4. We apologise for this omission, and have amended our description of this literature in the Introduction to include this point (p3, para.2).

      The reviewer notes that we interpret the ability of the Ana2(12A) mutant to keep incorporating into the centrioles for a longer period as being consistent with our idea that rising levels of Cdk activity during S-phase normally reduce the ability of WT Ana2 to bind to the centriole. They ask us to show how Cdk activity increases over this time-course, and to test whether dampening Cdk has the same effect on Ana2 recruitment (i.e. allows Ana2 to be recruited for a longer period). The time-course of Cdk activation in these embryos has been reported previously (Deneke et al., Dev. Cell, 2016; we present the relevant data from this paper in RF#2A [black line]). This reveals how Cdk activity rises throughout S-phase, which is crucial for our model. To assess the effect of dampening Cdk activity in these embryos we have now analysed the effect of halving the genetic dose of Cyclin B (RF#2B). This perturbation extends S-phase length, but has a complicated effect on the recruitment dynamics of Ana2 (RF#2B). As we would predict, Ana2 is recruited to centrioles for a longer period in these embryos, but it is also recruited more slowly (so it accumulates to lower levels). This is consistent with our hypothesis that Cdk1 activity might first stimulate and then ultimately inhibit the centriolar recruitment of Ana2. The interpretation of this experiment is not straightforward, however, as dampening Cdk1 activity alters Ana2 recruitment dynamics (and many other processes in the embryo) in complicated ways, so we have decided not to include it in the manuscript.

      The reviewer suggests that it would be valuable to show that all 12 of the potential Cdk1 phosphorylation sites in Ana2 can be phosphorylated by Cdk1 in vitro. We think this would not be particularly informative as our hypothesis does not rely on all 12 sites being phosphorylated to generate the Ana2(12A) phenotype. We simply mutate all 12 sites because we don’t know which, if any, are relevant. Thus, showing that some/all of the 12 sites can/cannot be phosphorylated in vitro does not test any hypothesis and would not change any of our conclusions. We now explain our thinking on this in more detail (p12, para.2)

      Other points

      Figure 3. We have corrected the amino-acid numbering mistakes.

      Figure 5Aii. We have changed the x-axis (time) labelling in this and all other Figures.

      Figure Legends. We have tried to eliminate the typos from the Figure legends, and apologise that these errors made it through to the final submitted version of our manuscript.

      Reviewer #3

      This reviewer thought our manuscript would be of great interest to not only the centrosome field but also to cell biologists more generally. Although they had no major concerns, they made a number of suggestions for improvements.

      1. As the reviewer suggests, we now explicitly state that although the Ana2(12A) mutant appears to be largely functional, the overall conformation of the protein may be altered, changing its function in ways we do not appreciate (p21, para.2).

      2. The reviewer suggests we include a multiple sequence alignment of Ana2/STIL proteins to provide more context about the distribution and conservation of the 12 S/T-P sites mutated in Ana2(12A).* This is an excellent idea, and we now include this in a new Figure S6, where we also provide more information about which of these sites have been shown to be phosphorylated in embryo or S2-cell extracts

      3. The reviewer is confused as to why the 12A and 12D/E mutants rescue the ana2-/- mutant flies so well, which suggests that the mechanism we propose here cannot be essential for centriole duplication. We understand this confusion and we now make this point more clearly and explain why we think this occurs in more detail (e.g. p22, para.1). We propose that Cdk normally phosphorylates Ana2 to inhibit its ability to promote centriole duplication, but this phosphorylation does not entirely block this function. So, if all other elements of the system are functional, Ana2(12A) is recruited to centrioles for longer than normal, but this does not dramatically perturb centriole duplication because the many other factors that regulate centriole duplication (such as the pulse of Plk4 recruitment to centrioles [Aydogan et al., Cell, 2020]) still occur normally and are sufficient to ensure that centrioles still duplicate normally. When Ana2 phosphorylation is mimicked [Ana2(12D/E)], the ability of Ana2 to promote centriole duplication is perturbed (but not abolished). This perturbation is lethal in the early embryo—where the centrioles must duplicate in just a few minutes to keep pace with the rapid nuclear divisions. In somatic cells S-phase is much longer, so these cells can still duplicate their centrioles (as we observe) even though Ana2(12D/E) does not function efficiently. As we now explain, this phenotype (being lethal in the early embryo, but not in somatic cells) is a common feature of mutations that influence the efficiency* of centriole and centrosome assembly (p17, para.2).

      4A. The reviewer asks us to comment in more detail on why centrioles do not seem to be elongated in the Ana2(12A) mutant wing disc cells (now Figure S8C), even though we show that Ana2(12A) (Figure 4A), and also Sas-6 (Figure 5), are recruited to centrioles for an abnormally long period. This is an excellent question and, although we do not know the answer, we now discuss this interesting point in more detail (p16, para.1). We think this is likely due to the “homeostatic” nature of centriole growth: in our hands, almost any perturbation that makes centrioles grow for a longer/shorter period, also makes them grow more slowly/quickly, so that they tend to grow to a similar size (Aydogan et al., JCB, 2018; Cell, 2020). This is fascinating, but poorly understood. When we perturb the system by expressing Ana2(12A), both Ana2(12A) and Sas-6 incorporate into centrioles for a longer period, as we predict (Figure 4A and 5A). Unexpectedly, however, Sas-6 is also recruited to centrioles much more slowly. Thus, as so often happens, when we perturb the system so the centrioles grow for a longer time, the centrioles “adapt” by growing more slowly. We do not currently understand why this occurs (although we speculate that Ana2 may also be regulated by Cdk/Cyclins to help recruit Sas-6 to centrioles in early S-phase). In the embryo, where S-phase is very short, this homeostatic compensation is not perfect, and the centrioles appear to actually be shorter than normal. In somatic wing-disc cells, where S-phase is much longer, we suspect that there is more scope for homeostatic compensation and so the centrioles grow to the correct size.

      4B. In this point (also labelled [4] by the reviewer, so we have retained this numbering but labelled the points A and B) the reviewer asks why levels of Ana2(12A) eventually decline at centrioles once the embryos actually enter mitosis. The reviewer notes our rheostat theory, but suggests a discussion of other mechanisms might be interesting. This is a good point, and we agree that the observation that Ana2(12A) levels ultimately still decline at centrioles during mitosis is likely to be important in explaining why centriole duplication is not more dramatically perturbed by Ana2(12A). We now expand our discussion of this point, highlighting that other mechanisms must help to ensure that Ana2 is not recruited to centrioles during M-phase, and discussing the possibility that the receptors that recruit Ana2 to centrioles are themselves inactivated during mitosis by high levels of Cdk activity (p15, para.1). In such a model, the rapid drop in WT Ana2 centriolar levels is due to a combination of switching off Ana2’s ability to bind to centrioles (as we propose here) and switching off the ability of the centrioles to recruit Ana2. For Ana2(12A), only the latter mechanism would operate, so Ana2(12A) levels would start to drop later in the cycle (as the inflexion point at which Ana2 recruitment and loss balances out would be moved to later in the cycle), and these levels would drop more slowly—as we observe.

      • The reviewer is confused to how the Ana2(12D/E) mutant can rescue the mutant phenotype when it is recruited to centrioles so poorly. Ana2(12D/E) is indeed recruited very poorly to centrioles in the experiment shown in Figure 7. However, this experiment had to be conducted in the presence of WT untagged Ana2—as the embryos do not develop in the presence of only Ana2(12D/E). We would predict that WT Ana2 would bind more efficiently to centrioles than Ana2(12D/E) (which appears to behave as if it has been phosphorylated by Cdk/Cyclins, and so cannot be recruited to centrioles efficiently). Thus, in the experiment we show in Figure 7, the Ana2(12D/E) protein is probably being “outcompeted” for binding to the centriole by the WT protein. In somatic cells expressing only* Ana2(12D/E) presumably sufficient mutant protein can be recruited to centrioles to support normal centriole duplication (as it no longer has to compete with the WT protein). We now explain our thinking on this point (p18, para.1).

      • The reviewer wonders whether Ana2(12D/E) may be unable to homo-oligomerize, and this may explain why the protein is not recruited to centrioles efficiently even in the presence of WT protein. This is indeed a possibility, but we think it unlikely as it is widely believed that Ana2/STIL proteins must multimerize to be functional (Arquint et al., eLife, 2015; Cottee et al., eLife, 2015; Rogala et al., eLife, 2015; David et al., Sci. Rep., 2016). As Ana2(12D/E) strongly restores centriole duplication in ana2-/-* mutant somatic cells, it seems unlikely that it cannot multimerize. Nevertheless, we now specifically highlight that the 12D/E (and 12A) mutations might alter the ability of Ana2 to multimerise (p21, para.2).

      We thank the reviewers again for their thoughtful and constructive comments. We hope they will agree that the revised manuscript is now improved and would be appropriate for publication in The Journal of Cell Biology.

      With best wishes,

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      Centriole duplication is a conserved pathway that need to be tightly regulated. The key enzyme of centriole assembly is Plk4 which is recruited to the centrioles and undergoes dynamic re-localization from a ring-like pattern around a centriole to a dot-like morphology at the daughter centriole assembly site. This event is central for inducing centriole biogenesis. Plk4 then phosphorylates Ana2/STIL which allows recruitment of Sas-6 to form the cartwheel structure for centriole assembly.

      In the present study, Steinacker, Wong et al. monitor how cytoplasmic concentrations of the key proteins in centriole assembly, Plk4, Asl/Cep152, Ana2/STIL, Sas-6 and Sas-4/CPAP change during the centriole assembly process in the Drosophila embryo by using fluorescence correlation spectroscopy (FCS) and Peak Counting Spectroscopy (PeCoS). They find that their concentrations remain constant with exception of Ana2/STIL of which cytoplasmic diffusion rate increased at the end of S-phase and is dependent on phosphorylation by Cdk1/CyclinB. Phosphorylated Ana2/STIL blocks centriole duplication thus preventing premature initiation of centriole duplication in mitosis.

      Major comments

      The manuscript is interesting and very well written. Most of the experiments are carefully performed. However, there are some important aspects for improvements that are listed below

      Additional experiments:

      • Figure 3: the transgenic flies that were generated here, CC and STAN, still contain wild-type Ana2. So, the authors therefore need remove or dampen their claim that the change in Ana2's cytoplasmic diffusion does not depend on its interaction with Sas-6 (page 11).
      • Figure 5A: is the observed reduced recruitment of Sas-6 by Ana2(12A) due to a decrease in binding affinity? This should also be shown by analyzing protein-protein interactions between Ana2(12A) and Sas-6 biochemically.
      • The authors use an Ana2(12A) mutant which comprises putative Cdk1 phosphorylation sites that have been identified in Mc Lamarrah et al. JCB 2018. However, only three of them were phosphorylated by Cdk1/cyclin B in vitro (Fig. S6). Are all these 12 putative Cdk1 phosphorylation sites important in vivo? Did the authors generate the Ana2(3A) or the S284A/T301A mutants to see whether it can rescue the ana2-/- mutant phenotype similar to the 12A mutant? These might be sufficient to observe the phenotype.
      • Figure 6: is the interaction between Plk4 and Ana2(12A) impaired? Similarly, Plk4 activity and phosphorylation of Ana2(12A) by Plk4
      • Figure 7: Phosphomimetics, in this case 12 amino acid changes, have the disadvantage of introducing more negative charge than the phosphorylated residue. The Ana2/(12D/E)-mNG is not efficiently recruited to centrioles. Is effect also observed for the Ana2/(3D/E) mutant?

      Minor comments

      Figure S1: only mNG-tagged centriolar proteins are shown. An empty mNGtag or an mNG-tagged non-centriolar protein should be shown to exclude that the tag by itself shows centriolar localization or somehow affects the localization

      S4C: Sas6-mNG CPM error bars are missing for the 10min time point

      S5A: What are the expression levels of the Ana2(12A) mutant? The expression levels shown in this Figure are not similar.

      Significance

      Centriole duplication normally begins at the G1/S phase transition. An important question in the field is how premature centriole duplication in mitosis is prevented. The authors used fluorescence correlation spectroscopy (FCS) and Peak Counting Spectroscopy (PeCoS) to study the major conserved proteins in the centriole assembly pathwayq and found that only Ana2/STIL's cytoplasmic diffusion increases at the end of S-phase. It is known from the literature that Cdk1 prevent Plk4-STIL complex assembly in centriole biogenesis by directly competing with Plk4 for the CC domain of Ana2/STIL (Zitouni et al. Curr Biol 26, 1127-1137 (2016). However, Ana2/STIL can also bind to Plk4 via its conserved C-terminal region of STIL (Ohta et al., Cell Reports 11, 2018; McLamarrah et al., J Cell Biol 2018, 217, 1217-1231). The work by Steinacker, Wong et al. suggest that at least in fly embryos, growth of the daughter centriole is regulated though phosphorylation of Ana2 by Cdk1/CyclinB rather than binding. The findings described in this manuscript are interesting for a broad range of scientists from both the centrosome and mitosis fields

      Expertise of the reviewer: centriole biogenesis, structural and numerical centrosomal aberrations in disease

    1. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #1

      Evidence, reproducibility and clarity

      In this manuscript, Dantas and colleagues report that confinement is sufficient to restore G2/M transition in cells than can't adhere to their matrix. Exploring further the mechanisms involved, they show that confinement (dynamic cell compression) stimulates nuclear import of cyclin B1 and nuclear envelope permeability using cells in 2D culture. The authors observed that actomyosin contractility increases NE tension in cells preparing for prophase, leading to an increase in nuclear translocation of cyclin B1. However, a few inconsistencies between the data and the conclusion make the current report too preliminary for publication. It may require significant additional work to consolidate the authors' model.

      • The specific contribution of Nuclear Envelope tension. The authors conclude that confinement acts through increasing NE tension, although confinement may affect cytoplasmic signaling, which could contribute to G2/M transition. The authors should test whether compressing the nucleus versus compressing the cytoplasm have distinct effects on cyclin B1 nuclear translocation and G2/M, as it has been done by others when addressing nuclear mechanosensitive mechanisms (Elosegui-Artola et al. or Lomakin et al.). To consolidate their model, the authors should also test whether decreasing NE tension (independently of actomyosin tension) has opposite effect on G2/M (for example using LBR overexpression). Increase in nuclear membrane tension has been shown to trigger cPLA2 recruitment to the NE (Enyeidi et al, 2013; Lomakin et al. 2020), although the authors show here that confinement does not induce cPLA2 recruitment (but still increases NE tension figure 4G) in the absence of Rock activity or when the LINC complex is disrupted. This is surprising considering that confinement should increase NE tension independently of actomyosin contractility and should increase cPLA2 recruitment at the NE, unless in this case cPLA2 recruitment is not mediated by an increase in NE tension.
      • NPC transport versus NE permeability. The authors suggest that confinement increases cyclin B1 transport via NPC-mediated transport and rule out that confinement may affect NE permeability based on the absence of NE rupture using the INM marker lap2. However, the sample size for this observation is missing and NE permeability could be altered even in the absence of major INM rupture observed by confocal. The authors should use a reporter of nuclear permeability (fluorescent cytoplasmic marker or nuclear marker as previously used by Denais et al or, 2016 or Raab et al., 2016) to make sure that NE permeability is not affected by confinement. In addition, NPC function should be tested in parallel with other fluorescent reporter (such as NLS-GFP constructs) to test whether global NPC-mediated transport is changed during prophase (with or without confinement).
      • Effect of confinement on cyclin B transport (NEP) in adherent cells. In figure 1D, we can see that confinement enhances cyclin B1 nuclear translocation in cells adhering on fibronectin. Although it is unclear whether confinement has a significant effect in other figures, for example in figure 2F: DMSO is not significantly different from confiner+CDKi (same thing in 3i and 3j with Rock inhibitor and Kash construct). In these figures the untreated+confiner (or control in 3j) is missing, and the absence of difference between treated+confiner and control is puzzling. Either there is no difference between confiner and CDKi+confiner and it means there is no difference between control and confiner (surprising considering figure 1D); or there is a difference between CDKi+confiner and confiner, indicating that CDK inhibition affects confinement-induced cyclin B import. Both possibilities suggest that the authors should significantly revisit their model. In any case, all control (untreated, treated +/- confiner should be in all figures to avoid any misunderstanding).
      • Consequences of cPLA2 recruitment at the NE. The authors state that "Active cPLA2 then stimulates actomyosin contractility creating a positive feedback loop" But the NE is already unfolded and distance between NPR is increased before cPLA2 recruitment. Does PLA2 inhibition affect nuclear irregularity (or distance between NPC)? Or does cPLA2 impact cyclin B1 transport via a distinct mechanism? Did the author analyze CDK1 phosphorylation in presence of PLA2 inhibitor?
      • Robustness of the main observation. On page 4, the authors report that cells enter mitosis after 140 sec (+/- 80 sec) of confinement, although in the example showed in figure 1b, the cell enters at least 420 sec min after confinement, as we can see that the cell is already confined -420 sec (compressed shape) and NEP occurs at 0. Did the author showed a cell that was not included in their statistics? This would be very surprising considering the very low sample size used for this experiment (n=6 and 10). In addition, many observations have been made on small sample size (n=6 for figure 1) or/and not from independent experiments. The authors should increase their sample size and compare results from independent experiments to consolidate their model.
      • 2h shows nuclear signal (cyclin in grayscale), while 2e does not, why?
      • starting point to quantify cyclin entry is the lowest intensity, which may depend on many factors (and could be affected by experimental design). It would be necessary to have synchronized cells to homogenize the starting point of these experiments.
      • DN-KASH have been transiently transfected for single cell experiments, how does the authors unsure that cell observed are transfected? Does it have a fluorescent tag, if so which one?
      • "requires contact with external stimuli" or "that mechanical confinement is sufficient to overcome the lack of external stimuli." (page 4): external stimuli is vague here and it could be better to replace it with a more specific description

      Significance

      While the physiological relevance of these findings remain to be determined, the authors report an interesting observation that could have a significant impact in the field. The authors do not comment the potential overlap of their findings with other reports involving the LINC complex (Booth et al., ELife) or CDK-mediated actin remodeling (Ramanathan et al., NCB 2015) during prophase.

    1. Reviewer #3 (Public Review):

      Four decades after the seminal work of the Schekman's lab on the genetic identification of the core eukaryotic secretory machinery the molecular roles of the individual components have been largely characterized. Yet our understanding of how these components are organized to define processes is wanting, with notable controversies still hovering over at several levels of the secretory pathway, including the events that take place in the ER/Golgi interface, the transit across the Golgi, the biogenesis of secretory vesicles and the delivery, tethering and docking of these vesicles to the membrane. This manuscript mostly addresses the latest steps of this chain of events and makes some incursions into the biogenesis of vesicles at the TGN. It represents a serious and honest attempt to define the timeline of events that, driven by key components such as the Sec4 ras-in-brain (Rab) GTPase, its effectors myosin-5, Sro7 and the exocyst, its GEF, Sec2 and the prototypic Sec/Munc protein Sec1, a regulator of trans-SNARE complex formation, ultimately result in the tethering, docking and fusion of vesicles with the membrane of the polarized bud of the ascomycete yeast Saccharomyces cerevisiae. Tethering, as defined by light microscopy appears to be a robust process reproducibly lasting for five seconds, before fusion, as defined by the loss of vesicle components, takes place. Important evidence is provided that the exocyst is incorporated as an holo-complex to secretory vesicles. Overall, even though this work will likely suffer modifications and amendments as knowledge and technology progress, it will nevertheless become the reference blueprint around which any future work in the field will pivot.

      This work represents a very substantial advance in the field of exocytosis. Besides reporting with unmatched time resolution the tethering of vesicles with the membrane, it describes a herculean effort to gain mechanistic understanding of the process by using a score of genetic perturbations and fluorescent reporters. I feel that evidence that Sec3 travels with the exocyst rather than contributing a milestone for exocyst landing will be disputed, but this referee finds it as convincing as appealing. Nearly as important is the timing of Sec1 action in the fusion step. However, it is the delineation of a timeline that will make this paper a reference in the field.

      Understanding the technology for image acquisition is critical to appreciating the strengths of this MS (333 ms/Z-stack time point may be considered super-resolution - in the time dimension. Therefore, its description requires clarification in places. The experimental work is almost exclusively based on live microscopy using fluorescent proteins tagged by allelic replacement. The microscopy routine for single fluorophore analysis provides time series with a resolution of 3-5 fps that enables authors to resolve, using robust statistical tests, events separated by seconds. In this context, it is notable that dual-channel imaging appears to be made by sequential, not simultaneous, acquisition, which deserves a currently missing comment. Moreover, given the weight that image acquisition plays in this project, it might be described and justified better. The Materials and methods lack detail, for example, the laser lines & power used for excitation. This referee could not fully understand the routine of image acquisition, specifically, the continuous movement of the stage in the Z-axis as images are streamed (to the RAM or to the disk? the latter takes time, line 177); does it mean that Z-stepping is solely governed by the exposure time? The CCD camera penalizes pixel size (16 µm) at the expense of achieving outstanding quantum efficiency. The optical path includes a 100x objective and a 2x magnification lens to compensate for the large camera pixel size, thereby achieving 0.085 µm/pixel, but these lenses 'waste' part of the fluorescent signal. One wonders if the CMOS camera (6.5 µm pixel size) coupled with a 63x objective wouldn't be appropriate? A brief discussion on this choice would be helpful for readers.

      There is an elephant in the room of in vivo microscopy that no one dares to comment on: reporter proteins are mutant versions carrying a heavy and potentially oligomerising rucksack - the fluorescent protein tag. The authors take the honest approach of acknowledging that some of the tagged proteins such as Sec4 are disfunctional and that certain reporters are incompatible with each other as they give rise to synthetic negative effects. In the end, they conclude that using diploids carrying the GFP-tagged allele in heterozygosis with the wt represents the most physiological approach to track proteins until less intrusive fluorescent tags are developed.

      It is remarkable that Sec2 and Sec4 are recruited to membranes even before a vesicle is formed (Fig 6I). I find somewhat weak the evidence that RAB11s 'mark' the TGN, and disturbing the fact that RAB11 reaches the PM (does GFP tagging prevent GAP accession?). I should like to recommend strongly that the authors integrate into the introduction/discussion information on the late steps of exocytosis available for Aspergillus nidulans, another ascomycete that is particularly well suited for studying this process. Here RAB11 is not a late Golgi resident but is transiently (20 s) recruited to TGN cisternae in the late stages of their 120 s maturation cycle to drive the transition between Golgi and post-Golgi (Pantazopoulou MBoC, 2014). Recruitment of RAB11 to the TGN is preceded by the arrival of its TRAPPII GEF (Pinar, PNAS 2015; Pinar PLOS Gen 2019), a huge complex that is incorporated en bloc to the TGN (Pinar JoCS, 2020). Upon RAB11 acquisition RAB11 membranes engage molecular motors (Penalva, MBoC 2017) to undertake a several-micron journey that transports them to a vesicle supply center located underneath the apex (review, Pinar & Penalva, 2021). Here is where Sec4 is located, strongly indicating that there is a division of work between two Rabs each mediating one of the two stages between the TGN and the membrane (Pantazopoulou, 2014, MBoC).

    1. SciScore for 10.1101/2022.05.03.22274395: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: PCR confirmed and clinically suspected severe COVID-19 cases admitted to hospital were recruited into the DISCOVER study at North Bristol NHS Trust for which HRA Approval was granted by the South Yorkshire Research Ethics Committee (20/YH/0121).<br>Consent: All samples were used in accordance with the Human Tissue Act (2004) with appropriate consent and ethical approvals in place.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Blinding of validation set: The validation set of samples (n=807) were split into multiple aliquots (n=5) for randomisation and blinding by assigning a new barcode ID for each aliquot.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Blinding of validation set: The validation set of samples (n=807) were split into multiple aliquots (n=5) for randomisation and blinding by assigning a new barcode ID for each aliquot.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Purified proteins were analysed by SDS-PAGE and by Western-blots assays using an anti-His tag antibody (Sigma).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-His tag</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After washing, HRP-conjugated anti-human Pan-Immunoglobulin (Pan) (Sigma), IgG (Southern Biotech), IgA (Sigma) or IgM (Sigma) secondary antibody, in the same dilution buffer as the samples, was added (50 µl per well) and incubated for 1 hour.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgG ( Southern Biotech)</div><div>suggested: (SouthernBiotech Cat# 1050-01, RRID:AB_2737431)</div></div><div style="margin-bottom:8px"><div>IgA ( Sigma )</div><div>suggested: (Sigma-Aldrich Cat# I1010, RRID:AB_1163625)</div></div><div style="margin-bottom:8px"><div>IgM ( Sigma ) secondary antibody</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgM</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Roche SARS-CoV-2 anti-nucleocapsid antibody assay: Serum samples from PCR-confirmed cases were analysed using the commercial Elecsys® Anti-SARS-CoV-2 (Roche) in the Department of Microbiology, Infection Sciences, Southmead Hospital, North Bristol NHS Trust, Southmead Road, BS10 5NB, UK following manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-nucleocapsid</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Anti-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Transfected 293T cells were then infected with VSV*G-FLuc particles for 2 hours, washed with PBS, then incubated with fresh DMEM, supplemented with 10% FBS and 1:2000 (v/v) I1 (anti-VSV-G) antibody (absolute antibody Ab01401-10.3).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>I1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-VSV-G</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">VSV-G-harbouring BHK21 cells were infected with VSV*ΔG- FLuc particles to generate complemented VSV*G-FLuc particles as previously described (35).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK21</div><div>suggested: ATCC Cat# CRL-6281, RRID:CVCL_1914)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, 293T cells were seeded and transiently transfected with a plasmid corresponding to the original Wuhan strain Spike protein (pCAGGS-S2-spike) using Turbofect transfection reagent (ThermoFisher R0532) for 16 hours following the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Optimal pseudotype cell entry was achieved using VeroE6 cells stably expressing the human angiotensin-converting enzyme 2 (ACE2) receptor and the cell surface protease TMPRSS2 (Vero ACE2 TMPRSS2 (VAT) cells, which were a kind gift from Dr Suzannah Rihn, MRC-University of Glasgow Centre for Virus Research (36)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div><div style="margin-bottom:8px"><div>Vero ACE2</div><div>suggested: RRID:CVCL_A7UJ)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The sequence was synthesized with an NdeI restriction site at the 5’ end and the BamHI site at the 3’ end and cloned into pET28a expression vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pET28a</div><div>suggested: RRID:Addgene_139598)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The recombinant plasmids (pET28a-NP-FL) were transformed into E. coli strain BL21 (DE3)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pET28a-NP-FL</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, 293T cells were seeded and transiently transfected with a plasmid corresponding to the original Wuhan strain Spike protein (pCAGGS-S2-spike) using Turbofect transfection reagent (ThermoFisher R0532) for 16 hours following the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAGGS-S2-spike</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Images were acquired on the ImageXpress Pico Automated Cell Imaging System (Molecular Devices) using a 10X objective and infected cells detected and quantified using Cell ReporterXpress software (Molecular Devices).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Cell ReporterXpress</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical Analysis: Data analyses were performed using either R software with R Studio, and GraphPad Prism (version 9) as detailed below.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">However, sample readouts using other methods including interpolated unit values (from a 4- parameter logistic regression model fit (on Prism or within BMG software) to the 7- point standard pool dilution series) and AUC from sample dilution series were used in the development stage.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:


      Strengths of this study include rigorous development of high performance, low blood volume, cost-effective tests which can be easily deployed in a variety of settings, but our approach also has several limitations. Firstly, whilst samples from pre-pandemic children were included, samples from children with COVID-19 were not available to us and as such, assay performance for detecting recent paediatric infections cannot be reported. However, since widespread vaccination of children is not currently common in many countries while asymptomatic/mild paediatric infections are, antibody assays offer a useful tool for monitoring infection in this age group. The antigens used in the in-house assays were generated using the genetic sequence from the parent Wuhan strain of SARS-CoV-2 first described in 2020 (7) from which several new variants of concern (VOC) have evolved and have caused significant waves of infection globally. Some of these variants, especially Omicron, include multiple mutations in these target antigens and as such, may lead to antibody responses with differential binding to the target antigens. Indeed, antibodies responses raised to antigens from one SARS-CoV-2 variant genetic sequence lead to differential ability to neutralise VOC strains. However, whilst others have shown reduced binding to antigens from sequences of VOCs, rates of seropositivity when using different antigens, and/or from people who were infected with non-Wuhan variants, appear to be relatively un...


      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. 7.1.2 Forwarding from Inbox Note: Forwarding to avoid the ghost replies problem The following section is to mitigate the "ghost replies" problem which occasionally causes problems on federated networks. This problem is best demonstrated with an example. Alyssa makes a post about her having successfully presented a paper at a conference and sends it to her followers collection, which includes her friend Ben. Ben replies to Alyssa's message congratulating her and includes her followers collection on the recipients. However, Ben has no access to see the members of Alyssa's followers collection, so his server does not forward his messages to their inbox. Without the following mechanism, if Alyssa were then to reply to Ben, her followers would see Alyssa replying to Ben without having ever seen Ben interacting. This would be very confusing! When Activities are received in the inbox, the server needs to forward these to recipients that the origin was unable to deliver them to. To do this, the server MUST target and deliver to the values of to, cc, and/or audience if and only if all of the following are true: This is the first time the server has seen this Activity. The values of to, cc, and/or audience contain a Collection owned by the server. The values of inReplyTo, object, target and/or tag are objects owned by the server. The server SHOULD recurse through these values to look for linked objects owned by the server, and SHOULD set a maximum limit for recursion (ie. the point at which the thread is so deep the recipients followers may not mind if they are no longer getting updates that don't directly involve the recipient). The server MUST only target the values of to, cc, and/or audience on the original ob

      Here's where things get spicy

    1. SciScore for 10.1101/2022.05.04.490614: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Staining antibodies are as follows (Hu Fc Block Pure Fc1.3216 (BD, Cat# 564220), APC anti-HLA-ABC (Thermofisher, Cat# 17- 9983-42), APC/Cy7 anti-HLA-DR (BioLegend, Cat# 307618), PE anti- DYKDDDDK Tag (BioLegend, Cat# 637309), AF488 anti-SARS-CoV-2 Spike S1 Subunit (R&D Systems,Cat# FAB105403G), FITC anti-Influenza A NP (Thermofisher, Cat# MA1-7322), PE anti-mouse CD45 (BioLegend, Cat# 109808), BV421 anti-mouse CD31 (BioLegend, Cat# 102423), APC anti-mouse EpCAM (BioLegend, Cat# 118213), PerCP/Cy5.5 anti-H-2Kb/H-2Db (BioLegend,Cat# 114620)).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-HLA-ABC</div><div>suggested: (Thermo Fisher Scientific Cat# 17-9983-41, RRID:AB_10753773)</div></div><div style="margin-bottom:8px"><div>anti-HLA-DR</div><div>suggested: (BioLegend Cat# 307618, RRID:AB_493586)</div></div><div style="margin-bottom:8px"><div>anti-SARS-CoV-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-Influenza</div><div>suggested: (Thermo Fisher Scientific Cat# MA1-7322, RRID:AB_1017747)</div></div><div style="margin-bottom:8px"><div>anti-H-2Kb/H-2Db</div><div>suggested: (BioLegend Cat# 114620, RRID:AB_2750200)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmids: pDONR207-SARS-CoV-2 E (#141273), pDONR207-SARS-CoV-2 M (#141274), pDONR207-SARS-CoV-2 ORF7a (#141276), pDONR223-SARS-CoV-2 ORF7b (#141277), pDONR223-SARS-CoV-2 ORF8 (#141278) were purchased from addgene (Kim et al., 2020) and used as templates for construction of plasmids expressing SARS-CoV-2 viral proteins.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pDONR207-SARS-CoV-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pDONR223-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For HIV Nef expressing plasmid construction, NL4-3-dE-EGFP (kindly provided by Dr. Ya-Chi Ho) was used as a template.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NL4-3-dE-EGFP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For construction of plasmids expressing SARS-CoV viral proteins, oligonucleotides corresponding to both strands of SARS-CoV Tor2 (GenBank accession: NC_004718.3) ORF8a and ORF8b containing XhoI and BamHI sites at the 5’ and 3’ ends were synthesized (IDT) and cloned into XhoI-BamHI site of c-Flag pcDNA3 vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3</div><div>suggested: RRID:Addgene_15475)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To investigate the prevalence of amino acid mutations, we downloaded up to 965 sequences of each lineage and aligned the ORF8 nucleotide sequences using Jalview software (http://www.jalview.org/) (Waterhouse et al. Bioinformatics. 2009) by MUSCLE algorithm (Edgar RC.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Jalview</div><div>suggested: (Jalview, RRID:SCR_006459)</div></div><div style="margin-bottom:8px"><div>MUSCLE</div><div>suggested: (MUSCLE, RRID:SCR_011812)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">FlowJo software (Tree Star) was used for the data analysis.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.05.03.490428: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Human convalescent serum samples: Human convalescent serum samples from recovered COVID-19 patients were obtained from Public Health Clinical Center of Chengdu in Chengdu, China, under approved guidelines by the Institutional Review Board (IRB), and all patients had provided written informed consent before serum sample were collected.<br>Consent: Human convalescent serum samples: Human convalescent serum samples from recovered COVID-19 patients were obtained from Public Health Clinical Center of Chengdu in Chengdu, China, under approved guidelines by the Institutional Review Board (IRB), and all patients had provided written informed consent before serum sample were collected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Animal studies, facilities and ethics statements: Specific pathogen-free (SPF) BALB/c female mice (6-8 weeks old) for immunogenicity studies were purchased from Charles River Experimental Animals Co.,</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Serum was collected on D35 (2 weeks PD2), D56 (Day of 3rd dose boost), D85 (1 month post dose 3), D113 (2 months post dose3) and D141 (3 months post dose 3) for pseudovirus neutralizing antibody test.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>D56</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>D85</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>D113</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>D141</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudovirions were produced by co-transfection HEK 293T cells with psPAX2, pLVX-AcGFP-N1-Fluc, and plasmids encoding various S genes by using Lipofectamine 3000 (Invitrogen, L3000-015).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudoviruses stock were titrated by infecting 293T-ACE2 cells and luciferase activity was determined following a 44-48 h incubation period at 37°C and 5% CO2 by addition Bright-Glo Luciferase Assay System (Promega, E2650) using a microplate reader (TECAN, Spark).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For three dose boost study, Balb/c mice, female (n=10/group) prime and boost with SCB-2019 3 μg adjuvanted with 75 μg alum plus 150 μg CpG 1018 twice on Day 0 and Day 21, then boosted with 3 μg SCB-2019, or SCB-2022B or Bivalent adjuvanted with 75 μg alum plus 150 μg CpG 1018 on Day 57 via intramuscular injection.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Balb/c</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The cDNA was subcloned into pTRIMER expression vector (GenHunter Corporation) at Hind III and Bgl II sites to allow in-frame fusion of the soluble S protein to Trimer-Tag (amino acid residue 1156-1406 from human Type I(α) collagen).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pTRIMER</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudovirus construction and production: The variants of concern of SARS-CoV-2 spike protein genes were optimized using mammalian codon and synthesized by Genscript, then cloned into pcDNA3.1(+) eukaryotic expression vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudovirions were produced by co-transfection HEK 293T cells with psPAX2, pLVX-AcGFP-N1-Fluc, and plasmids encoding various S genes by using Lipofectamine 3000 (Invitrogen, L3000-015).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>psPAX2</div><div>suggested: RRID:Addgene_12260)</div></div><div style="margin-bottom:8px"><div>pLVX-AcGFP-N1-Fluc</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Data arrangement was performed by Excel and statistical analyses were performed using the Prism 9.2.0 (GraphPad Software).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Excel</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04405908</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Completed</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">SCB-2019 as COVID-19 Vaccine</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04672395</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">A Controlled Phase 2/3 Study of Adjuvanted Recombinant SARS-…</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. The only reasonable implementation options are JavaScript and PHP.

      I argue that PHP is not reasonable here. The only appropriate thing for this use case is (unminified) JS—or some other program text encoded as a document resource permitting introspection and that the user agent just happens to be able to execute/simulate.*

      • Just like the advocates of "a little jQuery", author here doesn't seem to realize that the use of PHP was the first step towards what is widely acknowledged to be messed up about the "modern" Web. People can pine for the days of simple server-side rendering, but there's no use denying that today's Web is the natural result of an outgrowth that began with abuses of the fundamental mechanisms underpinning the Web—abuses that first took root with PHP.

      * Refer to the fourth and sixth laws of "Sane Personal Computing, esp. re "reveals purpose"

    2. how does one support comments? Answer: Specialist third-party services like Disqus come into existence. Now, you can have comments on your website just by adding a <script> tag, and not have to traverse the painful vertical line of making your website itself even slightly dynamic.

      Controversial opinion: this is actually closer to doing the Web the way that it should be done, taking the intent of its design into account. NB: this is not exculpatory of minified JS bundles (where "megabyte" is the appropriate unit order of magnitude for measuring their weight) or anything about "modern" SPAs that thumb their nose at graceful degradation.

    1. The biggest mistake—and one I’ve made myself—is linking with categories. In other words, it’s adding links like we would with tags. When we link this way we’re more focused on grouping rather than connecting. As a result, we have notes that contain many connections with little to no relevance. Additionally, we add clutter to our links which makes it difficult to find useful links when adding links. That being said, there are times when we might want to group some things. In these cases, use tags or folders.

      Most people born since the advent of the filing cabinet and the computer have spent a lifetime using a hierarchical folder-based mental model for their knowledge. For greater value and efficiency one needs to get away from this model and move toward linking individual ideas together in ways that they can more easily be re-used.

      To accomplish this many people use an index-based method that uses topical or subject headings which can be useful. However after even a few years of utilizing a generic tag (science for example) it may become overwhelmed and generally useless in a broad search. Even switching to narrower sub-headings (physics, biology, chemistry) may show the same effect. As a result one will increasingly need to spend time and effort to maintain and work at this sort of taxonomical system.

      The better option is to directly link related ideas to each other. Each atomic idea will have a much more limited set of links to other ideas which will create a much more valuable set of interlinks for later use. Limiting your links at this level will be incredibly more useful over time.

      One of the biggest benefits of the physical system used by Niklas Luhmann was that each card was required to be placed next to at least one card in a branching tree of knowledge (or a whole new branch had to be created.) Though he often noted links to other atomic ideas there was at least a minimum link of one on every idea in the system.

      For those who have difficulty deciding where to place a new idea within their system, it can certainly be helpful to add a few broad keywords of the type one might put into an index. This may help you in linking your individual ideas as you can do a search of one or more of your keywords to narrow down the existing ones within your collection. This may help you link your new idea to one or more of those already in your system. This method may be even more useful and helpful for those who are starting out and have fewer than 500-1000 notes in their system and have even less to link their new atomic ideas to.

      For those who have graphical systems, it may be helpful to look for one or two individual "tags" in a graph structure to visually see the number of first degree notes that link to them as a means of creating links between atomic ideas.

      To have a better idea of a hierarchy of value within these ideas, it may help to have some names and delineate this hierarchy of potential links. Perhaps we might borrow some well ideas from library and information science to guide us? There's a system in library science that uses a hierarchical set up using the phrases: "broader terms", "narrower terms", "related terms", and "used for" (think alias or also known as) for cataloging books and related materials.

      We might try using tags or index-like links in each of these levels to become more specific, but let's append "connected atomic ideas" to the bottom of the list.

      Here's an example:

      • broader terms (BT): [[physics]]
      • narrower terms (NT): [[mechanics]], [[dynamics]]
      • related terms (RT): [[acceleration]], [[velocity]]
      • used for (UF) or aliases:
      • connected atomic ideas: [[force = mass * acceleration]], [[$$v^2=v_0^2​+2aΔx$$]]

      Chances are that within a particular text, one's notes may connect and interrelate to each other quite easily, but it's important to also link those ideas to other ideas that are already in your pre-existing body of knowledge.


      See also: Thesaurus for Graphic Materials I: Subject Terms (TGM I) https://www.loc.gov/rr/print/tgm1/ic.html

    1. Author Response

      *Reviewer #2 (Public Review):

      This manuscript describes studies on the structural determinants of activation for the adhesion GPCR (aGPCR) GPR116 both in vitro and in vivo. The authors define key residues for activation on the receptors' N-terminus (the "tethered agonist") and the extracellular loops. Thus, the studies provide novel insights into the structural determinants of GPR116 activation. However, some interpretational issues (detailed below) complicate some of the authors' conclusions. Specific comments are as follows:

      1. Results section, first paragraph, last sentence: The authors write, "These results taken together indicate that the H991A mutant is capable of proper trafficking to the membrane, is able to response to exogenous peptide, but is unable to be cleaved and activated by endogenous ligands in vivo." The last part of this sentence represents an over-interpretation, as the data shown in Figure 1 do NOT show that the non-cleavable receptor is unable to be activated by endogenous ligands in vivo. It is entirely conceivable that a non-cleavable aGPCR could still be activated by endogenous adhesive ligands if those ligands were to change the position of the tethered agonist in manner that alters receptor signaling activity.

      Thank you for highlighting this misleading wording. We rephrased the sentence to read as follows: Taken together, these results demonstrate that the H991 residue within the GAIN domain is critical for cleavage of GPR116 into NTF and CTF fragments but dispensable for trafficking of the receptor to the plasma membrane and response to exogenous peptide activation in vitro.

      1. The data shown in Fig. 1B (surface expression of non-cleavable H991A mutant) need to be quantified in some way in order to be interpretable.

      As the H991A construct does not contain a cell surface epitope tag, it is difficult to directly quantitate surface expression of this protein. The data in transiently transfected HEK293 cells (Figure 1, panels C and D) and in primary alveolar epithelial cells (Figure 2, panels C&D) clearly demonstrate that the H991A mutant is activated to comparable levels as the wild-type receptor in response to exogenous peptide stimulation. In light of these functional data, we are confident that the surface expression of H991A is comparable to that of the WT receptor in vitro and in vivo.

      1. Results section, second paragraph, penultimate sentence: The authors write, "These data demonstrate that while the non-cleavable receptor is fully activated in vitro by exogenous peptides corresponding to the tethered agonist sequence, cleavage of the receptor and unmasking of the tethered agonist sequence is critical for GPR116 activation in vivo." However, the non-cleavable GPR116 mutant actually has two key differences from WT: i) lack of full liberation of the tethered agonist sequence, and ii) lack of liberation of a free NTF, which might dissociate from the CTF and have important in vivo physiological actions on its own. Isn't it conceivable that the lack of a freely mobile NTF contributes to the similarity in lung phenotype between the non-cleavable knock-in mutant and the GPR116 knockout? Based on the data shown in Figure 2, how can the authors claim these data demonstrate that unmasking of the tethered agonist is critical for GPR116 activation? The data could equally be interpreted as showing that liberation of a free NTF is critical for the physiological effects of GPR116 in vivo.

      We thank the reviewer for this comment and, in retrospect, agree that we may have overstated the interpretation of our results for the H991A transgenic mouse. While it is possible that the free NTF may be responsible for the physiological effects of GPR116 in vivo, in light of recently published data by Mitgau et al. (BioRxiv https://doi.org/10.1101/2021.09.13.460127), we believe this not to be the case for the following reasons. First, the H991A and WT receptors are activated to an identical level by exogenous peptide stimulation in a transformed cell line (HEK293) and in primary alveolar type 2 epithelial cells (Figures 1 and 2), irrespective of if the NTF is free floating in solution in the context of the WT receptor. These data would argue against a role of the free NTF in receptor activity. Second, in a recent publication by Mitgau et al., the authors clearly demonstrate that activation of GPR126, an adhesion GPCR that is also cleaved at the GPS and activated by exogenous peptides corresponding to the tethered agonist, by antibodies that bind and crosslink the NTF is completely dependent on cleavage at the GPS. They further demonstrate that antibody-mediated activation does not lead to liberation of the NTF from the CTF. Rather, they postulate that proper GPS processing, as occurs for the WT receptor, leads to a favorable protein confirmation of the tethered agonist, which is indispensable for GPR126 activity. Given these results, we postulate that cleavage at the GPS of WT GPR116 results in a conformation that is critical for the tethered agonist sequence to reach and bind the ECLs, resulting in activation of the receptor, similar to that observed with GPR126. We have edited our interpretation of these data in the revised manuscript.

      1. Figure 3: If the authors' hypothesis is that the tethered agonist must be liberated in order to allow activation of GPR116, then why do ANY of the Flag-tagged mutant constructs exhibit constitutive signaling activity? Doesn't the N-terminal Flag tag prevent the tethered agonist from being exposed? How can these data be reconciled with the authors' model?

      It is unlikely that the 27 amino acid N-terminal FLAG epitope tag envelopes the tethered agonistic peptide to the same extent as the tertiary structure of the carboxy terminus of the NTF (based on published structures for other aGPCRs). Additionally, we provided data demonstrating that an untagged version of the CTF protein is activated to a similar extent at FLAG-tagged CTF in response to activating peptides (Supplemental Figure 2A). Based on our data from mutagenesis experiments and modeling of GPR116 with the agonist, we do not believe the tethered agonist dives deeply within the binding pocket but rather interacts with critical amino acids at the surface of ECL2 to induce conformational changes to the receptor and downstream activation.

      1. The data shown in Fig. 3D are lacking statistical comparisons, so it is not possible to tell whether any of the differences between the mutants are statistically significant.

      Statistical analyses for data in this panel have been added

      1. The data shown in Fig. 4D (surface expression of the ECL mutants) need to be quantified in some way.

      We have added additional data to this figure (Fig4 F-G-H) using the V5-tagged mFL construct as control. As the tag is C-terminal, we quantified by flow cytometry the total expression using an anti-V5 antibody, to complement to immunocytochemistry data showing membrane expression.

      1. In interpreting the results of the ECL mutations on GPR116 signaling activity, it is unclear why the authors so explicitly propose that these data demonstrate that the tethered agonist must be interacting with ECL2. Isn't it possible that ECL2 mutants with impaired receptor signaling activity simply lock the receptor in an inactive state? In this way, the effects of the ECL2 mutations could be explained without invoking a physical interaction between the putative tethered agonist and ECL2.

      Yes, this interpretation is also possible. We have rephrased the Results and Discussion sections accordingly to reflect this possibility.

    1. SciScore for 10.1101/2022.04.28.489772: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Euthanasia Agents: 2 variant at 100 TCID50/mouse under isoflurane anesthesia.<br>IACUC: All procedures were performed according to the animal study protocols approved by the FDA White Oak Animal Program Animal Care and Use Committee.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">In the ABSL-3 lab, K18-hACE2 mice were randomly grouped and were inoculated intranasally with NY (G614), Delta, Omicron BA.1 or Omicron BA.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Western blot: Western blot was performed using an anti-SARS-COV-2 S antibody following a protocol described previously (58).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-COV-2 S</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Alkaline phosphatase conjugated anti-Rabbit IgG (1:5000) (Sigma-Aldrich, St. Louis, MO) was used as a secondary antibody.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Rabbit IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Control sensors with no ACE2 or antibody were also dipped in the S protein solutions and the running buffer as references.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For antibody staining, an Alexa Fluor 647 conjugated donkey anti-human IgG Fc F(ab’)2 fragment (Jackson ImmunoResearch, West Grove, PA) was used as secondary antibody at 5 μg/ml concentration.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After washing, plates were probed with 1 μg/ml of inhouse developed rabbit polyclonal antibody specific for SARS-CoV-2 membrane/nucleocapsid (33) at 4°C overnight followed by peroxidase-conjugated goat anti-rabbit secondary antibody (SeraCare #5220-0336, 1:2000) for 2h at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: (SeraCare KPL Cat# 5220-0336, RRID:AB_2857917)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, Expi293F cells transfected with monomeric ACE2 or dimeric ACE2 expression construct and the supernatant of the cell culture was collected.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Expi293F</div><div>suggested: RRID:CVCL_D615)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Murine Leukemia Virus (MLV) particles (plasmids of the MLV components kindly provided by Dr. Gary Whittaker at Cornell University and Drs. Catherine Chen and Wei Zheng at National Center for Advancing Translational Sciences, National Institutes of Health), pseudotyped with various SARS-CoV-2 S protein constructs, were generated in HEK 293T cells, following a protocol described previously for SARS-CoV (59, 60).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293T</div><div>suggested: KCB Cat# KCB 200744YJ, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To prepare for infection, 7.5×103 of HEK 293 cells, stably transfected with a full-length human ACE2 expression construct, in 15 μl culture medium were plated into a 384-well white-clear plate coated with poly-D-Lysine to enhance the cell attachment.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudotyped virus particles were produced in 293T/17 cells (ATCC) by co-transfection of plasmids encoding codon-optimized SARS-CoV-2 full-length S constructs, packaging plasmid pCMV DR8.2, and luciferase reporter plasmid pHR’ CMV-Luc.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T/17</div><div>suggested: ATCC Cat# CRL-11268, RRID:CVCL_1926)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The 293T cell line stably overexpressing the human ACE2 cell surface receptor protein was kindly provided by Drs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: KCB Cat# KCB 200744YJ, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Seed viruses were amplified in Vero E6 (ATCC CRL-1586) or Vero E6 with TMPRSS2 overexpression (BPS Bioscience #78081)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In vitro virus replication and focus-forming assay: Vero-E6 cells were pre-seeded in 12-well tissue culture plates overnight and were infected with authentic viruses (G614, Delta, Omicron BA.1 or BA.2) at MOI of 0.01 in Gibco™ high glucose DMEM containing 3% FBS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, 10-fold serially diluted postinfection were added at 100 μl/well to Vero E6-TMPRSS2 cells pre-seeded in 96-well tissue culture plates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6-TMPRSS2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mouse study: Hemizygous B6.Cg-Tg(K18-ACE2)2Prlmn/J (K18-hACE2</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>B6.Cg-Tg(K18-ACE2)2Prlmn/J</div><div>suggested: RRID:IMSR_JAX:034860)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In the ABSL-3 lab, K18-hACE2 mice were randomly grouped and were inoculated intranasally with NY (G614), Delta, Omicron BA.1 or Omicron BA.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>K18-hACE2</div><div>suggested: RRID:IMSR_GPT:T037657)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The S gene was fused with a C-terminal twin Strep tag (SGGGSAWSHPQFEKGGGSGGGSGGSSAWSHPQFEK) and cloned into a mammalian cell expression vector pCMV-IRES-puro (Codex BioSolutions, Inc, Gaithersburg,</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV-IRES-puro</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudotyped virus particles were produced in 293T/17 cells (ATCC) by co-transfection of plasmids encoding codon-optimized SARS-CoV-2 full-length S constructs, packaging plasmid pCMV DR8.2, and luciferase reporter plasmid pHR’ CMV-Luc.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV DR8.2 , and luciferase reporter</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pHR’</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Serially diluted pCMV6-AC-ACE2-GFP plasmid or pCC1-CoV2-F7 plasmid expressing SARS-CoV-2 N (62) was used to construct a standard curve.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV6-AC-ACE2-GFP</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pCC1-CoV2-F7</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The KD was obtained by fitting Req value and its corresponding concentration to the model: “one site-specific” using GraphPad Prism 8.0.2 according to H.J. Motulsky, Prism 5 Statistics Guide, 2007, GraphPad Software Inc.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Automated data collection was carried out using SerialEM version 3.8.6 (63) at a nominal magnification of 105,000× and the K3 detector in counting mode (calibrated pixel size, 0.83 Å) at an exposure rate of 13.761 electrons per pixel per second.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SerialEM</div><div>suggested: (SerialEM, RRID:SCR_017293)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Local resolution was also determined using cryoSPARC.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>cryoSPARC</div><div>suggested: (cryoSPARC, RRID:SCR_016501)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Several rounds of manual building were performed in Coot.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Coot</div><div>suggested: (Coot, RRID:SCR_014222)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Iteratively, refinement was performed in both Phenix (real space refinement) and ISOLDE (66), and the Phenix refinement strategy included minimization_global, local_grid_search, and adp, with rotamer, Ramachandran, and reference-model restraints, using 7KRQ and 7KRR as the reference models.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Phenix</div><div>suggested: (Phenix, RRID:SCR_014224)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
  6. Apr 2022
    1. SciScore for 10.1101/2022.04.22.22274032: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Subjects or households with suspected or confirmed SARS-CoV-2 infection were recruited from the Greater New Orleans community under Tulane Biomedical Institutional Review Board (federalwide assurance number FWA00002055, under study number 2020-585).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Determination of antigen-specific antibody reactivity by multiplexed Luminex analysis: Recombinant SARS-CoV-2 antigens (full-length spike, RBD, and N) and the recombinant spike protein from OC43, HKU1, 229E, and NL63 (Frederick National Laboratories) were coupled with MagPlex beads (Luminex) via sulfo-NHS coupling chemistry.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antigen-specific</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>HKU1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The Spike protein ELISA for IgG antibodies has been validated by testing a standard set of positive and negative samples provided by NCI SeroNet staff.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">NK92 cells in complete alphaMEM culture medium were added at 5 × 104 cells/well in the presence of 4 µg/ml brefeldin A (Biolegend Cat# 420601), 5 µg/ml GolgiStop (BD Biosciences Cat# 554724) and 0.15µg of anti-CD107a antibody (Clone H4A3 PE-Cy7, Biolegend Cat# 328618) for 5 hours at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-CD107a</div><div>suggested: (BioLegend Cat# 328618, RRID:AB_11147955)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody-dependent neutrophil phagocytosis (ADNP): Protocol was adapted from [72]</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Antibody-dependent neutrophil phagocytosis</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Beads were washed with PBS containing 15 mM EDTA and stained with an FITC-conjugated anti-guinea pig C3 antibody (MP Biomedicals).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-guinea pig C3</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Neutralization of SARS CoV-2 in Pseudovirus Assay: CHO cells were generated and stably expressed ACE2 by transfecting CHO cells with an ACE2 expression plasmid containing the blasticidin resistance gene.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHO</div><div>suggested: CLS Cat# 603479/p746_CHO, RRID:CVCL_0213)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">CHO-ACE2 cells were similar in SARS CoV-2 susceptibility to the 293T/ACE2 cell line developed by Dr.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHO-ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Virus neutralization was measured in CHO/ACE2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHO/ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudoviruses were produced by co-transfection of the four plasmids into 293T cells grown in T75 flasks with Fugene 6 as transfection reagent.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Unbound antibodies were removed by centrifugation before adding THP-1 cells at 2.5×104 cells/well.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>THP-1</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">RBD (aa321-535) was similarly expressed in the phCMV plasmid and purified on Streptactin X affinity columns.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>phCMV</div><div>suggested: RRID:Addgene_15802)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A DNA fragment encoding SARS CoV-2 N protein, including its natural leader sequence was generated by PCR of full-length N protein gene from a lentiviral N Protein expression vector (pLVX-EF1alpha-SARS-CoV-2-N-2xStrep-IRES-Puro, which was a gift from Nevan Krogan (Addgene plasmid # 141391 ; http://n2t.net/addgene:141391; RRID:Addgene_141391, [68]).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_141391)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">These included an expression plasmid for full-length spike protein of the Wuhan-1 strain containing the D614G amino acid chain (VRC7480.G614) [70], a pCMV ΔR8.2 lentivirus backbone plasmid (VRC5602) [71], the VRC5601 plasmid pHR’ CMV Luc containing the firefly luciferase reporter gene [71], and VRC9260 for TMPRSS2 expression.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV ΔR8.2 lentivirus</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>VRC5601</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pHR’</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Neutralization titers were defined as the serum dilution (ID50) at which relative luminescence units (RLU) were reduced by 50% compared to virus control wells after subtraction of background RLUs (determined by GraphPad Prism, version 9 for macOS, GraphPad Software, San Diego, California USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Spike Glycoprotein (stabilized) from SARS-Related Coronavirus 2, Wuhan-Hu-1 with C-Terminal Histidine Tag, Recombinant from Baculovirus), and SARS-CoV-2 specific mega pools at 0.2 μg/well including PepTivator SARS-CoV-2 Prot_S (Miltinyi - 130-126-700), SARS-CoV-2 Prot_M (130-126-702), SARS-CoV-2 Prot_N (130-126-699) in 96-well U bottom tissue culture plate (CytoOne CC7672-7596) in 200 μl RPMI-1640 with 10% FBS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PepTivator</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">) GraphPad Prism (version 9.0.0, GraphPad Software, San Diego, CA), JMP (version 16.2.0, SAS Institute, Inc.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, Cary, NC), and SAS (version 9.4, SAS Institute, Inc.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SAS Institute</div><div>suggested: (Statistical Analysis System, RRID:SCR_008567)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:


      Study limitations primarily involved using SARS-CoV-2 infection to differentiate subjects rather than pre-pandemic samples. In addition, the assays were limited to peripheral blood samples and not tissue-specific responses, which included only effector functions to spike protein and cytokine secretion instead of T-cell subset analyses. Detection of secreted cytokines allowed a greater number of cytokines to be evaluated but prevented confirmation of cells producing cytokines as would be observed intracellular stained cytokines for specific T-cell populations. However, cytokines between spike or peptide pools were highly correlated (Figure S5), indicating T-cell production. Also, high expression of IL-2 has been routinely observed from CD4+ T-cell and not CD8+ T-cells after SARS-CoV-2 infection [28, 38]. In this study, IL-17A secretion was closely correlated to IL-2 and Th1 cytokine release after stimulation with protein or peptide pools, suggesting that IL-17A may be serving as a proxy for a Th1/Th17 subset, as identified in other post-vaccination studies [61] which should be more closely examined. Finally, while the critical role for age in SARS-CoV-2 immunity was validated, it remains an ongoing question of why children exhibit less severity with infection and how differences in qualitative features of immunity depend on patient age. Our study used samples collected from subjects only shortly after the pandemic which will be difficult to perform as COVID subsides and vaccin...


      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.04.21.489021: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The cells were incubated with 100μM of the respective peptide and 1:200 dilution of rabbit anti-HA tag antibody (Sigma; catalogue no. Cat # H6908) at 4°C for 1hr.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-HA</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were incubated with 1:200 dilution of goat anti-rabbit Alexa fluor-647 antibody (Invitrogen) and 1:100 dilution of neutravidin fluorescein conjugate (Invitrogen; FITC, catalogue no. A2662, used for the first FACS) at 4°C for 30min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>antibody (Invitrogen)</div><div>suggested: (Rockland Cat# 00-8844-25, RRID:AB_2610705)</div></div><div style="margin-bottom:8px"><div>30min</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were incubated with 1:500 dilution of mouse anti-FLAG monoclonal antibody (Merck, catalogue no. F3165) overnight at 4°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-FLAG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The blots were probed with 1:5000 anti Flag antibody (Sigma, F3165) overnight at 4□C followed by 1:10000 anti-mouse secondary at room temperature for 1hr.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti Flag</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-mouse</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The surface of the well was washed twice with blocking buffer and incubated with HRP-conjugated rabbit anti-6xHis tag antibody (Abcam; catalogue no. AB1187), 1:10,000 dilution at 4°C overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-6xHis tag</div><div>suggested: (Abcam Cat# ab1187, RRID:AB_298652)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">eGFP-ACE2/HEK293T immunostained with FLAG antibody was imaged at 60x oil objective of FV3000 confocal microscope (Figure 2B) and 100x oil objective of H-TIRF microscope (Supplementary Figure 2A) using 405nm, 488nm and 647nm laser lines for DAPI, eGFP, and Alexa fluor-647 fluorophores.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>eGFP</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell culture experiments: Wild type mammalian HEK293T cells and LentiX-293T cells (Takara Bio, catalogue no. 632180) were used in this study for pseudotyped spike virus production and viral transduction assay.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>LentiX-293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Caco2 cells were lysed for total RNA purification using the Trizol method.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco2</div><div>suggested: CLS Cat# 300137/p1665_CaCo-2, RRID:CVCL_0025)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudoviral transduction assay: The GFP/HEK293T cells or eGFP-ACE2/HEK293T cells were grown up to 60-70% confluency in complete media before viral transduction.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GFP/HEK293T</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>eGFP-ACE2/HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In this assay, the viral titre was used in a concentration such that to obtain more than 70% transduction efficiency in the eGFP-ACE2/HEK293T or eGFP/HEK293T cell line.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>eGFP/HEK293T</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cloning and protein purification: The nanobody gene was amplified from isolated yeast colonies and cloned between HindIII and XhoI sites in a pET-22b(+) plasmid containing a C-terminal 6x histidine tag.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pET-22b(+)</div><div>suggested: RRID:Addgene_12651)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For viral particle production, 5 µg pHR lentiviral vector cloned with mCherry fluorescent protein, 3.75 µg packaging plasmid psPAX2 (Addgene; #12260), and 2.5 µg envelope plasmid for the expression of Spike glycoprotein (obtained as a kind gift from Prof. Nevan Krogan, UCSF, USA) of SARS-CoV-2 were mixed in 500 µl OptiMEM media and 20 µl PLUS reagent (Invitrogen; LTX transfection reagent, catalogue no. L15338100) and kept for incubation at room temperature for 5min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHR</div><div>suggested: RRID:Addgene_16514)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">We also generated control lentiviral particles by replacing Spike plasmid with VSV-G envelope protein, pmDG2 (Addgene; #12259) plasmid.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pmDG2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Omicron pseudotyped virus production: Omicron pseudotyped viruses were produced similarly as described above for spike pseudoviruses but instead used omicron envelope plasmid along with packaging plasmid (psPAX2) and lentiviral plasmid (pHR mCherry) in the following ratio: psPAX2 (1.3pmol), pHR mCherry: 1.64pmol, SARS-CoV-2 Omicron Strain S gene (Genscript, Cat # MC_0101274): 0.72pmol.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>psPAX2</div><div>suggested: RRID:Addgene_12260)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">This construct contains amino-terminus EGFP followed by self-cleaving 2A peptide sequence followed by ACE2 and carboxy-termini SNAP-tag and FLAG tags (eGFP-ACE2/HEK293T) Generation of stable HEK293T cell line for over-expression of ACE2: The lentiviral pTRIP vector cloned with eGFP-ACE2/HEK293T under CMV enhancer and chicken β-actin promoter (CAG promoter) flanked with 5′and 3′ long terminal repeat (LTR) sequences (39), were used to produce lentiviral particles as per the method described before (35).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pTRIP</div><div>suggested: RRID:Addgene_127663)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The following peptide sequences from the receptor-binding domain (RBD) of the spike were synthesized from LifeTein with a biotin tag: Peptide-1: [FNCYFPLQS]S-K-Biotin Peptide-2: Biotin-[GFQPTNGVGY] Sequence Alignment for Covid Variants The hCoV19 spike (Wuhan/WIV04/2019), GISAID (EPI_ISL_402124) construct is a kind gift from Prof. Nevan Krogan, UCSF, USA (38).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>LifeTein</div><div>suggested: (LifeTein, RRID:SCR_012626)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For viral particle production, 5 µg pHR lentiviral vector cloned with mCherry fluorescent protein, 3.75 µg packaging plasmid psPAX2 (Addgene; #12260), and 2.5 µg envelope plasmid for the expression of Spike glycoprotein (obtained as a kind gift from Prof. Nevan Krogan, UCSF, USA) of SARS-CoV-2 were mixed in 500 µl OptiMEM media and 20 µl PLUS reagent (Invitrogen; LTX transfection reagent, catalogue no. L15338100) and kept for incubation at room temperature for 5min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Addgene</div><div>suggested: (Addgene, RRID:SCR_002037)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Images were analysed on Fiji software to calculate mean fluorescence intensity (MFI) for eGFP (ACE2 expression) and mCherry (viral transduction) channel from the z-projected stacks.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Fiji</div><div>suggested: (Fiji, RRID:SCR_002285)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. Author Response:

      Reviewer #2:

      The authors investigated changes in the unstressed and stressed oligomeric states of the mammalian endoplasmic reticulum (ER) stress sensor, IRE1a. Previous biochemical and microscopy studies in mammalian cells and studies of the related protein Ire1 in yeast, describe an increase in oligomerization of the stress sensor upon treatment of cells with chemical agents that impair the ER protein folding environment. The general view has been that IRE1 in unstressed cells is a monomer and varying degrees of misfolded protein stress stimulate dimerization, activation, and higher order oligomerization. Distinguishing between monomers and dimers, as well as tetramers or other small oligomers is technically challenging, especially for integral membrane proteins. To address this challenge, the authors turned to single particle tracking fluorescence microscopy of Halo-tagged endogenous IRE1. Using a clever combination of random labeling with two fluorescent dyes and oblique angle illumination to visualize single molecules, as well as dimers, the authors surprisingly find that their endogenous IRE1 reporter appears to be dimeric in homeostatic cells. This observation challenges the predominant model in which IRE1 is monomeric in unstressed cells and that even dimerization represents a switch into an active state. The authors claim to detect evidence for higher order oligomers following treatment with stressors. The authors then use a series of IRE1 mutants to identify how oligomerization is regulated and present a new model to reconcile the different models of IRE1 activation in the literature.

      The authors have extensively characterized their novel experimental system in terms of protein expression levels, functionality, and ability to distinguish monomers and dimers. The data are well presented and the authors are clearly familiar with the arguments that have surrounded the IRE1 oligomer question. That the authors observe the characteristic XBP1 mRNA splicing activity in the absence of visible large IRE1 clusters may suggest that the large clusters reported by others may have distinct roles, perhaps in more permissive mRNA cleavage.

      The present study is undermined by two major weaknesses. First, while the authors persuasively demonstrate that they can detect IRE1a dimers, a major claim of the manuscript rests upon detection of tetramers and possibly higher order oligomers. Unfortunately, the authors provide no independent controls to show what tetramer or higher order oligomer data would look like. Thus, the authors can only infer that higher order oligomers are detected, based on modest shifts in the percent of correlated particle trajectories observed in some cells. More robust evidence is needed to make claims of oligomerization. Tools have been developed by others that can induce reversible oligomerization of proteins. Application of these tools would provide powerful controls for tetramers or even higher order oligomers in this study.

      The second, deeper concern, is the discrepancy between the Halo Tag clustering results in this study and studies by this lab and several other labs that report a distinct stress phenotype. In mammalian cells and yeast, IRE1 and Ire1, tagged with different fluorescent proteins or even a small HA peptide epitope tag, undergo quantitative visible formation of puncta or clusters upon treatment with stressors. The small number of bright clusters that form effectively deplete the rest of the ER of IRE1 signal. In the present study, the authors observe no visible change in IRE1-Halo localization in stress cells. The authors do not investigate the cause of this difference. While one might argue that the presence of stress-inducible IRE1 activity is sufficient to argue that the reporter in this study is functional, IRE1 reporters (that do cluster) described in previous studies by the Walter lab and other groups are also demonstrably functional. Does IRE1 normally cluster? Is it cell-type dependent? Tag-dependent? Notably, the Pincus et al. PLoS Biology paper from the Walter lab used two different fluorescent protein tags that do not heterozygously dimerize. Robust colocalization and FRET signals were detected upon treatment of cells with stressors and clustering was subsequently observed. A 2007 Journal of Cell Biology study from Kimata et al. reported clustering in yeast with an Ire1 tagged with an HA epitope peptide. The HA peptide seems unlikely to be prone to any oligomerization propensities that GFP tagged reporters might experience. Importantly, a 2020 PNAS paper from the Walter lab (Belyy et al.) studied clustering of a robustly monomeric mNeonGreen-tagged IRE1 in U2-OS cells and mouse embryonic fibroblasts and this construct readily clustered following stress induction.

      When evaluated against the backdrop of the extensive literature describing the visual behavior of IRE1a in live cells, the absence of stress-induced clustering is both puzzling and disconcerting. Given the focus of this study is to use visual techniques to study IRE1a interactions, the burden of proof is on the authors to resolve this significant discrepancy with the rest of the IRE1a literature. One can easily imagine that incorporation of the majority of the pool of IRE1a into 10-100 clusters could produce very different correlated trajectory behavior. Until the authors can determine why their reporters behave differently from other IRE1a reporters and establish which version accurately reflects physiologic IRE1a behavior, the potential impact of the findings of this manuscript are of unknown value.

      We thank the reviewer for this detailed assessment of our work. We agree that the question of apparent discrepancy in the formation of observable IRE1 clusters between this manuscript and earlier work is important. We have now addressed this issue both in the revised version of the manuscript and in specific point-by-point responses to reviewers’ comments. As a brief summary, we addressed the reviewer’s first concern (lack of controls larger than dimers) by cloning and validating a tetrameric HaloTag construct, the measurements from which were entirely consistent with the model we presented in the original version of the manuscript. To address the reviewer’s second concern, we present several lines of evidence showing that the discrepancy between the formation of microscopically visible IRE1 clusters in earlier studies and the absence of such clusters in the present work almost certainly results from differences in expression levels. First, our IRE1-HaloTag construct is perfectly capable of forming stress- induced clusters, as we show in the new Figure 1 – Figure Supplement 3. Second, we point to a parallel study by Gómez-Puerta et al., who demonstrate that a more “conventional” IRE1-GFP construct does not form visible stress-dependent puncta when it is expressed at a low level comparable to that of untagged IRE1 in HeLa cells, despite being fully active. Third, our earlier work in the 2020 PNAS paper referenced by the reviewer actually showed that even in the overexpression context, IRE1-mNeonGreen only forms visible puncta in just over half of all cells, despite the fact that XBP1 processing is nearly 100% effective in bulk assays. Furthermore, in the same paper we show that, rather than all IRE1 molecules being sequestered in clusters, only a small fraction (~5%) of IRE1-mNeonGreen assembles into large puncta while the remaining 95% of IRE1 stays uniformly distributed throughout the ER. Taken together, we believe that IRE1 does have the propensity to assemble into larger clusters when its expression levels are high (regardless of the tag used), but that these clusters are not strictly required for its activation. We have made significant changes to the discussion section of the manuscript to clarify the above points and directly address the apparent discrepancy between the present work and earlier studies.

      Reviewer #3:

      In this paper, the authors' aim was to test how IRE1's oligomerization state relates to its activation status without relying on ectopic overexpression. The principle underlying the work is a rather simple one, which is that, if the population of IRE1 can be labeled stochastically with either of two different fluorescent probes, then if the protein dimerizes, presuming single molecules can be visualized, correlated migration of a spot of each fluorophore should be observed for some of those dimers. Any correlated migration, maintained for long enough, will by necessity by some sort of dimer or multimer. In principle, if my math is right, the correlation should be 50% of spots of each color, assuming all the molecules are in a dimer, all molecules are labeled with one fluorophore or the other, and the koff of the fluorophores is very low. In practice, the correlation appears closer to 10%, which the authors establish using a control molecule that should not dimerize except by chance, and another for which pseudo-dimerization is enforced due to the two HALO domains used to bind the fluorophores being conjugated to the same molecule in cis. Much of the paper is devoted to establishing the fundamentals of the system. For these experiments, the authors replaced endogenous IRE1 with the HALO-tagged version to generate near-normal expression and show that the IRE1-HALO behaves similarly to endogenous. They also show that correlated migration is observed in the dimer control to a much greater extent than in the monomer.

      Using these findings, they demonstrate, in my mind quite conclusively, that IRE1 exists as a dimer even in the unstimulated state. During ER stress, the authors observe a state that is more highly ordered. Mathematical modeling suggests a transition from predominantly dimers to a mix of dimers and something more highly ordered, with tetramers being the simplest explanation. Satisfyingly, a mutation that breaks the known dimer interface causes the protein to exist solely in monomers, as does deletion of the IRE1 lumenal domain, while disrupting the oligomerization interface keeps the protein as dimers. Mutation or deletion of the kinase and RNase domains does not affect higher order status, suggesting that activation of these domains is not a prerequisite for assembly. It is clear from this that the central claims of the paper, which is that IRE1 exists in a dimer in the basal state and transitions to a higher ordered structure in the activated state, are supported. Moreover, the general approach is likely to be appealing to the study of other molecules activated by multimerization.

      We thank the reviewer for this thoughtful and helpful analysis of our work.

      The principal advance of the paper is the technological approach for tracking IRE1 (and, presumably, other molecules whose activity is regulated by dimerization). The approach is quite elegant for that purpose. Its impact in terms of conclusions about IRE1 is perhaps less clear. The authors rationalize their endogenous-replacement approach by describing how their previous efforts and those of others relied on ectopic overexpression of GFP-tagged IRE1. The authors take great pains to claim that the observed multimerization status of the IRE1-HALO constructs is not a function of expression level, which would imply then that expression level alone is not responsible for the previously observed IRE1 oligomeric puncta. It is not clear why exactly the authors' results differ from this group's previous studies on the topic nor where the truth lies, including whether something inherent to the GFP-tagged overexpression approach favors non-physiologic structures, whether the difference is fundamentally one of cell type, or whether multimerization and activation are correlated but not causally related, with multimer-breaking mutations killing IRE1 by some other mechanism.

      The question of reconciling our present data with earlier work (including work from our group) is clearly and understandably a central question for all three reviewers. As we detailed above in our responses to reviewers 1 and 2, we are convinced that the formation of large IRE1 clusters is largely dependent on expression level rather than the differences between fluorescent protein tags and the HaloTag. We added new supplementary figures and substantially revised the text of the manuscript to address this question directly.

      Interpreting the data is also complicated by the fact that, while the authors point out that the percent of correlated trajectories (i.e., the measurement of multimerization state) does not itself correlate with expression level (using trajectories-per-movie as a proxy), the proper conclusion from that lack of correlation is not that variance in expression level does not account for the changes in apparent multimerization status, but instead that it cannot be the only factor. In some sense, the authors are attempting to play the argument both ways, by arguing that expression level matters for IRE1 activation (from previous studies) and that it doesn't (from this study). I think to address this the authors will need to better account, one way or another, for why the findings presented here differ from their previous findings and why these are the more salient (if in fact they are).

      This is a very important point, and we thank the reviewer for raising it. We are not arguing that expression levels do not matter for the formation of oligomers; quite the contrary, as detailed above and in the revised version of the text, we believe that the formation of massive IRE1 oligomers observed in previous studies and in the new Figure 1 – Figure Supplement 3 is mainly a function of elevated concentration. What we do claim is that our approach can reliably pick out oligomeric differences within the relatively narrow range of concentrations used for single-particle tracking experiments in this paper. We are using the very weak truncated CMVd3 promoter in all transient transfection experiments, and we are only analyzing data from cells that have a comparable density of single-molecule spots to the density we observe in endogenously tagged IRE1-HaloTag cells. In fact, the metric of “trajectories per movie” used as a proxy for expression levels in Figure 5 – Figure Supplement 1 is an overestimation of the true variability of expression levels, since each movie only covers a small fraction of each cell’s area and the number of observed molecules varies depending on cell morphology. Practically speaking, all cells that we image have expression levels that are clustered together rather narrowly, roughly within differences of no more than a factor of 3. These levels, in turn, are significantly lower than the expression levels used in earlier papers by our group and others.

      The other somewhat substantial issue is that there is no control for what higher order structures look like. The authors give no sense for the dynamic range of the multimerization assay. I would presume that tetramers would show a higher percentage of correlated trajectories than dimers, and octamers higher still, and that the mathematical model accounts for this theoretical possibility in calculating an average protomer number of 2.7 in the stress condition, but it would be better to see that in practice; at first glance it would seem that engineering a tetrameric and/or higher order control and validating it would be straightforward.

      This is another great point raised by all reviewers. In the revised version of the manuscript, we engineered a new tetrameric control construct (See Figure 2 – Figure Supplement 1), the results from which agree remarkably well with the mathematical model we developed in the original version of the manuscript (see Figure 2 – Figure Supplement 3)

      Lastly, the data analysis lacks statistical justification for its conclusions. I presume given the high number of readings that the observed changes are all statistically significant, but that should be indicated, as in most cases the 95% confidence intervals shown are overlapping.

      This is another excellent point. The reviewer is correct that all relevant conclusions are statistically supported by the data, and our analysis code immediately calculates pairwise p- values for every plot using one of several relevant tests. Our preferred test is the permutation test, since it makes no assumptions about the underlying distributions being compared. To avoid cluttering the main plots, we have included tables of pairwise p-values for each plot in the revised version of the manuscript.

    2. Reviewer #1 (Public Review): 

      In this manuscript, the authors sought to define the early events associated with activation of the ER stress-responsive membrane protein IRE1. Towards that aim, they used CRISPR to integrate a HALO tag into the genomic locus of IRE1 at the C-terminus of the protein. The authors then adapted a single molecule fluorescence microscopy approach where the HALO tag is liganded with two different fluorophores to define the oligomeric state of membrane proteins in cellular models. They validated this approach using ER membrane proteins containing defined number of HALO tags (single or double) and imaged with oblique angle illumination microscopy to confirm their ability to detect effect monomer and dimers of these tags. Using this approach with IRE1, they showed that in the absence of stress, there is a high fraction of apparent IRE1 dimers in the membrane. In response to ER stress, this oligomer size (calculated by correlated trajectories) increased, suggesting that ER stress promotes IRE1 oligomerization, eventually returning to dimers at longer treatment times. Intriguingly, using the ER stressor thapsigargin, the authors indicate that oligomerization precedes auto-phosphorylation of IRE1, suggesting that oligomerization is a key step in the activation of this enzyme. Extending this, the authors then transition to an overexpression model where they incorporate IRE1 constructs containing mutant that disrupt specific parts of the protein or prevent dimeric or oligomeric interactions to probe their importance in this early oligomerization observed in response to ER stress. This demonstrated that the oligomerization was primarily dictated by the ER luminal domain and involved two distinct interfaces specifically required for IRE1 dimer formation (in the absence of stress) and oligomer formation (following ER stress). Ultimately, with these results, the authors propose a model whereby IRE1 exists primarily as a autophosphorylation-deficient, back-to-back dimer that upon ER stress oligomerizes to a phosphorylation competent oligomer that allow autophosphorylations and IRE1 activation. 

      Overall this is an interesting approach and study to define early stages of IRE1 activation. Notably, it reveals a different model of these early stages of IRE1 activation than those previously reported by this group and others using GFP-tagged IRE1 overexpression constructs (something that was enabled by the integration of HALO tags into the genomic locus). The experiments are well performed and the data appear to all be interpreted correctly, although there are a few remaining questions that should still be addressed.

    3. Reviewer #2 (Public Review): 

      The authors investigated changes in the unstressed and stressed oligomeric states of the mammalian endoplasmic reticulum (ER) stress sensor, IRE1a. Previous biochemical and microscopy studies in mammalian cells and studies of the related protein Ire1 in yeast, describe an increase in oligomerization of the stress sensor upon treatment of cells with chemical agents that impair the ER protein folding environment. The general view has been that IRE1 in unstressed cells is a monomer and varying degrees of misfolded protein stress stimulate dimerization, activation, and higher order oligomerization. Distinguishing between monomers and dimers, as well as tetramers or other small oligomers is technically challenging, especially for integral membrane proteins. To address this challenge, the authors turned to single particle tracking fluorescence microscopy of Halo-tagged endogenous IRE1. Using a clever combination of random labeling with two fluorescent dyes and oblique angle illumination to visualize single molecules, as well as dimers, the authors surprisingly find that their endogenous IRE1 reporter appears to be dimeric in homeostatic cells. This observation challenges the predominant model in which IRE1 is monomeric in unstressed cells and that even dimerization represents a switch into an active state. The authors claim to detect evidence for higher order oligomers following treatment with stressors. The authors then use a series of IRE1 mutants to identify how oligomerization is regulated and present a new model to reconcile the different models of IRE1 activation in the literature. 

      The authors have extensively characterized their novel experimental system in terms of protein expression levels, functionality, and ability to distinguish monomers and dimers. The data are well presented and the authors are clearly familiar with the arguments that have surrounded the IRE1 oligomer question. That the authors observe the characteristic XBP1 mRNA splicing activity in the absence of visible large IRE1 clusters may suggest that the large clusters reported by others may have distinct roles, perhaps in more permissive mRNA cleavage. 

      The present study is undermined by two major weaknesses. First, while the authors persuasively demonstrate that they can detect IRE1a dimers, a major claim of the manuscript rests upon detection of tetramers and possibly higher order oligomers. Unfortunately, the authors provide no independent controls to show what tetramer or higher order oligomer data would look like. Thus, the authors can only infer that higher order oligomers are detected, based on modest shifts in the percent of correlated particle trajectories observed in some cells. More robust evidence is needed to make claims of oligomerization. Tools have been developed by others that can induce reversible oligomerization of proteins. Application of these tools would provide powerful controls for tetramers or even higher order oligomers in this study. 

      The second, deeper concern, is the discrepancy between the Halo Tag clustering results in this study and studies by this lab and several other labs that report a distinct stress phenotype. In mammalian cells and yeast, IRE1 and Ire1, tagged with different fluorescent proteins or even a small HA peptide epitope tag, undergo quantitative visible formation of puncta or clusters upon treatment with stressors. The small number of bright clusters that form effectively deplete the rest of the ER of IRE1 signal. In the present study, the authors observe no visible change in IRE1-Halo localization in stress cells. The authors do not investigate the cause of this difference. While one might argue that the presence of stress-inducible IRE1 activity is sufficient to argue that the reporter in this study is functional, IRE1 reporters (that do cluster) described in previous studies by the Walter lab and other groups are also demonstrably functional. Does IRE1 normally cluster? Is it cell-type dependent? Tag-dependent? Notably, the Pincus et al. PLoS Biology paper from the Walter lab used two different fluorescent protein tags that do not heterozygously dimerize. Robust colocalization and FRET signals were detected upon treatment of cells with stressors and clustering was subsequently observed. A 2007 Journal of Cell Biology study from Kimata et al. reported clustering in yeast with an Ire1 tagged with an HA epitope peptide. The HA peptide seems unlikely to be prone to any oligomerization propensities that GFP tagged reporters might experience. Importantly, a 2020 PNAS paper from the Walter lab (Belyy et al.) studied clustering of a robustly monomeric mNeonGreen-tagged IRE1 in U2-OS cells and mouse embryonic fibroblasts and this construct readily clustered following stress induction. 

      When evaluated against the backdrop of the extensive literature describing the visual behavior of IRE1a in live cells, the absence of stress-induced clustering is both puzzling and disconcerting. Given the focus of this study is to use visual techniques to study IRE1a interactions, the burden of proof is on the authors to resolve this significant discrepancy with the rest of the IRE1a literature. One can easily imagine that incorporation of the majority of the pool of IRE1a into 10-100 clusters could produce very different correlated trajectory behavior. Until the authors can determine why their reporters behave differently from other IRE1a reporters and establish which version accurately reflects physiologic IRE1a behavior, the potential impact of the findings of this manuscript are of unknown value.

    1. SciScore for 10.1101/2022.04.12.22273675: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: This study was approved by the institutional review board at Emory University under protocols STUDY00000260, 00022371, and 00045821.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">anti-SARS monoclonal antibody CR302240 was generously provided by Jens Wrammert</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Spike Trimer Capture ELISA: The following ELISA was adapted from previously published methods17: 96-well half area, high binding plates (Corning #3690) were coated with anti-6x-His-tag monoclonal antibody (#MA1-21315MG, ThermoFisher) at 2 µg /mL in PBS at 4°C overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-6x-His-tag</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Approximately one million viable PBMCs were stained with Zombie aqua fixable cell viability dye (BioLegend) to exclude dead cells; washed with PBS containing 2% FBS, referred to as FACS buffer; surface-stained with the following fluorescent monoclonal antibodies: CD3 (clone SK7, BioLegend),</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After washing with FACS buffer and fixing and permeabilizing cells with Cytofix/Cytoperm (BD Biosciences), the cells were stained intracellularly with the following fluorescent monoclonal antibodies: CD154 (clone CD40L 24-31, BioLegend),</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD154</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After washing with FACS buffer and fixing and permeabilizing cells with Cytofix/Cytoperm (BD Biosciences), the cells were stained intracellularly with the following fluorescent monoclonal antibodies: CD154 (clone CD40L 24-31, BioLegend), IL-2 (clone MQ1-17H12, BD Biosciences), IFN-γ (clone 4S.B3, eBioscience), TNF (clone Mab11, BD Biosciences).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IL-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IFN-γ</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>TNF</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">IFN-γ spots were detected with biotinylated murine anti-human IFN-γ antibody (clone 7-B6-1, Mabtech), followed by incubation with streptavidin-HRP (BD) and then developed using AEC substrate (EMD Millipore).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IFN-γ</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A HeLa cell line transduced to stably express the human ACE2 receptor (ACE2-HeLa) was generously provided by David Nemazee17.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HeLa</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Wuhan-Hu-1 spike trimer protein expression: Spike trimer plasmids were transiently transfected into Expi293 cells (ThermoFisher) with 5 mM kifunensine (Mfr), purified with His-Trap columns (Cytiva), trimers selected with a Superdex 200 gel filtration column (Mfr), and finished product dialyzed into 20 mM Tris pH 8.0, 200 mM sodium chloride, 0.02% sodium azide by the BioExpression and Fermentation Facility at the University of Georgia.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Expi293</div><div>suggested: RRID:CVCL_D615)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudovirus production: Pseudoviruses were produced by seeding 16 million 293T cells (ATCC CRL-3216) into DMEM with 10% heat-inactivated FBS and 1% GlutaMAX (ThermoFisher) (DMEM-10) in a T-150 flask the night prior to transfection and incubating at 37°C in a humidified 5% CO2 incubator.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">DMEM-10 media was then removed from plates with cells and 50 µl pseudovirus dilutions added onto ACE2-HeLa cells and incubated for two hours at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2-HeLa</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmids pCMV ΔR8.2 (</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV ΔR8.2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmid nCoV-2P-F3CH2S43 expressing a His-tagged, pre-fusion stabilized SARS-CoV-2 spike trimer from Wuhan-Hu-1 isolate was generously provided by Jason McLellan.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>nCoV-2P-F3CH2S43</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">On the day of transfection, the HIV-1 lentiviral packaging plasmid, pCMV R8.2 (17.5</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV</div><div>suggested: RRID:Addgene_16459)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sequences from immunocompromised patients were aligned with 301 reference sequences collected from patients within the Emory Healthcare System between 1/1/2021 and 4/30/2021 using MAFFT as implemented in geneious (geneious.com).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MAFFT</div><div>suggested: (MAFFT, RRID:SCR_011811)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A maximum-likelihood tree was constructed using a general time reversible model with empirical base frequencies and a 3 rate model in IQ-TREE version 2.0 with 1,000 ultrafast boostraps38 and visualized in FigTree (http://tree.bio.ed.ac.uk/software/figtree).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IQ-TREE</div><div>suggested: (IQ-TREE, RRID:SCR_017254)</div></div><div style="margin-bottom:8px"><div>FigTree</div><div>suggested: (FigTree, RRID:SCR_008515)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To identify iSNVs, reads were mapped to reference sequence NC_045512.1 using minimap2, variants were called using vphaser2 with maximum strand bias of 5, and variants annotated with SNPeff, all as implemented in viral-ngs version 2.1.19.0-rc119.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SNPeff</div><div>suggested: (SnpEff, RRID:SCR_005191)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To ascertain a precise endpoint titer (ET), curve data (best fit values for the bottom, top, logEC50, and hill slope) were processed by a MATLAB program designed to determine the sample dilution at which each regression curve intersected the healthy control cutoff value.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MATLAB</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After washing with FACS buffer and fixing and permeabilizing cells with Cytofix/Cytoperm (BD Biosciences), the cells were stained intracellularly with the following fluorescent monoclonal antibodies: CD154 (clone CD40L 24-31, BioLegend), IL-2 (clone MQ1-17H12, BD Biosciences), IFN-γ (clone 4S.B3, eBioscience), TNF (clone Mab11, BD Biosciences).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BD Biosciences</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Flow cytometry data were collected on an LSR Fortessa (BD Biosciences) and analyzed using FlowJo software V10 (Tree Star).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.

      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:


      Limitations to our study include a small number of patients and the use of convenience samples. Larger clinical studies in immunocompromised populations are needed, including serial sampling to further elucidate therapies that promote immune evasion. Our work and others’ emphasize the need to both protect immunocompromised patients from acquiring infection, and to prevent the forward spread of viruses with immune escape mutations. Such needs might be met with broad spectrum monoclonal antibodies and next generation SARS-CoV-2 vaccines that induce potent neutralizing antibody responses to prevent infection and memory CD8+ T cell responses to control breakthrough.


      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.04.19.488806: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">16 Anti-His tag and microtubule-associated protein 1 light chain 3 beta (LC3) Antibodies were purchased from Millipore Sigma (Burlington, MA, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>16 Anti-His tag</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>microtubule-associated protein 1 light chain 3 beta (LC3) Antibodies</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-Adipose Differentiation-Related Protein (ADRP, or Perilipin-2, PLIN2), Nrf2, prostaglandin E synthase 2 (PTGS2), and PI3K-beta antibodies were obtained from ProteinTech (Rosemont, IL, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-Adipose Differentiation-Related Protein ( ADRP</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>PLIN2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Nrf2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>PTGS2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>PI3K-beta</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-ATG7 antibody was purchased from Abcam (Waltham, MA, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-ATG7</div><div>suggested: (Abcam Cat# 2054-1, RRID:AB_991677)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-SRB1 antibody was obtained from Novus (Centennial, CO, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-SRB1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-Fth1, HRP-anti-rabbit or mouse secondary antibodies, and RIPA lysis buffer were obtained from Santa Cruz Biotech (Dallas, TX, USA)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-Fth1 , HRP-anti-rabbit or mouse secondary antibodies</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Anti-Fth1 ,</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>HRP-anti-rabbit</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Palmitic acid (PA)-induced lipotoxicity assay: The HEK293, HEK_pcDNA and HEK_Spike cells were cultured in a 96-well plate and reached 80% confluence on the next day before treatment.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>HEK_Spike</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">H9C2 cells (ATCC, Manassas, VA, USA) were cultured in DMEM (10% FBS) medium in a 96 well-plate with 80% confluence.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>H9C2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">16 The sequence was cloned into a pcDNA3.1 vector to obtain pcDNA-Spike.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The individual colonies with stable integration of the pcDNA-Spike (HEK_Spike) or pcDNA vector (HEK_pcDNA) were selected and expanded.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA-Spike</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pcDNA</div><div>suggested: RRID:Addgene_66792)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viral production and H9C2 cell culture: The Spike gene was cleaved from pcDNA-Spike plasmid and cloned into lentiviral vector pLV-mCherry (Addgene, Watertown, MA, USA) with removal of mCherry gene to generate pLV-Spike plasmid.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLV-Spike</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The control virus with VSV-G as the tropism and expression of mCherry was generated by co-transfection of pLV-mCherry and pMD2.G vector (Addgene, Watertown, MA, USA) into the Phoenix cells, which was referred to as VSV-G virus.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLV-mCherry</div><div>suggested: RRID:Addgene_36084)</div></div><div style="margin-bottom:8px"><div>pMD2.G</div><div>suggested: RRID:Addgene_12259)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.04.19.488067: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Each Newick file is parsed by a python script which generates a CSV file of edges in the TAG.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>python</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Another option is to use Gephi, but to use this tool, users need to start listening for data streams in Gephi before executing an APOC graph streaming query to push the data to the app.[6] Alternatively, users can connect using the Neo4j plugin for Cytoscape.[7] We found this option to be the most intuitive and sustainable for ad-hoc visualization since you can remotely connect to the graph using a read only user account on the database.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gephi</div><div>suggested: (Gephi, RRID:SCR_004293)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.04.19.488843: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: All animal experiments were approved by the Academia Sinica Institutional Animal Care and Use Committee (IACUC protocol No.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Four- to six-week-old female BALB/c mice were immunized with 5 μg of the Kappa spike and RBD mRNA-LNP by intramuscular (I.M.) injection.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-RBD and control antibodies were added to the plates and incubated for 1 h at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-RBD</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then, the cells were washed and horseradish peroxidase-conjugated anti-human antibody (1:2000) was added for 1 h at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human antibody</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After four inoculations with the same concentration of mRNA-LNP, the splenocytes from immunized mice were harvested and fused with mouse myeloma NS-1 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NS-1</div><div>suggested: RRID:CVCL_IV58)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The pseudovirus neutralization assays were performed using HEK293T cells that expressed human ACE2 (HEK293T/hACE2)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The mixtures were then added to pre-seeded HEK293T/hACE2 cells for 24 h at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T/hACE2</div><div>suggested: RRID:CVCL_A7UK)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Four- to six-week-old female BALB/c mice were immunized with 5 μg of the Kappa spike and RBD mRNA-LNP by intramuscular (I.M.) injection.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/c</div><div>suggested: RRID:IMSR_ORNL:BALB/cRl)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The PCR products were cloned using the pGEM-T Easy Vector System (Promega) and analyzed by DNA sequencing.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pGEM-T Easy</div><div>suggested: RRID:Addgene_86229)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The resulting VH was cloned into a modified pcDNA5-FRT-Gamma1 expression vector with human IgG1 constant region.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA5-FRT-Gamma1</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Recombinant protein-based ELISA: Recombinant RBD and spike-His tag proteins for different SARS-CoV-2 variants were purchased from ACROBiosystems.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACROBiosystems</div><div>suggested: (ACRObiosystems, RRID:SCR_012550)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The half maximal inhibitory concentration (IC50) was calculated by nonlinear regression using Prism software version 8.1.0 (</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">GraphPad Software Inc.)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">From the sequences, the framework regions (FRs) and complementarity determining regions (CDRs) were defined by searching with the NCBI IgBLAST program (https://www.ncbi.nlm.nih.gov/igblast/).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgBLAST</div><div>suggested: (IgBLAST, RRID:SCR_002873)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After analyzing the structure with PyMOL software, we identified the key amino acid residues at which mutations may impact the original conformation of the CDRs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMOL</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. On 26 November 2021, WHO designated the variant B.1.1.529 a variant of concern, named Omicron, on the advice of WHO’s Technical Advisory Group on Virus Evolution (TAG-VE).  This decision was based on the evidence presented to the TAG-VE that Omicron has several mutations that may have an impact on how it behaves, for example, on how easily it spreads or the severity of illness it causes. Here is a summary of what is currently known.  
    1. I thank researchers from and for sharing information with @WHO & the world about B.1.1.529 variant that has been recently detected. We will convene our TAG-VE again today to discuss Everyone out there: do not discriminate against countries that share their findings openly
    1. Finally, among your data, if an apperance set contains any reserved roles, then the posits containing the set are classified as peridata.

      reserved roles

      peridata

    1. • When the customer's payment details are successfully authenticated by the bank, the Payment state changes to Authorized. • The amount deducted from the customer’s account by Razorpay is not settled to your account until the payment is captured, either manually or automatically. • There can be scenarios where payment is interrupted due to external factors, such as network issues or technical errors at the customer's or bank's end. In this case, the amount may get debited from the customer's bank account but the payment status is not received by Razorpay from the bank. This is termed as Late Authorization.

      check if the bullet symbol has been used, or it is ul li tag I had replaced the bullets. I hope the content has not been overwritten

    1. SciScore for 10.1101/2022.04.12.488087: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: Immunization of alpaca, construction of yeast display VHH library, and isolation of VHH yeasts specific for SARS-CoV-2 and SARS-CoV-1 spikes: The animal experiment protocol involving immunization, collection of blood samples, and construction of VHH library was approved by IACUC at NBbiolab, Inc. in Chengdu, China.<br>IACUC: Immunization of alpaca, construction of yeast display VHH library, and isolation of VHH yeasts specific for SARS-CoV-2 and SARS-CoV-1 spikes: The animal experiment protocol involving immunization, collection of blood samples, and construction of VHH library was approved by IACUC at NBbiolab, Inc. in Chengdu, China.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Eight-week-old female K18-hACE2 transgenic mice (InVivos Ptd Ltd, Lim Chu Kang, Singapore) were used for this study.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After extensive wash with cold PBS+1%FBS, the yeast clones were incubated with HA-Tag (6E2) mouse monoclonal antibody conjugated with Alexa Fluor® 488 (1:100 dilution) and eBioscience™ streptavidin conjugated with PE Conjugate (1:200 dilution) on ice for 30 min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HA-Tag</div><div>suggested: (Cell Signaling Technology Cat# 2350, RRID:AB_491023)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The cells were then fixed, permeabilized, and incubated with cross-reactive rabbit anti-SARS-CoV-N IgG (Sino Biological, Inc., China) for 1 h at room temperature before adding an HRP-conjugated goat anti-rabbit IgG antibody (Jackson ImmunoResearch, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-N IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-rabbit IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sections were then covered with rabbit anti-SARS-CoV-2 N protein monoclonal antibody (Abcam; 1:1000) for 1 h at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 N protein</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines: HEK293T cells (ATCC, CRL-3216) and HeLa cells expressing hACE2 were kindly provided by Dr. Qiang Ding at Tsinghua University.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>HeLa</div><div>suggested: CLS Cat# 300194/p772_HeLa, RRID:CVCL_0030)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sf9 cells (ATCC) were maintained at 27°C in Sf-900 II SFM medium.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Sf9</div><div>suggested: RRID:CVCL_4U10)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Expression and production of nanobodies were conducted by transfecting the expression vectors into the HEK293F cells using polyethyleneimine (PEI) (Polysciences).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293F</div><div>suggested: RRID:CVCL_6642)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Specifically, human immunodeficiency virus backbones expressing firefly luciferase (pNL4-3-R-E-luciferase) and pcDNA3.1 vector encoding either SARS-CoV-2 or sarbecovirus spike proteins were co-transfected into the HEK-293T cells (ATCC).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HeLa-ACE2 cells were then added to the mixture of nanobody-pseudovirus, incubated at 37°C for additional 48 h, and lysed for measuring luciferase-activity.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HeLa-ACE2</div><div>suggested: JCRB Cat# JCRB1845, RRID:CVCL_B3LW)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Tissues were homogenized with 0.5 mL DMEM supplemented with antibiotic and antimycotic (Gibco, Waltham, MA, USA) and titrated in Vero E6 cells using plaque assays.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Eight-week-old female K18-hACE2 transgenic mice (InVivos Ptd Ltd, Lim Chu Kang, Singapore) were used for this study.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>K18-hACE2</div><div>suggested: RRID:IMSR_GPT:T037657)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines: HEK293T cells (ATCC, CRL-3216) and HeLa cells expressing hACE2 were kindly provided by Dr. Qiang Ding at Tsinghua University.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>hACE2</div><div>suggested: RRID:Addgene_1786)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">VHH sequences were amplified by PCR, cloned into a yeast surface display vector pYD1, and introduced into the electrocompetent EBY100 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pYD1</div><div>suggested: RRID:Addgene_73447)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For the former, VHH genes were cloned into the multiple cloning sites of pMD18T containing the upstream CMV promoter, the secretory signal sequence from the mouse Ig heavy chain, and the downstream human IgG1 Fc gene fragment and SV40 poly (A) signal sequence.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pMD18T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For the latter, selected VHH genes were cloned into pVRC8400 vector with a 6xHis tag.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pVRC8400</div><div>suggested: RRID:Addgene_63163)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Specifically, human immunodeficiency virus backbones expressing firefly luciferase (pNL4-3-R-E-luciferase) and pcDNA3.1 vector encoding either SARS-CoV-2 or sarbecovirus spike proteins were co-transfected into the HEK-293T cells (ATCC).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pNL4-3-R-E-luciferase</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The IC50 values were calculated based on the reduction of 50% relative light units (Bright-Glo Luciferase Assay Vector System, Promega, USA) compared to the virus-only control, using Prism 8.0 (GraphPad Software Inc., USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Phylogenetic tree and genetic analysis of nanobodies: Neighbor-joining phylogenetic trees were generated using MEGA version 10.1.8 with 1000 bootstrap replicates 68.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MEGA</div><div>suggested: (Mega BLAST, RRID:SCR_011920)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Chord diagrams showing the germline gene usages and V/J gene pairing were analyzed and presented by the R package circlize version 0.4.13 69.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>circlize</div><div>suggested: (circlize, RRID:SCR_002141)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sequence logo were plotted using Python package Logomaker 70</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Subsequent model building and refinement were performed using COOT (PMID: 15572765) and PHENIX (PMID: 12393927), respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>COOT</div><div>suggested: (Coot, RRID:SCR_014222)</div></div><div style="margin-bottom:8px"><div>PHENIX</div><div>suggested: (Phenix, RRID:SCR_014224)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All structure figures were generated with ChimeraX and Pymol (PMID: 28158668)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ChimeraX</div><div>suggested: (UCSF ChimeraX, RRID:SCR_015872)</div></div><div style="margin-bottom:8px"><div>Pymol</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Half-maximal inhibitory concentration (IC50) of nanobodies was calculated by the equation of four-parameter dose inhibition response using Graphpad Prism 8.0.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Graphpad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. dstillman May 11, 2020 You can see JavaScript API, but there's not much documentation currently.Not tested, but running this from Tools → Developer → Run JavaScript will probably work:var items = await Zotero.Items.getAll(Zotero.Libraries.userLibraryID, true);for (let item of items) { if (!item.isRegularItem()) continue; let ids = item.getAttachments(); for (let id of ids) { let attachment = await Zotero.Items.getAsync(id); let tags = attachment.getTags(); for (let tag of tags) { item.addTag(tag.tag); } attachment.setTags([]); await item.saveTx({ skipDateModifiedUpdate: true }); await attachment.saveTx({ skipDateModifiedUpdate: true }); }}
      • EXAMPLE
    1. SciScore for 10.1101/2022.04.09.487739: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The membrane was incubated with ACE-2 Antibody (1:2,000, Novus Biologicals, CO, USA), Myc-Tag (9B11</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Myc-Tag</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The membrane was then incubated with secondary HRP-linked, Anti-rabbit IgG (1:10,000, Cell Signaling Technology, MA, USA) and Goat anti-Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, HRP (1:2,000, Thermo Fisher Scientific, MA, USA) for 1 h at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-rabbit IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-Mouse IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK293T cells were cultured in FP medium (DMEM containing 10% FBS, 2 mM GlutaMAX™ Supplement, 0.1 mM MEM Non-Essential Amino Acids, 50 U/mL and 50 μg/mL Penicillin-Streptomycin).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To establish ACE2-expressed cell line (ACE2-HEK293T cells), HEK293T cells were infected with ACE2-expressing lentivirus and ACE2-positive cells were selected by 2 ug/mL of puromycin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2-HEK293T</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For protein expression, the cell membrane penetrating peptide (TAT), red fluorescence protein (DsRed) and NK-NT or NKN1 fragments were cloned into pET6xHN-N Vector (Takara, CA, USA)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pET6xHN-N</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For ACE2-expressing lentivirus packaging, pscALPSpuro-HsACE2 (human) (Addgene, MA, USA) were co-transfected with psPAX2 and pCMV-VSV-G packaging plasmids into HEK293T cells using FuGENE 6 (Promega, WI, USA)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV-VSV-G</div><div>suggested: RRID:Addgene_8454)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For doxycycline (Dox) inducible, Spike protein pseudotyped luciferase-expressing lentivirus preparation, HEK293T cells were transfected with FUW-RLuc-T2A-PuroR(Kanarek et al., 2018) (Addgene, MA), psPAX2 and pUNO1-SARS2-S (D614G) (InvivoGen, CA) packaging plasmids using FuGENE 6.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>psPAX2</div><div>suggested: RRID:Addgene_12260)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In competition BiFC Assay, HEK293T cells were co-transfected with 0.5 μg of each construct expressed in pBiFC-VN155 (I152L) and 0.5 μg pBiFC-VC155 vectors, together with and 5 μg competitor constructs with stop codon in pBiFC-VN155 (I152L) vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pBiFC-VC155</div><div>suggested: RRID:Addgene_22011)</div></div><div style="margin-bottom:8px"><div>pBiFC-VN155</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Fluorescence images were taken at 24 h and 48 h after transfection using a Nikon fluorescence microscope and fluorescence intensity was quantified by Image J.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Image J</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.04.11.487660: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">C5 affinity maturation library construction: The sequence of C5 in phagemid pComb3XSS were used as template for library construction.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pComb3XSS</div><div>suggested: RRID:Addgene_63890)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Nanobody expression and purification: The cDNA encoding the nanobodies in the pComb3XSS vector were PCR amplified and subcloned into vector pET22b to express 6×His tagged proteins.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pET22b</div><div>suggested: RRID:Addgene_84863)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The coding cDNA of 1ZVH was chemically synthesized and subcloned into a modified phage display vector of pComb3XSS, in which the amber stop codon (TAG) were mutated to CAG to facilitate nanobody display in E. coli without gene supE, e.g. SS320(Genentech).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Genentech</div><div>suggested: (Genentech, RRID:SCR_003997)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Standard variation values were calculated using a 3-parameter logistic regression fit using Prism Software (GraphPad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were acquired using the SerialEM software on an FEI Tecnai F30 transmission electron microscope (ThermoFisher Scientific) operated at 300 kV and equipped with a Gatan K3 direct detector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SerialEM</div><div>suggested: (SerialEM, RRID:SCR_017293)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Image processing and 3D reconstruction: Drift and beam-induced motion correction were performed with MotionCor2 [61] to produce a micrograph from each movie.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MotionCor2</div><div>suggested: (MotionCor2, RRID:SCR_016499)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Contrast transfer function (CTF) fitting and phase-shift estimation were conducted with Gctf [62].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gctf</div><div>suggested: (GCTF, RRID:SCR_016500)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Local map resolution was estimated with ResMap [65].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ResMap</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">We initially fitted the templates models into the corresponding final cryo-EM map using Chimera [67], and further corrected and adjusted them manually by real-space refinement in Coot [68].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Chimera</div><div>suggested: (Chimera, RRID:SCR_002959)</div></div><div style="margin-bottom:8px"><div>Coot</div><div>suggested: (Coot, RRID:SCR_014222)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The resulting models were then refined with phenix.real_space_refine in PHENIX [69].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PHENIX</div><div>suggested: (Phenix, RRID:SCR_014224)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The final atomic models were validated with Molprobity [70, 71].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Molprobity</div><div>suggested: (MolProbity, RRID:SCR_014226)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All figures were generated with Chimera or ChimeraX [72, 73].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ChimeraX</div><div>suggested: (UCSF ChimeraX, RRID:SCR_015872)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. SciScore for 10.1101/2022.04.11.487879: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: All participants in the convalescent cohort provided informed consent for their blood products to be used for research purposes by signing the standard New York Blood Center (NYBC<br>IRB: For participants who received the SARS-CoV-2 mRNA-1273 vaccine (Moderna), whole blood, plasma and serum samples were obtained at the NIH Clinical Research Center in Bethesda, MD under protocols approved by the NIH Institutional Review Board, ClinicalTrials<br>IACUC: Animal ethics statement: Animal research was conducted under an IACUC approved protocols at the Integrated Research Facility, Frederick, Maryland, in compliance with the Animal Welfare Act and other federal statutes and regulations relating to animals and experiments involving animals.<br>Field Sample Permit: Animal ethics statement: Animal research was conducted under an IACUC approved protocols at the Integrated Research Facility, Frederick, Maryland, in compliance with the Animal Welfare Act and other federal statutes and regulations relating to animals and experiments involving animals.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Hamsterization of human monoclonal antibodies: Genomes corresponding to the mouse IgG2a heavy and light chains were aligned to the genome assembly MesAur1.0 (GCA_000349665.1) for a female Syrian golden hamster downloaded from Genbank.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">No randomization or blinding was applied to the analysis of participants’ plasma, serum or PBMC samples, but all samples were anonymized before being used in this study.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">No randomization or blinding was applied to the analysis of participants’ plasma, serum or PBMC samples, but all samples were anonymized before being used in this study.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Binding of secreted antibody to the beads was detected in the CY5 or TRED channels by capturing images at 6 min intervals over a 30 min time course.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CY5</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Shotgun mutagenesis epitope mapping of antibodies by alanine scanning: Epitope mapping was performed essentially as previously described (43), using a SARS-CoV-2 (Wuhan Hu-1 strain) S2 subunit shotgun mutagenesis mutation library, made using a full-length expression construct for the SARS-CoV-2 spike glycoprotein.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2 spike glycoprotein .</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vaccinee and convalescent plasma binding to peptides: Polyclonal IgG antibodies from plasma or sera of vaccinated, convalescent, or naïve donors were purified using the Pierce Protein G Spin Plate (Thermo Scientific).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Polyclonal IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Baculoviruses were produced by transfection of bacmid DNA into Sf9 cells and used to infect High Five cells (Life Technologies) at high (5 to 10) multiplicity of infection (MOI).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Sf9</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasma IgG reactivity to human coronaviruses and donor selection: Multiplexed beads for SARS-CoV-2, SARS-CoV-1, MERS-CoV, HCoV-OC43, HCoV-HKU1, HCoV-229E and HCoV-NL63 spike proteins, as well as CD4 as a negative control, were incubated with donor plasma diluted at 1/50, 1/250 or 1/1250 for 30 min at room temperature, then washed and stained with 2.5 μg/mL goat anti-human IgG Alexa Fluor 647 (Jackson ImmunoResearch, 109-606-170).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HCoV-229E</div><div>suggested: JCRB Cat# JCRB1838, RRID:CVCL_B3M4)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">mAbs were also expressed in-house by transient transfection of Expi293 cells (Gibco, A14527) using the ExpiFectamine 293 Transfection Kit (Gibco, A14524) according to manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Expi293</div><div>suggested: RRID:CVCL_D615)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To generate green fluorescent protein (GFP)-tagged receptor cell lines, HeLa-ACE2 cells were transduced with lentivirus encoding GFP and sorted to collect the GFPhigh/ACE2high population.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HeLa-ACE2</div><div>suggested: JCRB Cat# JCRB1845, RRID:CVCL_B3LW)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">mAbs were added to the wells at a final concentration of 200 μg/mL and cultures were further incubated at 37 °C for 1h. 8,000 GFP+/ACE2+ HeLa cells were then added to each well and the co-cultures were maintained overnight to allow for syncytia development.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HeLa</div><div>suggested: CLS Cat# 300194/p772_HeLa, RRID:CVCL_0030)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A plasmid encoding cDNA for each spike protein mutant was transfected into HEK-293T cells and allowed to express for 22 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For neutralization assays, 5 × 104 RD cells were inoculated at TCID75% OC43-GFP virus and incubated for 1h at 35°C. 4-fold serial dilutions (73 ng/mL - 300 μg/mL) of each mAb were incubated with TCID75 OC43-GFP virus for 1h at 35°C. 60 μL of mAb- virus mixture was used to inoculate each well containing 5 × 104 RD cells and cultures were incubated for 24 h at 35°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RD</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">transducing plasmid pHR’ CMV-Luc, a TMPRSS2 plasmid and full-length spike plasmids from SARS-CoV-2, SARS-CoV, MERS-CoV, HCoV-NL63 and HCoV-229E into 293T cells using Lipofectamine 3000 transfection reagent (ThermoFisher Scientific, Asheville, NC, L3000-001) (49). 293 flpin-TMPRSS2-ACE2 cells (provided by Dr. Adrian Creanga, VRC/NIH) were used for SARS-CoV-2, SARS-CoV and hCoV-NL63 while HuH7.5 cells were used for MERS-CoV and hCoV-229E neutralization assay.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HCoV-NL63</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>HuH7.5</div><div>suggested: RRID:CVCL_7927)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS: Addgene #170447; SARS2 #170442; MERS #170448; NL63 #172666; alpha strain #170451; beta #170449; gamma #170450; delta #172320; omicron 180375) were co-transfected in HEK293T with Lipofectamine 2000 (ThermoFisher Scientific, 11668019) to produce single-round infection-competent pseudoviruses.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS: Addgene #170447; SARS2 #170442; MERS #170448; NL63 #172666; alpha strain #170451; beta #170449; gamma #170450; delta #172320; omicron 180375) were co-transfected in HEK293T with Lipofectamine 2000 (ThermoFisher Scientific, 11668019) to produce single-round infection-competent pseudoviruses.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>#172666</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pre-fusion stabilized constructs for CCoV HuPn-2018 (Accession # QVL91811.1, aa1-1384 with E1140P and E1141P mutations) and PdCoV0081-4 ( Accession # MW685622.1, aa1-1092 with E854P and V855P mutations) were synthesized and cloned into pCDNA3.1- vectors (Genscript) with the following C-terminal modifications: T4 fibritin trimerization motif, HRV3C protease cleavage site, poly-GS linker, Avi-tag, and 8× His tag.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCDNA3.1-</div><div>suggested: RRID:Addgene_52535)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, the SARS-CoV-2 NTD and RBD were cloned into an in-house pFastBac vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pFastBac</div><div>suggested: RRID:Addgene_1925)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The spike S2 domain (699 to 1207 with F817P, A892P, A899P, A942P, K986P, V987P) was constructed into phCMV3 vector which contained an N-terminal secreting signal peptide, and C-terminal thrombin cleavage site and His6 tag.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>phCMV3</div><div>suggested: RRID:Addgene_173431)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 RBD, SARS- CoV-2 NTD, SARS-CoV-1 spike and SARS-CoV-1 RBD, MERS-CoV spike, OC43-CoV spike, CCoV-HuPn-2018 spike, pPDCoV-0081-4 spike, HCoV-NL63 spike, HCoV-229E spike, HCoV- HKU1 spike, H1 HA and recombinant CD4 (gifted by Gavin Wright, (35)).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pPDCoV-0081-4</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Spike-containing lentiviral pseudovirions were produced by co-transfection of packaging plasmid pCMVdR8.2,</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMVdR8.2</div><div>suggested: RRID:Addgene_8455)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">transducing plasmid pHR’ CMV-Luc, a TMPRSS2 plasmid and full-length spike plasmids from SARS-CoV-2, SARS-CoV, MERS-CoV, HCoV-NL63 and HCoV-229E into 293T cells using Lipofectamine 3000 transfection reagent (ThermoFisher Scientific, Asheville, NC, L3000-001) (49). 293 flpin-TMPRSS2-ACE2 cells (provided by Dr. Adrian Creanga, VRC/NIH) were used for SARS-CoV-2, SARS-CoV and hCoV-NL63 while HuH7.5 cells were used for MERS-CoV and hCoV-229E neutralization assay.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHR’</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>TMPRSS2</div><div>suggested: RRID:Addgene_53887)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2.5μg 2nd generation lentivirus backbone plasmid pCMV-dR8.2 dvpr (Addgene, 8455), 2μg pBOBI-FLuc (Addgene, 170674) and 1μg truncated coronavirus spike expressing plasmids (</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV-dR8.2</div><div>suggested: RRID:Addgene_8455)</div></div><div style="margin-bottom:8px"><div>pBOBI-FLuc</div><div>suggested: RRID:Addgene_170674)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Hamster genes with the highest homology to the mouse IgG2a heavy chain, lambda and kappa light chains genes were cloned into a pCDNA3.4 vector (Genscript) and expressed in Expi293 cells as described above.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCDNA3.4</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">) high-throughput flow cytometer and FACS data were analysed with FlowJo (Version 10.8.1</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Analyses of the VH and Vλ/Vκ genes, CDR3 sequences, and percentage of somatic mutations were carried out using Geneious Prime (Version 2021.0.3, https://www.geneious.com) and the International Immunogenetics Information System database (IMGT, http://www.imgt.org/) (40).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>https://www.geneious.com</div><div>suggested: (Geneious, RRID:SCR_010519)</div></div><div style="margin-bottom:8px"><div>http://www.imgt.org/</div><div>suggested: (IMGT - the international ImMunoGeneTics information system, RRID:SCR_012780)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Recombinant IgG mAbs were purified using HiTrap Protein A columns (Cytiva/GE Healthcare Life Sciences, 17040303).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Cytiva/GE Healthcare</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Phylogenetic tree generation: Full-length amino acid sequences of SARS-CoV-2 (accession #NC_045512.2), SARS-CoV (accession # AY278741.1), MERS-CoV (accession # NC_019843) , HCoV-NL63 (accession #NC_005831.2), HCoV-229E (accession #NC_002645.1), CCoV HuPn-2018 (accession #MW591993.2) and PDCov-0081-4 (accession #MW685622) were aligned using the L-INS-i method of MAFFT version 7.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MAFFT</div><div>suggested: (MAFFT, RRID:SCR_011811)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The sequence alignment was used to generate a sequence logo plot using the Weblogo 3.0 server and to color conserved amino acid residues on a pre-fusion stabilized spike protein (PDB 6VSB).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Weblogo</div><div>suggested: (WEBLOGO, RRID:SCR_010236)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Images were acquired in A488, A568 and DAPI channels using a BZ-X fluorescence microscope (KEYENCE) and processed using Fiji ImageJ (42)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Iterative model building and refinement were carried out in Coot (46) and PHENIX (47), respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Coot</div><div>suggested: (Coot, RRID:SCR_014222)</div></div><div style="margin-bottom:8px"><div>PHENIX</div><div>suggested: (Phenix, RRID:SCR_014224)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Authentic OC43-CoV-GFP virus propagation and neutralization assay: Rhabdomyosarcoma cells (RD, ATCC CCL-136) were maintained at 37°C and 5% CO2 in No-glucose DMEM (Gibco, 11966-025), supplemented with 10% HI-FBS, 4500 mg/mL glucose, 1 mM sodium pyruvate (Gibco, 11360-070), 1 mM HEPES (Gibco, 15630-080) and 50 μg/mL gentamycin (Quality Biological, 120-098-661)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Quality Biological</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">50% neutralization titers (NT50) were calculated using the dose- response-inhibition model with 5-parameter Hill slope equation in GraphPad Prism 9.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Descriptive statistics (mean ± SEM or mean ± SD) and statistical analyses were performed using Prism version 9.3.1 (GraphPad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).

      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.



      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT00001281</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Studies of Blood and Reproductive Fluids in HIV-Infected and…</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT05078905</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Vaccine Responses to SARS-CoV-2 and Other Emerging Infectiou…</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.

      Results from rtransparent:


      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a protocol registration statement.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>
    1. Are you ready to annotate?

      Hello friends, colleagues, and all others that I hope become part of the first two categories. I am Alan Levine, coming to you from central Canada. Welcome to my unorthodox workshop. I am so web old I can remember annotations in the first Mosaic browser.

      Please reply with your own introduction, and share your experience, interest in web annotation.

      Do not forget to tag all responses oer22 in this workshop !

    1. These callbacks are focused on the transactions, instead of specific model actions.

      At least I think this is talking about this as limitation/problem.

      The limitation/problem being that it's not good/useful for performing after-transaction code only for specific actions.

      But the next sentence "This is beneficial..." seems contradictory, so I'm a bit confused/unclear of what the intention is...

      Looking at this project more, it doesn't appear to solve the "after-transaction code only for specific actions" problem like I initially thought it did (and like https://github.com/grosser/ar_after_transaction does), so I believe I was mistaken. Still not sure what is meant by "instead of specific model actions". Are they claiming that "before_commit_on_create" for example is a "specific model action"? (hardly!) That seems almost identical to the (not specific enough) callbacks provided natively by Rails. Oh yeah, I guess they do point out that Rails 3 adds this functionality, so this gem is only needed for Rails 2.