Graphics
The word graphics reminds me of a computer of video game and how good the graphics are
Graphics
The word graphics reminds me of a computer of video game and how good the graphics are
_€Heys SUOT}IEIIUOS 3Y} Pip UST M,, ‘010A Bropuesnd Ure JOY
This reminds me of when my mother was pregnant with my younger sister. My aunt would always make sure my mom was good with whatever it was.
meri can, speak 'American.' If you don't like it, go back to Mexico where you
This just reminds me Trump during his debate with one of his predecessors when he asked him to speak English instead of Spanish.
Mexican dialect. From my parents and Chicanos living in the
This reminds me of China where there are many different dialects.
Humans thus objectified and pathologized could not be seen asequals, as fully entitled citizens, and least of all as “Germans.”
It reminds me of the American Constitution's 3/5 Compromise, which counted enslaved blacks as 3/5 person, from almost a century earlier. But in fact, looking over the course of human history, it is more accurate to say that racial equality [as a fact] is a new concept. After all, where there is inequality and imbalanced influence, discrimination in the interest of the majority power emerges. Nationalistic superiority was an overarching theme of WWII later on. Even today, the Chinese government's sentiments of Han superiority have forced Uighurs into labor camps. Blacks in majority-white society (or really as a minority of any nation if you consider examples of those in Japan, Korea, Philippines, Brazil, etc.) still face varying levels of discrimination everyday life, the least of which may be bias in social media like those described in the beginning of the article. So against these odds, I hope that the modern notions of racial equality will end up as a turning point of the next millennia, rather than an outlier.
Africa was considered a barbaric unity and blacks bydefinition unable to produce culture. After all development on the Africancontinent had been attributed to Aryan, Semitic, or Hamitic invaders,
One of the biggest justifications of colonization was that the Europeans were helping the African civilizations through their colonizing efforts. It reminds me of the different portrayals of Africa in postcolonial literature. In Heart of Darkness, the African people as barbaric and in need of leadership. On the other hand, Things Fall Apart is meant to accurately portray African society as a fully formed and complex civilization prior to colonialism. The latter book, interestingly, never portrays African society as perfect, but it shows how the Europeans didn't bring civilization to Africa.
It was through Aicha and Mina that I discovered
This reminds me of our discussion about Glubb. In the sense that, these accounts are coming from people who were actively involved in the events.
he nationalist struggle was a struggle for a political redistribution of the cards among the male elites.
This paragraph reminds me of a similar time period in American history, the Andrew Jackson Presidency, where white men wanted more democracy and "power to the people." Except power to the "people" meant white middle class men and no mention of women. Here we have the same issue but within a different culture where once again the nationalist movement is designed for better opportunities and experiences for men. This includes anything from more economical gain, higher status, and domination in culture/customs.
THE CONSERVATIVE CHRISTIAN COLLEGE where I used to teach, students often mentioned how much social and peer pressure there was for them to marry on graduation.
This reminds me of a lot of people I know at Central College
always checking
This reminds me of Descartes' methodic doubt, and is a good lesson to apply for our age of near limitless access to information. Whatever we find striking enough to remember could at least be doubted until the information we compartmentalize is both specific to our experience and generalizable enough to share, that way truth can be found in its application to reality as we see it and as others see it.
The infant must have basic needs met in a consistent way in order to feel that the world is a trustworthy place.
I can agree with this. It reminds me of what we learned in Fatherhood of having sensitive parents and having a secure attachment relationship between the parents and the child. In other words, the parents are able to satisfy the child’s needs in distress in a timely manner. In doing so, they create a trustworthy relationship between the parent and child because the child will learn that in distress he knows he can trust on his parents to be there.
news media’s depictions can connect and affectdifferent levels of government
This reminds me of how we discussed media bias and how the rendering of facts to fit a story influences ideas by citizens listening. In an issue with multiple levels of gov't, there is even more confusion leading to misunderstanding in citizens' minds and therefore misinformation that causes improper involvement in our democratic gov't.
Just because the website has a domain that looks legitimate does not mean that the content is reliable, of high-quality, or free of bias.
This quote reminds me a little bit of Wikipedia. When I first began completing research projects in upper elementary school, Wikipedia seemed like a great resource to use. Now understanding a little more, it seems to have a legitimate domain. However, I was taught that it does not have high-quality or unbiased information. Anyone can go on a Wikipedia page and edit it, including with false or biased information/opinions. It's interesting to see just how many websites pose as having legitimate domains. This can really impact students when they are looking to find specific research, information, etc.
ocher words, computational models, however finely perfected, are better understood as temporary states in a process of comi ng to know rather than fixed structures of knowledge.
This style of impermanent, adaptive thinking reminds me of that which Thomas Kuhn advocates for in The Structure of Scientific Revolutions. In order to build upon our knowledge of the world around us we have to be willing to accept when old systems of understanding are no longer viable and must be changed. The resulting paradigm shift ultimately elevates our knowledge on a given subject while progressing its field of work.
By writing the verb in capital letters, we mean any of the forms of the verb. In this instance, BE includes am, are, is, was, were, be, been, and being.
This reminds me of the tree diagram we went over in school when learning which one was capital and which one was lower case.
both pre- and in-service teachers have come to develop and staunchly cling to their disgust at what they perceive to be squandered opportunities. Poor children fail in schools because they are not taking advantage. Poor people exist because they wasted a good, free educa-tion. The poor themselves are the problem.
This again reminds me of the first reading's statement: "I can succeed by working hard and using my talents; if I fail, it will be my own fault." Because of this belief, teachers treat their students differently which affects their success which was also outlined in Ryan and Deci's Self Determination Theory.
10 Seen and Heard So it does not depend on the age of the teller, but on the sensitivity of the listener.
This reminds me of a foundational philosophy of RIE
Foucault’s notion of “parrhesia”—free, blatant public speech—as perhaps a better model through which to understand some kind of “educational turn” in art.
The term parrhesia is borrowed from the Greek, and Foucault introduced this concept into academic field, believing that parrhesia is extremely courageous and that one must be prepared to take risks when choosing parrhesia. This also reminds me of the concept of panopticism proposed by Foucault. In 1975, Foucault reintroduced the panopticism of Bianchin's "panopticon" in Discipline and Punish, considering it not only an architectural innovation, but also "an event in the history of human thought".
Observe (Perceive the results of just completed actions) – Review Orient (Perceive the current environment, See probabilities and possibilities ahead) – Learn & See Decide (Pick a strategy) – See Act (Get something done) – Do
This reminds me of what Bruce Lee said. Paraphrased, when fighting an opponent, one must observe your opponents fighting behavior and assess the possibilities. Decide on a combo of attacks and then implement. After you implement, you stand back and analyze/observe the results of your attack and cycle through the process again.
To withhold his commission, therefore, is an act deemed by the court not warranted by law, but violative of a vested legal right.
From what I understand about this case. it vaguely reminds me of the case of a baker who refused to bake a cake for a gay couple due to his religious beliefs. I think it made it to the state supreme court and they ruled he was within his constitutional right to refuse service. Since they ruled here that they could not force him to deliver the commissions (even though he did violate the law) did this case have any affect on the ruling of the more current case? I know that it said in a previous module that they have to follow precedent set by previous cases.
These children were speaking about the dependence on adults that arises, not from lack of competence, but from their small stature in an adult-sized world.
This line reminds me about other resources we have read since beginning this program involving how the size of adults can interfere or impose upon a child potential invitation to play for example.
A deserted cabin at Table Mountain Ranch.
Reminds me of Kaczynski's cabin. Obviously he would have been in their generation, and as an MKUltra victim, he would have been subjected to similar chemical compounds. Very curious...
And of course, both groups rejected modernity to some extent — the difference was that they did so from opposite angles
here are monsters in my bed.
Reminds me of when we were kids and thought there were monsters under the bed.
Both of the above interrogatives are also good examples of face-enhancing ques- tions, which provide the Prime Minister with the opportunity in his response to expound on recent positive Government polici
This all reminds me a lot of a courtroom.
The defeat of the Gigantes (Giants) by the gods angered Gaia even more, so she had intercourse with Tartaros and gave birth to Typhon in Cilicia. He was a mixture of man and beast, the largest and strongest of all Gaia‘s children.
This text reminds me of a situation where a powerful and wealthy father of two daughters wants to retire and settle down. But before that happens, he needs to find a worthy successor for his position. However, his daughters are fighting for their father's resources so they each look for a valuable husband with good genes that suits what the grandfather is looking for. In the end, both daughters gave birth to one child and the mother of the son got her father's blessing over the mother of the daughter. This scene that I just described was depicted from a show, and it's clear that the motive behind both the daughter's action is to claim money/status. I wonder if Gaia's intentions are in that same direction. Is she trying to be a dominant figure in order to gain validation or is there something more to this? In other words, what is her reason for wanting to overthrow everyone else --> creating a powerful child?
Contributing factors to the prevalence of burnout include the strain on the US health care system caused by increased demand for health services, due to expanded health care access; increased workloads; and the administrative burden resulting from the implementation of electronic health records [3,4,5,6].
This reminds me of the situation we are currently in with the pandemic and Covid-19. Covid-19 has effected many lives negatively but personally I feel like people who work in the medical profession were some of the people who had been impacted the most. When Covid-19 was at its peak, there would be hundreds and sometimes thousands of people being hospitalized on the daily. This put a lot of pressure on doctors, nurses, and PA's because thousands of people's lives depended on them and many people died in their care. It was emotionally taxing because they had to deal with death everyday and some of them felt as if it were their fault. Dealing with a human life is something that is very stressful and having your patients die on you can make a person experience burnout and feel like they are not good enough.
“Don’t ever say thank you,” a woman CO tells her. “That takes the power away from it.”
Bauer in this moment and choice of dialogue inclusion reminds me of Bly's encounter with the doctor. In Bly's book "Then Days in a Madhouse" when Bly refuses to open her tongue for the doctor to see he makes a point that he is in fact the doctor. In the highlighted text, it is a similar case of power dynamics and seat privilege in which the COs have a higher position and hence demand stuff rather than asking, with the expectation of ultimate submission.
models
Whenever I hear the word model, it always reminds me of the model cars i would have and how mechanics of how they work
There’s something captivating about adding specificity to a product’s process—the process’ originality, the inclusion of descriptive adjectives, the journey from initial idea to finished product.
Hypothesis: Arousing curiosity is another effctive marketing strategy.
NOTE: This reminds me of Welsch Grape Juice. The history of how it was made is printed at the back of every bottle. I always feel satisfaction reading it whenever I get tempted to buy the grape juice. And in a way, I feel like family, because the process of creating the juice was shared to me. Like, this delicious juice that I'm having was created through the process of pasteurization.
Cannot even that brief span aid me in preventing you from opposing me and ruining your country? F
Even after their death the plight of the plebs the Gracchus brothers brought up is taken up as a full political movement, reminds me a lot of the Language Caesar used.
so we call them all immigrants, which embodies the Athenian attitude that they could never “belong.”
This reminds me of reoccurring themes in Jose Vargas's Dear AmericaItalic**, the idea that despite how long one resides in a country, no matter how dedicated or committed one is, one can never truly belong.
centrality of exit logic in online community software, scholars and platform designers alike should rethink the ethics of relying on exit; perhaps they can then better identify conditions under which voice-based mechanisms are necessary to ensure accountability
This somewhat reminds me of the Instagram feature to block someone to no longer see their content (which would be exit) and another function to report a post from an individual, for which several options appear to voice feedback (voice-based). I wonder where else this has been implemented.
Educational purposes su as preserving the explanations made by ateaer, so that the pupil can refer to them at any moment,
This reminds me of learning through Zoom. I know people who'd record their lectures and play them back at a more efficient time for them.
advertising-supported broadcasting for so long—seventy years—that it iseasy to forget that this was extremely controversial and hotly debated in the1920s, condemned as a crass invasion of people’s private lives.
This reminds me of the early days of YouTube. It had no commercials, and now it plays a commercial before nearly every video. It's very irritating, so I can imagine how annoyed listeners were by advertising-supported broadcasting in the 1920's.
delphinium
I had to search this but I think it's important to note that Delphiniums are flowers that symbolize cheerfulness and goodwill but also a protective plant that symbolizes truth. Thinking about the last line in the poem of "an iron cortex" it ties into the idea of Delphiniums being a protective plant as iron is a protective metal. In regards to truth it reminds me of the last few lines and the idea of knowing rather than remaining ignorant to the worlds truths. I do question what truths exactly Millay is saying need protection? or in what way the truth protects us?
Two roads diverged in a wood, and I- I took the one less traveled by, And that has made all the difference.
This line really stuck with me because it reminds me of a quote i always heard growing up. You may be alone on your path because other people arent willing to do the work ot get where they want to be. Yet it makes all the difference because it molds you into the person youre striving to be. arriving to the destination is not the important part, the journey to get there is.
My apple trees will never get across And eat the cones under his pines, I tell him. He only says, “Good fences make good neighbors.”
The speaker is beginning to realize that there isn't really a need for the wall. There's no point of constantly going through the struggle of repairing it. The neighbor points out that the wall essentially keeps the peace between them. This reminds me of the political talk of boarders and it's as if they're two different sides of that argument.
many writers have chosen self-representation as a means to publishing
It's interesting to me that authors chose to publish through self-representation. In this case it makes sense considering the shortage of literary agents, but this instance reminds me of other creative industries, like the modeling or music industries where models can chose to work unrepresented by an agency, or 'freelance', while some musicians chose not to create with a label and make music independently.
To enter a conference, the user typed a command and the name of the conference; once "inside," she would find a series of numbered "topics," each created by a user and each repre- senting an ongoing, asynchronous conversation. She could then post her own comment in a conversation or start another topic
This setup reminds me most of Reddit, where there are different subreddits, or in this case discussion boards, where people can contribute their own ideas, either commenting under others' posts or beginning a new one. It is quite fascinating to think of the WELL as one of the first kinds of social media that people engaged in. Equally important, I find it important to address what groups of people (white, male, middle-to-upper class) initially engaged in online community and conversation, and how the beginnings of social media have influenced the way it is today. I also find it fascinating that there wasn't much advertising and actual shopping that stemmed from posting these products online, but rather more of a conversation about them and it is quite interesting to see how social media has flipped on its head to engage with consumer purchases and influencer marketing.
As when a shepherd easily carries the fleece of a wether, picking it up with one hand, and little is the burden weighting him, so Hektor lifting the stone carried it straight for the door leaves which filled the gateway ponderously close-fitted together.
As the Trojan and Achaian forces rage against each other on the blood-soaked battlefield littered with bodies from both sides, Zeus grants Hektor the glory of being the first to break the wall of the Achaians--a glory he earlier denied to another Trojan warrior, Aias. With the blessing of Zeus, Hektor rallies the Trojans, and as he approaches the gates of the Achaian wall, he lifts a great stone with the intention to break down the wall as “easily carries the fleece of a wether” by a shepherd to carry home, comparing the ease with which Hektor moves toward his destructive goal with the domesticity of the task of a shepherd in peacetime. The domestic task of a shepherd tending to his flock is paralleled with the violent work of the warrior Hektor to knock down the Achaian wall. This comparison illustrates the tension between these seemingly disparate spheres of Greek life, and so by paralleling the shepherd’s care with Hektor’s burden, Homer links pastoral life with war life and perhaps implies that the two are more closely related than they may seem. Is the work of a warrior as universal as that of a shepherd? In this way, are violence and glory expected to be as much a part of life as domesticity and home?
This connection reminds me of the epithet “shepherd of the people” which is awarded to different leaders in the war and which also overlays the realm of domestic life with that of war.
Maddie
The technique of reproduction detaches the reproduced object from the domain of tradition. By making many reproductions it substitutes a plurality of copies for a unique existence. And in permitting the reproduction to meet the beholder or listener in his own particular situation, it reactivates the object reproduced. These two processes lead to a tremendous shattering of tradition which is the obverse of the contemporary crisis and renewal of mankind.
This reminds me of the idea of character archetypes in literature. There are certain characters with recurring traits that can be found throughout many stories, both in the past and present. Although these archetypes are not completely detached from each other and their basis, they are still very different. One character could be vastly different from a character of the same archetype because they each have different backstories, experiences, and goals. In this way, even though they are both replicas of the same general archetype, they revive it by showing it in a new way.
This unique existence of the work of art determined the history to which it was subject throughout the time of its existence.
This reminds me of the word "etymology" that I learned in a different class - every word or symbol has a lineage or history behind it that gives it meaning. Similarly, without understanding the context behind a work of art or seeing the process that went into it, even a perfect reproduction can never be truly perfect.
ll legends, all mythologies and all myths, all founders of religion, and the very religions ... await their exposed resurrection,
I find this very interesting because so many stories have been recreated and trends cycle a lot so this technique has probably become even more popular now Reminds me of Disney live action remakes which hasn't been able to resurrect any of the same feelings they did before
A cause was thought of as something that brings about a disturbance in state of harmonious equilibrium in nature, and the effect as something that restores this equilibrium, much as a punishment restores the social harmony after a crime.
This reminds me of Piaget's theory of learning. A child is in equilibrium when there is a balance between assimilation and accommodation, meaning that no new change to any mental structures is needed. Disequilibrium occurs when knowledge cannot assimilated into existing structures. When this happens, accommodation is needed to return to equilibrium--that is, a cause (accommodation) is needed to have a certain effect that restore the state of equilibrium.
ow here’s a tricky one for you. This Black English use of done makes possible a tense that has pretty much gone out of white mainstream usage
Reading about different tenses reminds me of learning Spanish, which further goes to show how AAVE should be respected as its own language
supportive environment where feedback enhances their sense ofcompetence in the learning task are likely to be those studentswho learn because it is pleasurable or because it appeals to theirself-concept.
this is interesting and reminds me of the can-do statements. These should have an effect on creating an autonomy-supportive environment. I wonder if it would be interesting to research how can-do statements influence intrinsic motivation (or if this has been done before)
For women, then, poetry is not a luxury. It is a vital necessity of our existence. It forms the quality of the light within which we predicate our hopes and dreams toward survival and change, first made into language, then into idea, then into more tangible action.
Reference to the title aka main idea of the entire piece Reminds me of Sylvia Plath's poetry
. A memex is adevice in which an individual stores all his books, records,and communications, and which is mechanized so that itmay be consulted with exceeding speed and flexibility
This reminds me of cloud technology. It's interesting to think that cloud technology has only now recently become increasingly popular among individuals and companies, despite its concept being imagined for decades now. I wonder how Bush would reimagine cloud technology if he were to witness it today.
Rapid electrical counting appeared soon after the physi-cists found it desirable to count cosmic rays. For their ownpurposes the physicists promptly constructed thermionic-tube equipment capable of counting electrical impulses atthe rate of 100,000 a second.
This reminds me of the development of the world wide web by physicists at CERN to facilitate collaboration and information-sharing by scientists around the world. I think it speaks to the highly intersectional nature of early computing and hypermedia advancements. The utility of computing power made computer scientists out of researchers across the sciences and furthered discovery in these fields like never before.
And because physical traits are inherited independently of one another, knowing the range of one trait does not predict the presence of others. For example, skin color varies largely from light in the temperate areas in the north to dark in the tropical areas in the south; its intensity is not related to nose shape or hair texture.
This reminds me of the theory that human life itself originated in africa and as people migrated to different places with colder or hotter temperatures, they adjusted and generation after generation became lighter
How canI listen to the other, how can I hold a dialogu
This reminds me of my experience working with City Year. During orientation, the team facilitators made us, corps member, reflect on how we can be better listeners to our students as well as our teammates.
I do not need to hide my fears. But I mustnot allow my fears to immobilize me.
I think this is such an important sentiment. It reminds me of a quote my dad always tells me when I am nervous about something (such as giving live presentations, which always feel like they'll be the death of me), which is "confront the dragon, get the gold."
to be too far below one’s own level of competence
This reminds me of an anecdote I read about a teacher who asked the students in his classroom to raise their hand if they thought they were of above average intelligence, and ~80 percent of students in the room raised their hand. I think it is common for us to think of ourselves as having higher than average intelligence, but what is "average"? "Average" in terms of what? I like to stray from describing myself or others as "intelligent" or "smart" (or to use the word from the article, "competent") because everyone brings different types of intelligence and competence to the table. So to summarize, I agree with the importance of humility as a quality for teachers to possess, because I think it opens the gates for us to learn as much from our students as they (hopefully) learn from us.
let go of my ego and embrace discomfort by learning and unlearning, decentring myself, and re-thinking and re-designing when something isn’t working.
Personally, I can relate to this so much. This reminds me of someone in a show I follow on YouTube talking about how important it is to leave your ego at the door and be willing to be wrong about something and to say that you're wrong--and how hard that can be for all of us because we're often so invested in being right.
Relevant to Albert, Seligman (1971) hypothe-sized that the strength of human phobic reactions(i.e., their resistance to extinction) is due to thehigh degree of preparedness of certain stimuli (e.g.,snakes).
This is interesting because it reminds me of how someone would see or sense danger and move away. Is this the same thing as touching a hot pot and moving your hand away instantly?
A more serious problem' with clinicians' citingof the Albert study is the failure of Watson's con-temporaries to replicate his work. Although H. E.Jones (1930) subsequently demonstrated persistentgalvanic skin response (GSR) conditioning withan infant (using a mild electric current as an un-conditioned stimulus, and a light and varioussounds as conditioned stimuli), attempts to repli-cate the Albert study using variations of Watson'sown method were unsuccessful.
This reminds me of the term "replication crisis". The replication crisis is when studies are impossible to be replicated. This is really important that it was included in the reading. Prior to reading this, I have never thought about variations of Watson's method being unsuccessful. This shows the importance of doing research. This also put conditioning in a new light for me.
Take tiny breaks when working, to go longer than most
Reminds me of the Pomodoro method. 25 min of work, 5 min of break (real break) Found an Android App yesterday that looked quite cool, but I've never tried the method so far. Usually I'll take breaks naturally.
more like an accelerated passage in a long evolution.
The cadence here reminds me of Donne's "XIV. MEDITATION":
If we consider Eternity, into that, Tyme never entred; Eternity is not an everlasting flux of Tyme; but Tyme is a short parenthesis in a longe period; and Eternity had been the same, as it is, though time had never beene.
e Nandi an
Among the Nandi an occupational definition of time evolved covering not only each hour but half hours of the day.
This reminds me of hearing attorneys journaling their day down to 7 1/2 minute increments for billing their clients.
But based on science and with computers, we're now able to discriminate things down to the time it takes atoms to vibrate and we can date and timestamp things in our worklives to the nth degree. Even this post will have a timestamp on it down to the thousandth of a second.
When the uneaten seeds eventually grow, they are clustered, accounting for the typical distribution pattern of whitebark pine in the forest.
This reminds me of how squirrels will bury their nuts for later! Though they can often forget where they buried them.
run all risks, and incur all consequences, rather than submit
resistance-reminds me of all of the acts of native resistance from Gord Hill's book
that the 'governors' of 'quasi-states' decry Western interventions by insisting upon the sanctity of the doctrine of non-interference when such interference is intended to implement international standards.
reminds me of The White Man's Burden
a majestic, tumbledown edifice that looked much like a stable fallen upon hard times, “Gs my ancestral land.”
This reminds me of the beginning of "In the Cart." There, Chekhov introduces us to Marya through the contradictions between her attitude and the attitude our narrator deems appropriate for the weather conditions. Here, the disagreement characterizing Dunraven is a little more extreme. Dunraven introduces his "ancestral land" as if he's inherited the stars, but it's an undeniable reality that it's actually a sparse patch of land and a collapsing building. Borges emphasizes this effect when writing about the building by placing Dunraven's perceptions and reality side by side. The phrase "majestic, tumbledown edifice" flip-flops like crazy. "Majestic" and "edifice" (which is usually used for large buildings) clearly fit Dunraven's vision, but "tumbledown" splits them up with its completely contradictory meaning. In the end, reality wins out, and we learn that this structure actually looks "like a stable fallen upon hard times."
I put it in my pocket to keep it safe. Yet notwithstanding, somebody stole it, but put five Indian corns in the room of it; which corns were the greatest provisions I had in my travel for one day.
vaguely reminds me of the De Vaca writing when they talked about eating raw meat so that it wasn't stolen from them by someone who smelled the cooked meat
no reading can ever exhaust the full potential [of a text], for each reader will fill in the gaps in his own way”
This reminds me of why my parents always had a policy when I was younger to "read the book before watching the movie." The space left between the lines in a text allow for someone to really imagine and make the story unique to them, and it's a lot different than watching a movie where everything is laid out for you to just passively consume. I wonder if there are Harry Potter fans who haven't read the books but have watched the movies, who might be missing out on contextual evidence for other people's interpretations of the text and if that could be a reason why there is such a divide between fans - because the movies are supposedly so strictly adherent to JK Rowling's interpretation of the books. I have neither read the books nor watched the movies so I don't know how true that statement is, but I believe it was mentioned in the Vanity Fair article "JK Rowling's Tweet Shows the Divide Between the Writer and the Phenomenon She Created."
knock your child
reminds me of a video where in a herd of horses, one foal couldn't stand so the male of the herd managed to grab it by the neck and flung it around until it died. The mare had tried in vain to get the foal standing and then protect it from the male.
least crumb of refreshing that came within either of our mouths
just reminds me of De Vaca's account of the tribes going without food for a few days in a row and it just being how they are.
Nothing; but you must learn ·what I thought you already knew. George, you cannot marry me; the laws forbid it! GEORGE. Forbid it? ZOE. There is a gulf between us, as wide as your love -as deep as my despair; but, oh, say you will pity me! That you will not throw me from you like a poisonous thing! GEORGE. Zoe, explain yourself-your language fills me with fear. ZOE. George, do you see that hand you hold? Look at these fingers; do you see the nails are of a ... bluish tinge? GEORGE. Yes, near the quick there is a faint blue mark. ZOE. Look in my eyes; is not the same color in the white? GEORGE. It is their beauty. ZOE. No! That -that is the dark, fatal mark of Cain. Of the blood that feeds my heart, one drop in eight is black -bright red as the rest may be, that one drop poisons all the rest; those seven bright drops give me love like yours -hope like yours -ambition like yours -passions hung from life like dewdrops on morning Howers; but the one black drop gives me despair, for I'm an unclean thing -I'm an octoroon
this reminds me of a modern day forbidden love story like Romeo and Juliet just with a twist...their love is forbidden because he cannot marry someone that has one-eight percent of black...it just shows how far behind the times were, whereas people of color weren't judged by their character but rather by the color of their skin. George seemed to overlook that because he fell in love with the context of her character and that's what won his heart overall.
BJJ. So I think I fucked up. I had this really a.mazing concept for how this would all work with my limited resources and then -Pu\Y\'vRIGHT. I grossly underestimated the amount of white men I actually would need here
I am really digging the self-awareness, stream of consciousness nature of this adaptation. This reminds me of the Grotowski / Woyzeck discussion board post we did about keeping theatre unique and relevant. Nothing is more unique to theatre than the "aliveness" of it. If someone said this same line I highlighted in a film, maybe I would crack a smile. But hearing it live makes it funnier and more palpable. BJJ breaking the fourth wall with his candid, charming personality is what gives this adaptation a boost over the original. The audience feels like a character in the play as well, creating a more casual atmosphere, but not in a negative way. Naturally, one feels more invested in a story they are a part of, which is what BJJ accomplishes here.
Over the next two decades, the United States would become increasingly involved in international politics, particularly in Latin America. These new conflicts and ensuing territorial problems forced Americans to confront the ideological elements of imperialism.
This reminds me of the image above, and that image makes me think, once with the native Americans and their sacred land wasn't enough, they did plentiful times.
https://jamesg.blog/2021/08/24/ordering-espresso-at-cafes
This reminds me that I ought to be more adventurous in cafes myself. Of course the pandemic ending could help in that area as well.
O, the recorders! let me see one. To withdraw with you:--why do you go about to recover the wind of me, as if you would drive me into a toil?
He reminds me of one of my students, going round and round answering a question or admitting fault to someone. It is interesting how he has a different personality and allowable shared information depending on the person that he is with, seems someone could have a hard time with that and mix up some information or give up something that shouldn't be given up to that particular person.
She takes hold of her large, black-framed eyeglasses and with a smooth gesture of her slender, delicate hand adjusts them in a fashion that reminds me of a librarian.
showing describing the individual being interviewed
abrain scanner that produces images of the human mind in action and is said to reveal signs thata suspect remembers details of the crime in question
i find it hard to believe this could be reliable - it reminds me of our discussion in class about people seeing a portion of the brain "light up" and coming to erroneous conclusions about what could be causing that activiy.
And so,in theory anything that can be done with a computer can also be done with a network of MCP neurons.
Reminds me of the many possibilities technology such as this can help improve even our own brain capabilities sometime in the future
being flexible, thinking quickly, sustaining the confidence of your people in uncertain times, and creating rules that work for individuals from widely diverse backgrounds” (Baron, 1999, p. xiv-xv).
This reminds me so much of classroom teaching. When I was getting my master's degree, the professor that did my observations wrote FLEXIBLE, FLEXIBLE, FLEXIBLE at the bottom of my last observation because without fail every observation that she tried to perform came with a set of challenges (testing day so the school wouldn't let her in for example). I am strongly a type A personality, so that was a hard one for me to learn.
Leadership has been described “in essence, a process: a series of actions and interactions among leaders and followers which lead to the attainment of group goals”
This reminds me of a quote by a late mentor of mine: "Success is the attainment of goals you create for yourself." - Howard Terry
Wren's definition of leadership is the actions and interactions of success. This is similar to my working definition thus far. I haven't thought about Mr. Terry in many years, but can see through my working definition of leadership that his influence played a role in how I view success and leadership in my own life.
your raving women's cries your army on the march
this reminds me of something that was talked about in crash course. How before the songs of Dionysus became theatre, women would worship this god by going out in the night and slaughtering an animal.
ll the evidence indicates that there is still blatant discrimination in employment, >firms. ®eesing, education, the media, the courts and in everyday interaction. Despite the passing ae = Gvil Rights legislation, despi
I also brought this up in last weeks annotation, but this reminds me of the lawsuit that was brought up at a nearby school due to students being discriminated against due to their usage of AAVE.
Reminds me of the reading about discourses and how we talk to teachers, parents, friends, and significant others all differently.
This reminds me of our student discussion on how there was no set definition for what SAE is, or who came up with that other than upper-middle class/old boring white people.
Imagining the future is a kind of nostalgia, because humans predict what the future will be like by using their memories.
The author is asking the audience to predict the future by looking at the past. This first line already reminds me of Toni Morrison's piece "Be your own Story" from last week where she was telling her audience the same thing: the past holds the answers to the future
But memory also helps people predict what it will be like to do things they haven’t done before.
This line reminds me of how I do almost the exact same thing over and over every single day between daily routines, going to class, and going to work. So it would be easy to predict what happens next. But if we are talking about years from now it might be a little less likely that everything will be the same. I know years from now I will be doing something I never done before.
c
That's why our admin is always reminding us to write the children's learning narratives through a strengths-based lens. It also reminds me of a quote shared by one of my colleagues: when her young daughter was telling someone about her little brother, she was trying to say "he was born with disabilities," but instead said "he was born with possibilities." Viewing disabilities as possibilities shifts thinking from what a child can't do to what a child is capable of if the adults in their lives pause and reflect on them as individuals.
transfiguration
this reminds me of Junji ito's uzumaki and the chapter in which a man disfigures his body in pursuit of a perfect shape
Italian Renaissance Saint Sebastian
This entire section reminds me of one of the main symbols of christianity and how gruesome Jesus on the cross can be depicted. It's a horrific act but is often displayed in beautiful stained glass or sculptures
pornographic.
reminds me of horror movies that mainly consist of horrific violence against women
imagine what life would be like in astate of nature
For some reason, this reminds me of Bandura's Stanford Prison Experiment.. He said one of its purposes was to find out if humans are naturally "evil".. and whether altruistic behavior is developmental rather than (at least partially) innate. Participants who were assigned the role of an officer were shown to abuse their power because they were unregulated and anonymous, but I remember that they may have also been encouraged by Bandura, not just unregulated. In any case, the experiment makes me think of the Abu Ghraib prisoner camp in Iraq, which completely breaks my heart.
Still, I honestly don't agree with Bandura's suggestion/ conception of human nature. Humans still feel guilt.. I like Hobbes' argument about the necessity of order nonetheless. It's common sense at this point I guess.
willingly accept the state’s sovereign authority to use power
This reminds me of last week's reading when the author discussed how politics is about the competition over power during struggles. This power is the ability to enforce their will and having the group accept it.
When states are too weak, certain parts of society may also dominate the rest of society.
I wonder why states allow themselves to become weak to that degree? The statement above reminds me of Taliban’s recent control of the weak state of Afghanistan, though I am not sure if I gave a correct example.
Set a timer and write for 5-15 minutes
This reminds me of the Pomodoro technique
eel discouraged and question our skill because we can't envision a fully-formed essay on the spot
This reminds me so much of Anne Lamott's writing "First Drafts"
his creates a passive role for the child
Reminds me of how Kath Murdoch says to "Let the children do the heavy lifting!"
Courtly love poetry featured a lady, usually married but always in some way inaccessible, who became the object of a noble knight's devotion, service, and self-sacrifice.
This reminds me of a lot of sitcoms and comedies where a main character chases a girl all at the cost of their own pride.
Women were consistently devalued and denigrated throughout most of the Middle Ages but, in the poetry of courtly love, they reigned supreme.
It's such a unique and unfortunate reality if fantastical literature sees women so highly there, but are treated so poorly in the real world. It reminds me very much of how the Amazon's were written as they independent, matriarch clan that heavily contradicted the patriarchy led world.
forces. Then they came and entered Armenia in the province of Vaspurakan and mercilessly slaughtered the Christian faithful with the edge of the sword. . . . Until that time the Arm
Although slightly unrelated, this description of the Seljuks and their supposed brutality reminds me quite extensively of the later mongol campaigns against many countries. Specifically their sacking of Baghdad, these forces would be a reckoning to both the Islamic and Christian world.
However, considering the time of this writing was during the 11th century, this was an accurate description of how a foreign, non-Christian group would be interpreted. A very Christian, somewhat Eurocentric view of events.
Each was a small library in its own right, with slabs of text arranged in monumental double columns. The Great Books of the Western World were what books should not be: an antidote to pleasure.
This reminds me that books should have massively larger margins for writing notes.
These places of possibility within ourselves are dark because they are ancient and hidden; theyhave survived and grown strong through darkness. Within these deep places, each one of usholds an incredible reserve of creativity and power, of unexamined and unrecorded emotionand feeling.
Throughout these lines Audre Lorde tells us, the audience, how each of us have the possibility of self-transformation. We are creative and powerful in our own way but only when we let our capabilities unhidden. This reminds me of another reading from a different class that has a similar idea of being scared of the unknown. However, it's nothing to be afraid about but instead turn to excitement.
Their opposition to the then dangerous thought was earnest and powerful; but, amid all their terror and affrighted vociferations against it, the alarming and revolutionary idea moved on, and the country with it.
While the appeal to patriotism is very much present throughout Douglass' speech (seeing as it was given on July fourth), this part stood out to me--here Douglass reminds his audience that the idea of independence from the British Empire was "alarming and revolutionary" at the time. It may have appeared as though it was always meant to be, but it had to be taken away from the British (this seems obvious, but is sometimes lost in all the pageantry of our country, take for example, how Benjamin Franklin wanted the fancy statue of himself, as if he had fulfilled a destiny like a god rather than participated in a reckless revolution). Oftentimes, people who err on the conservative side and fear progression use the argument that the agendas being pushed are happening at too fast a pace; that people must be more patient even when pushing for something like basic human rights. I remember reading a letter that Dr. Martin Luther King Jr. wrote to a reverend from jail arguing against the fairytale of gradual and passive, nondisruptive change for the purpose of white comfort. But back to this passage--the way I interpreted this was that he was making a connection between the right to declare independence from the British and the right to be treated equally as a Black man in America, which would hopefully sway people who argue that change has to be "gradual" and not "extreme" in order for it to be morally right.
Signs of modest self-assertion on the part of the moneyers begin to appear on bronze coins in the fi rst half of the second century BC, but the critical rupture came in 137 BC,
This reminds me of how in the aristocratic values the corruption of the aristocratic elites slowly bleed into the senate
Four years ago, I stood before you and told you my story, of the brief union between a young man from Kenya and a young woman from Kansas who weren’t well-off or well-known, but shared a belief that in America their son could achieve whatever he put his mind to
I chose this quote since it reminds me of my family my dad and mom came to America for the so called American dream just to give their kids a better chance at life than my parents did so this I relate to a lot.
he concept that different language varieties are suited to different situations can be summed up in the distinction which is often drawn between correctness and appropriateness of language.
This also reminds me of the idea of code switching, which was heavily discussed in one of my classes last year
at it is. Children from non-mainstream homes often do not get the oppor- tunities to acquire dominant secondary discourses - including those con- nected with the school - in their homes, due to their parents' lack of access to th
This reminds me of the time where I had to help tutor a young Spanish kid in English during high school and he really struggled with different "common" ideas of mannerisms in English
For part of what is wrong with Atwood's scholars of the twenty-second century is that they do not see the connection between their scholarship and their society.
This passage reminds me of some of the criticisms from Köpsell's poem. Köpsell heavily criticizes scholars who ignore the negative impact their scholarship may have on the society around them. In the second to last stanza he says, "Knowledge creates weapons" and "with a power point presentation - kill dead!" In this way, both Köpsell and Kacandes agree that this connection cannot be ignored.
But despite this understanding, and the gains made more generally in promoting workplace diversity, prejudices keep the employment prospects for neurodiverse individuals shockingly low. The cost is personal — denying individuals the chance to do meaningful work — as well as social, sending individuals to the dole queue. It also means workplaces are failing to benefit from highly valuable employees, and missing the opportunity to become better organisations in the process.
I posted this article in the class Slack for a couple of reasons. First, this particular argument reminds me of Benjamin, which we're currently reading, and how she shows that the problem of underexposure wasn't taken seriously until it interfered with capital. But, second, I also used it to point out that despite that, it's important to remember that we sometimes have to make arguments for specific audiences--i.e., that it isn't necessarily that Daley only cares about workplace productivity, or even that she prioritizes it, but that she's writing for an audience that does prioritize workplace productivity over basic humanity. So, the rhetorical situation may call for making such an argument rather than appealing to humanity, morality, or equity.
This reminds me of a Journalism class I took years ago where the teacher told the class that the Midwest accent is what most broadcasters try to go for when working since it's easily understood. I'm not sure how true that actually is, or if there was more social aspects I wasn't aware of at the time in play.
This reminds me of thinking negatively of people who use a lot of "filler words/phrases" when talking. Filler words/phrases are things you say to give your brain a second to catch up, the words "like" and "uh" are two common ones that I use.
giants who had made themselves strong by eating the flesh of those they took in battle and drinking their blood.
reminds me of wendigo legends, where wendigos were once warriors who were cut off from any food source save for their fellow people and became cannibals who over time developed and unending hunger for flesh.
the native Taino name means "Land of High Mountains" and was originally applied to the entire island of Hispaniola
reminds me again of the reality of artificial borders and the ongoing effects of colonialism
In a clock-time culture such as the United States or Canada, conscient us people would give much attention to writing down appointments on a cale sar 0 punctuality, and to investing in a watch that keeps accurate time. urther, they wou’ expect similar behavior from others. In an event-oriented cu. es con fentous people would be expected to react appropriately to ane hey demant 5 oo ed ime. They might have scheduled a meeting for 2:0U P.M., ; Eat thin aside if someone asks for their help at 1:45 p.m.
This reminds me of having "Syllabus". In the U.S., professors and teachers always send out syllabus at the beginning of the term so that everyone can arrange their schedule properly. However, in China, schedule will always change base on what's happening, so exam times and assignments due date are never settled.
6{JÍ ê{À»êTYJ°êÀwJÀêÀwYê7Y°êUY»êÀêêËYê{êÀw{»êRJrê7YêYYU»êJê»ÀJsYê§êJêªYXdq=¹ Jê«{JThÝÈêªÈÀêw{ê{ÞßtPM 'k|c.ê°JRR{À ê{YêJê¬ÀJÀê/zÐ!;êÉY»(ê{»ÀYJUêfêwY°Y»êÀwàáYê ̈Y ̈Yê{êÀâã
(SPOILER ALERT) This reminds me of chapter 2 of The Hobbit. TL;DR the Dwarves-- partial epitomes of fantasy heroes in their masculinity and hunting/weapons proclivity-- are captured in bags by trolls, and in a subversion of who tends to be the savior in fantasy at that time, it's the hobbit who bails them out. Hobbits have a proclivity for potatoes and rabbit.
To gather Paradise —
Reminds me of Blake's invocation at the beginning of "Milton"

Come into my hand
By your mild power; descending down the Nerves of my right arm From out the Portals of my Brain, where by your ministry The Eternal Great Humanity Divine planted his Paradise,
where the pattern lolls like a broken neck
This imagery reminds me of the lines/phrases "his historical neck broken...broken many professorial necks" that Adams uses in “The Dynamo and the Virgin”. I wonder why they both choose to use the imagery of broken necks? What is the symbolism in it?
It is a big, airy room, the whole floor nearly, with windows that look all ways, and air and sunshine galore. It was nursery first and then playroom and gymnasium, I should judge; for the windows are barred for little children, and there are rings and things in the walls.
This is my favorite line in the piece. (It also reminds me of Steve Martin pretending to be Micheal Caine's brother Ruprecht in Dirty Rotten Scoundrels.) This is the dividing line between John's rational and unsympathetic world (a world that values fresh air over the needs of the narrator for mental stimulation and a raison d'etre) and the narrator's ability to ignore its harmful effects. This line provides the reader with a valuable insight into the house's powerful effects on the isolated individual; it happened to the previous shut-in too... One cannot help but wonder how John could ignore the presence of those rings on the wall, the torn and smudged wallpaper? Does Gilman intend to reveal that John nudges the narrator toward mental deterioration?
I don’t know why I should write this. I don’t want to. I don’t feel able.
Gilman uses anaphora to highlight the wife is tired of being sick. She has become weaker that she isn't sure if she should write. It reminds me of Du Bois not wanting to break down the "vail" between the white and black folks. When he was younger Du Bois mention he had no intention of breaking down the wall which is similar to John's wife losing motivation to write.
I’m getting really fond of the room in spite of the wall-paper. Perhaps BECAUSE of the wall-paper. It dwells in my mind so!
At this point, John's wife is sick of the "Yellow wallpaper" which frustrates her to be in the room. I think it's interesting that the word 'because' is capitalized since it emphasizes she’s tired of following orders from John. The thought is on the back of her head 24/7. The narrator hinted the wife is trying to get a better understanding of the wall-paper. This similarity reminds me of Adam and Lansley having different thoughts to understand how the dynamo worked and how it was going to change their society.
There comes John, and I must put this away,—he hates to have me write a word.
Something I noticed in this line was that John doesn't really like his wife knowing how to write. It seems that John likes to follow old traditions which reminds me of Adam. In the "The Dynamo the Virgin" Adam was determined to learn math and science. Here, the wife seems passionate to write but knows her husband will not let her. In Du Bois passage, he mention that knowledge is power and that everyone should get an education which makes me believe that John is afraid of that.
But here I can creep smoothly on the floor, and my shoulder just fits in that long smooch around the wall, so I cannot lose my way.
The story up to this point has slowly moved away from tangible reality to an abstract conveyance of the narrator’s perspective of her mental state; this final act is so far into absurdity that it can only be perceived as some kind of allegorical abstraction rather than a literal plot. This way in which the story is told reminds me of Adam’s notions of the ways in which individual’s perception of the world is what brings its meaning. Perkins goes to great lengths in this story to portray the protagonist’s perception by engaging the reader with her moment-to-moment consciousness- almost in a stream of consciousness way- and the abstract/ enigmatic nature of the narrator’s perception helps to convey her declining mental state, successfully giving the reader a sense of how she sees the world.
John says if I don’t pick up faster he shall send me to Weir Mitchell in the fall
John holds his power and knowledge over his wife, almost treating her like a little girl. He is constantly telling her what is benefiting her and what is damaging to her. He doesn’t listen to her needs and ignores her true requests. Every time he reminds her of her health it’s almost like saying “I’m smart, a physician, and a man, so you must listen to me”. Similar to how Du Bois expresses how education does give a person something to talk about, almost as if it puts someone on a pedestal. These type of actions also remind me of the teachers Adams writes about, men who are much more educated and believe they have an advantage.
My brother is also a physician, and also of high standing, and he says the same thing.
By reading the first few lines I can infer that this couple is wealthy since they are able to have a house for the summer. This reminds me to how Du Bois talks about white wealthy people having opportunities like this. They are able to escape for a season, the wife doesn’t work (her husband forbids her). Her husband and brother are physicians. They have a life that many would have dreamed too have at the time. These are the kinds of experiences that Du Bois would not be able to have because of his race and the way people viewed him and his ancestors.
That spoils my ghostliness, I am afraid, but I don’t care—there is something strange about the house—I can feel it.
The “Ghostliness” or haunted aspect of the house reminds me of the Shadow motif in the Du Bois memoir. The haunting here is symbolic of a history of potential power in femininity which has been oppressed- the room itself acting as the physical oppressor of the main character, and her husband as the oppressor. This is like the Shadows which loom in Du Bois’ memoir and represent the powerful history of Africans that has been oppressed by white society in America. The motifs themselves (shadows and hauntings) are similar in their obscure and macabre nature, lending to the atmosphere of each narrative.
interesting- the reference to sea-waters yielding fish reminds me of biblical stories of Christ's miracles upon the waters- but here those powers of heaven are relegated to the whims of the gods
reminds me a bit of someone like Boo Radley or even, in some ways, Jesus
In this exercise, the potential of journalistic texts is explored.
Have you heard of "genre-based" pedagogy? This is whatt this kind of reminds me off. I always thought of it as pretty limiting but maybe in this scope, it makes sense.
To this I respond with a reminder that each of us is able to undermine the system of oppression by refusing to live with unchecked or unacknowledged privilege. Simply by reflecting and challenging our privileges, and working to change the system of discrimination through direct discussion, we can help to shift the status quo.
This reminds me of the Ted Talk we watched from Lillian Medville, as well as the infographic about Peggy McIntosh's work, about the necessity to first acknowledge our own privilege before we can start a dialogue about privilege and/or inclusivity.
Andinfactit seemsquiteplausibletomethatsomeversionofthisaxiom(perhaps"Evena paranoidcanhaveenemies,"utteredbyHenryKissin-ger!)8issoindeliblyinscribedinthebrainsofusbaby-boomersthatitoffersusthecontinuingillusionofpossessinga specialinsightintotheepistemologiesofenmity.Myimpression,again,isthatweareliabletoproducethisconstativeformulationasfiercelyasifit hada self-evidentimperativeforce:thenotationthatevenparanoidpeoplehaveenemiesiswieldedasifitsabsolutelynecessarycorollaryweretheinjunction,"-soyoucanneverbeparanoidenough."
this section and particularly the allusion to generational politics with 'baby boomers' reminds me of ongoing online discussions about the online left and the practice of reading every post as uncharitably as possible as part of some sort of moral crusade to have the most correct possible political opinions. paranoia and the death of nuance.
Tech companies have already begun to take significant steps to block accounts and trolls spreading disinformation about the coronavirus.
This reminds me when people were first getting the vaccine, there was a lot of tiktoks of people supposedly getting full body sort of spasms, and even though it was made as a joke, there was a lot of people who actually believed it was true and stopped themselves from getting vaccinated.
I work as a medical assistant, and this statement just reminds of what the doctors' experience inside the clinics at the time when the virus grew exponentially. I remember one of them telling me that there was days when people were actually scared to come in, and patients were always difficult to deal with when they did come in. Doctors need a lot more praise in this current world.
mocracies must advertise democracy. With-out emulating propaganda methods typical of authoritarian regimes, democracies should support literacy on democratic decisionmaking on both local and national level and on the values that guide public service and democratic processes, while strengthening anti-corruption efforts. As the democratic model has long been taken for granted, states should make a greater effort to raise individual awareness of democratic freedoms and civic responsibilities, and encourage impactful participation
This is also an important take away. This reminds me of the paper we read about readers- we need to educate the individuals, so that each individual can and will think for themselves. This is so crucial! When we have individual citizens capable of utilizing tools and researching (properly) for themselves, rather than simply watching their favorite news station or listening to their friends and family's perspective, then we can truly have progress in the form of moving forward with educated responses.
the idea of building on the capabilitypeople already had rather than telling them they had to change”
This reminds me of the common saying in the special education world to "presume competence" How are we presuming competence in ourselves and students to be "better"?
Anaked figure masturbates amid the gnarled roots of a tree
The hook provides both minor shock value and an immediate scene that the reader can envision. It reminds me of a journalistic approach to an introduction. Generally articles begin with a "lede." A lede is intended to draw in the reader by providing a description of a relevant moment that relates to the piece.
Scott disrupts this familiar depiction of the world gone wrong by observing that it rests on the assumption that there are those who mis- perceive reality and those who perceive it clearly, those with false consciousness and those with a scientific or true understanding of social reality
This reminds me of what we talked about in our last class. That is, how we believe that someone else is wrong because their "logic" is faulty. Such a belief implies that logic is purely objective, when it in fact, may not be. The question that arises from this observation is: who is to say who perceives the world clearly and who "misperceive[s] it?" How can we decipher which belief is correct?
Today, teen black girls are routinely depicted in reality television shows and music videos as hypersexual and aggressive. Such images, in contrast to white teen girl images, which most often emphasize innocence and purity, instead suggest “the overt sexuality of the black child,” and espe-cially poor black girls, drawing attention to the power of white discourse to frame cultural notions of childhood
this reminds me of an episode of dance moms where Nia is given a pretty overtly sexual dance for her age and when her mom is upset about it, TLC poses her as the instigator and villain
“I want to build a world where someone like me, a young person who controls tens of millions of dollars, is impossible,” he said.
It reminds me of the reading "Stealing a Bag of Potato Chips" because the boy was trying to resist the system and the criminalization of youth. He was trying to make a change just like mr. Jacob.
My money is mostly stocks, which means it comes from underpaying and undervaluing working-class people, and that’s impossible to disconnect from the economic legacies of Indigenous genocide and slavery,” Ms. Gelman said. “Once I realized that, I couldn’t imagine doing anything with my wealth besides redistribute it to these communities.”
This kind of reminds me of the article we just read. She would already donate but once she realized that the way she is getting her money is not good and how it looks outside of her POV she decided that there was no better way of using her money than donating.
as both a moral and economic failure
Reminds me of last classes activity when we found out how wealth is distributed in the United States and how unevenly distributed it is.
Nowadays almost all man's improvements, so called, as the building of houses and the cutting down of the forest and of all large trees, simply deform the landscape, and make it more and more tame and cheap.
reminds me of that one quote in the heise reading that had to do with progress that we went over in class.
KRISTIN [in her sleep]. His Lordship’s boots are brushed—put on the coffee—right away, right away, right...
Unless I'm missing something, plotwise, Kristin doesn't really need to be here for a lot of the play. There's a good chunk where she doesn't contribute any dialogue and is only there to sleep, which made me question why she was there at all. This bit, though, reminds me of the times in my real life where my dreams are just replays of my day at work. I feel like her sleeping on stage may actually be a sort of character exposition, as her being so exhausted and dreaming of work is indicative of her working-class status and juxtaposes her against Miss Julie.
MISS JULIE. You’re a charming storyteller, you know. Did you go toschool?
Jean's monologue which turns out to be a lie is an example of manipulation. The objective of the lie most likely being to seduce Julie, not because Jeans loves her, but because Jean wishes to use her class status to advance his own social position. In a way this reminds me of the contemporary term, gaslighting
Attempting to teach children as if they are instructional units
This quote reminds me of a very interesting video I saw a few years about about treating education as an industrial system that churns out educated adults.
The speaker is Sir Ken Robinson who passed away last year.
which links the name to the content and goals of the encyclopedia – the salvation of soul through attainment of knowledge and purification of heart
Laissa Innocent. This is an observation I can make that connects this line to a buddhism class that I took in my previous school. We learned that the Buddha meant the enlightened one. In addition, they gain wisdom. This connects to the reading because they mention the "attainment of knowledge." When they mention the "purification of heart," it reminds me of the positive attributes the Buddha has. I can see how it relates to the goals of the encyclopedia.
kes paths are open to her? Which ones lead to d a f ‘can she fin independ 2 5L0 €a 3 ence within dependence? ; stances limit women’ pendence? What circum- fisitainenect ae s freedom and can she overcome them?
All very good questions. This reminds me of me, overthinking everything. I found the best way is to throw myself into it and stay mentally resilient.
is not the Other who, defining itself a Other, defines the One; the Other is posited as Other by the Sue ositin itself as One. But in order for the Other not to turn into the One the Other has to submit to this foreign point of view. Where does this en i woman come from?
This reminds me exactly of Hegel's master slave dialect.
ormula that gives our book its title. If there is any one point that we hope you will take away from this book, it is the importance not only of expressing your ideas (“I say”) but of presenting those ideas as a response to some other person or group (“they say”).
Reminds me of the rule of excepting critisiscm. For example, you can express your thoughts, opinions, and ideas but also grow as a writer by accepting critiscm.
recognizable racial units
The existence of homogenous racial enclaves reminds me of elements of both the Ethnic City and the Divided City. The Raffles Plan's division of Singapore into segregated ethnic areas was a way to best benefit the European traders.
The results of this introspective difficulty are baleful. If to hold fast and observe the transitive parts of thought's stream be so hard, then the great blunder to which all schools are liable must be the failure to register them, and the undue emphasizing of the more substantive parts of the stream. Now the blunder has historically worked in two ways. One set of thinkers have been led by it to Sensationalism. Unable to lay their hands on any substantive feelings corresponding to the innumerable relations and forms of connection between the sensible things of the world, finding no named mental states mirroring such relations, they have for the most part denied that any such states exist; and many of them, like Hume, have gone on to deny the reality of most relations out of the mind as well as in it.
This reminds me of Behaviorism in a way, but not exactly. The denial of mental states due to their general inability to be truly observed is very much the same. But whereas Behaviorism is strongly empirical in a scientific sense, this Sensationalism often gives way to a Humean type of philosophical empiricism.
bellowed:
The word "bellowed" really reminds me of an animal. It showed the wildness of Bertha's character; however, in reading Wide Sargasso Sea we understand Antoinette as a character instead of a plot tool.
Compatibility between identity aspects is fundamental for psychological well-being.
Reminds me of Maslow's hierarchy of needs.
Panicked business leaders and friendly political officials reacted quickly. When local police forces would not or could not suppress the strikes, governors called out state militias to break them and restore rail service. Many strikers destroyed rail property rather than allow militias to reopen the rails.
This reminds me a lot of what was happening a couple months ago with the Black Lives Matter protest sparked by George Floyd's death. Some of the protestors also destroyed property and many were wounded by the "protection" that was put in place to calm them down.
knowledge evolves and endures throughout the life of a race rather than that of an individual.
This reminds me of Aaron Swartz. I feel like this sentence pretty much describes his life mission. The sharing and passing down of knowledge and information is all we have to offer for the future!
The strong must grow stronger, and that they may do so, they must waste no strength in the vain task of trying to uplift the weak.
This phrase reminds me of when people talk about "trickle down economics" and that it will eventually get to the poor because that's "how it's designed", but they don't take into account greed and that the wealthy will just get richer and hoard their wealth and the poor will struggle at the bottom no thanks to them. A horrible society in my opinion.
a rifle diet for a few days and see how they like that kind of bread.
This reminds me of the BLM movement at the beginning of 2020, when the former president announced a similar threat of shooting to protestors who looted stores.
tasks could be done quicker and more efficiently
Reminds me of Amazon headquarters. Treating workers like machines and not humans.
blood, your brains, on a chopping block—I’d like to see yoursex,* swimming in a sea of blood, like that bird there—I do believe Icould drink from your skull, I’d like to paddle my feet in your breast,I’d roast your heart and eat it whole!—You think I’m weak; you think Ilove you because my womb desired your seed
This scene was just terrifying. He decapitated the bird she said she loved much and then she went into a speech of her hatred of men and wanting Jean dead. I found it interesting as well as pathetic. She reminds me of Macbeth in a way, talks a lot of big game but never really goes through with it. It's not the first time she's rude or says she hates Jean and just wants him dead. Her hatred for men is also something that should prompt her to do SOMETHING but apparently this weakness she mentions earlier stops her. It's strange someone could have such a big contrast in them. Say all of these things to him out loud after what he's done to her and still not really act on any of it and go right back to the idea of running away with him and even taking Kristin with them.
n constructing their own learning
This reminds me of a specific part in the Everyday Utopias video, where the children were able to make proposals of what jobs and activities that they wanted to participate in during the day. Then their teacher validates their choices and follows through with coordinating with the other teachers and students so everyone can explore what they wanted to.
Idea Generation, Feedback, and Revision
Reminds me of feedback loops from programming.
” Luis, a skinny dark-haired 13-year-old boy, sits at a computer station in the back corner of the room with a set of plastic action fi gures from the X-men comic series, a basket of play dough, and an Intel Digital Blue stop-animation camera.
This reminds me of when i was in elementary school, there would be kids just like this but a little younger at my school. He is trying to keep his childhood alive without even realizing it.
feeling what it is like to understand some things better (or more deeply)
This kind of experience reminds me of how BJS teachers strive for children to have "the right to participate in complex topics and world issues." Tiny humans are capable of understanding big issues.
Experience of applying their developing skills inpurposeful and meaningful ways
This reminds me of the "Hundred Languages of Children", which talks about how the child can express their learning in many different ways that make sense to them. The educators must be able to recognize the child's language and provide them with the tools to express it.
Feeling what it is like to understand some thingsbetter (or more deeply
This reminds me of the design principal of conceptual curriculum; personalized and not standardized. A child or a group of children to have the freedom of long term exploration, without worrying about the time allotted for the topic
"What experiences should all children have much of the time?"
This reminds me of the contextual curriculum video of this week where the importance of time was talked about. Life isn't scheduled minute-by-minute and no one really functions that way either so we shouldn't force our children to live this way. Learning experiences cannot start and stop in one hour, they happen over long periods of time and they connect with other learning experiences.
inwhi he had urged ordinary people to learn to use computers rather thanleaving them in the hands of the “computer priesthood
While I know the context and situation is different. The idea of the internet being assessable and not a certain few reminds me of the issue of Net Neutrality that is happening today. It almost seems like there has always been a battle to ensure public assess to the internet.
Alas, with the years all this fine contempt began to fade; for the words I longed for, and all their dazzling opportunities, were theirs, not mine. But they should not keep these prizes, I said; some, all, I would wrest from them. Just how I would do it I could never decide: by reading law, by healing the sick, by telling the wonderful tales that swam in my head,—some way.
Reminds me of conversations had within the black community today regarding the need for black people to go above and beyond for the same recognition to be given that is easily afford by their white counterparts for doing far less.
National laws are superior to the laws of the states.
This reminds me of the supremacy clause in the United States: the idea that federal laws outweigh state laws.
a “more excellent way.”
This just reminds me of the ideology Western countries have about their need to "fix"people and make them more civilized.
But those that fear their Lord although they cannot see Hi~ shall be forgiven and richly rewarded.
This reminds me of something I read in the Quran which read along the lines of "belief only carries faith so long as the reality remains hidden. When it is revealed to mankind what the true purpose of this life then saying you believe will carry no weight. Similar to how when you study for a test that knowledge you are memorizing will only be valuable when you are sitting in the classroom taking the test. After, when the answer key is shown your answers even if you changed to the correct choices won't change what you said on the test.
I believe the second option has been under-explored.
Reminds me of the comedy sketch of the person using the restroom for people with handicap (or the similarly reserved parking lot). However a lot of people are staring at him, or knocking at the door, so he leaves the restroom/the car dragging his leg and pretending to have a handicap.
Rigorous training ingenres of music and dance was normal for boys and girlsfrom ages 12 to 15 and took place in “houses of song.”
The concept of "house of song" reminds me of arts high schools that are in place now! I went to a theater high school and remember taking music class and acting classes much like those boys and girls!
Or we ask yes/no questions: Did you have a good day? Which basically shut off interesting answers
This reminds me of my acting class I took. When we worked on improv the main of the person starting the scene was to make it open. If you started with a question best answered in yes or no it was likely that the partner would have to work harder to make the scene interesting. In addition, when responding if using yes or no it was always required you supplement it with something else. I relate this sentence as a fifty fifty back and forth between both speaker and answerer. It is necessary that the speaker doesn't lead with too many yes no questions, but it is also important that the person responding puts in input as well.
And yet all around me is that odor that I have not smelled since I was eleven, but have never forgotten—have dreamed, more than once. Then I pull myself up the bank by a gray-leafed bush, and I have it. The tantalizing and ambiguous and wholly native smell is no more than the shrub we called wolf willow, now blooming with small yellow flowers.
The author is reminiscing of his childhood, and the smell of the wolf willow is the thing that he remembers from his childhood. Its the smell of the wolf willow what reminds him of home.
Dominant overwriting also ignores ordevalues ‘Ōiwi aesthetics, by which I mean Hawaiian ways ofunderstanding and being that draw upon the senses, and all otherpleasurable modes of knowing, to inform and guide ‘Ōiwi artistic-intellectual expression.
This made me think of what I am going through as a student of lomilomi. My kumu was taught by many kumu, some of them allowed him to write all the detailed notes needed, and some said he wasnʻt allowed to write any. He never did show his notes to us. he always taught it to us with physical examples and demonstrations. Iʻve learned he did that with the intent that we had would share mana, space, and time in that way which formally builds the pilina and passes down hā, but also allowed us to write notes after the lesson when we got home. This is so that we would have ways to reminds us, when it came down to passing the ʻike to our ʻohana. this section made me think of the things and experiences people can miss if they read how to do lapaʻau practices from a book. all the small little nuances.
onduce to virtue more than to vice
This section reminds me of the quote from Adam Smith where he said "Virtue is to be more feared than Vice because its excesses are not subject to the regulation of conscience". I wonder if the author is making a reference to this?
the female body contributed only matter.
Women as material. Reminds me of women as clay. Describing women as matter gets to it.
I am accepting charitable donations,. ETH: 0x66e2871ef39334962fb75ce34407f825d67ec434 | BTC: 38B6vGaqNvMyTtoFEZPmNvMS7icV6ZnPMm | xDAI: 0x66e2871ef39334962fb75ce34407f825d67ec434 (function(i,s,o,g,r,a,m){i['GoogleAnalyticsObject']=r;i[r]=i[r]||function(){ (i[r].q=i[r].q||[]).push(arguments)},i[r].l=1*new Date();a=s.createElement(o), m=s.getElementsByTagName(o)[0];a.async=1;a.src=g;m.parentNode.insertBefore(a,m) })(window,document,'script','https://www.google-analytics.com/analytics.js','ga'); <p>ga('create', 'UA-74743044-2', 'auto'); ga('send', 'pageview');</p> Wednesday, June 23 2021. Nintendo Way Erev ... the Day of the Holy Divorce of Bayjorel Adam on “ho(s) I still single” … I “hisss” as Alger, Narcissus and to the various collegiates in Massachusetts; know it’s because I’m Cheyanne Mountain. You can’t even dream how hard it is to get inside “this heart.” Or maybe I can’t fathom why nobody’s rushing up to me trying to grab the ring of “infinite alimoney in the ever-after” … Na Na Na Na … Na Na Na Na … shey shea way) … tee tea, tay? This messages marks a major increase in “forced read(layshion)ership” to include a significantly larger group of students and professors than before. This is a new system; please unsubscribe using the instructions at the bottom of the message, which are different from the prior newsletter interface. I have noticeably been writing much less and sort of working harder on bringing to fruition the software and social policy changes I’ve been dreaming of and writing about instead of “just talking.” Searching this message that I intend to send to the students a day early–you know, with foresight for … in the hope that many of you remember first hand hearing the words “I don’t believe in the big bang, but I respect those that do” echo from a computer screen to me subconsciously in the state of South Carolina–that you will help me end the 7 year draught [[literal, good sex]] that I equate to the Biblical overflow of the Nile and to Stone Temple Pilots; this light and Sheldon Harr who trained me for my Bawr Mitzvah and taught me all the right things that I know about being a good Jew who didn’t really believe in the existence of God; but then helped create the system that makes us all that. Those who “see” or “saw” Kentucky as I did might recall the phrase spoken from myself to myself; “you don’t believe in God when you are this close to it’s creation” … or something almost verbatim; that. Some of you might see Gilgamesh more than I do, or have forgotten the "sliding of sleight of hand and becoming … the trickster of the Dajjal … "an idea that gore was being fabricated and faked; in order to help us see why it’s so very importanat that at the same time that immortality and heaven become part of the conversation of the adbication of Odin’s throne to Thor or to Arthor’s table and plebescite “victims” … that we all understand the magnanimous change wrought by Heaven on civilization and on the old customs and on the old laws, and that here we see the importance of guaranteeing safety and privacy and even “right to death” in a place where God had previously only written of “life and liberty” with the ambiguity of … “from what” being left to my seemingly slow hand. On the order of plans soon to be seen to fruition my large key of “what this website truly is” has grown to something like 20GB and now includes a static and time frozen version of everything linked to stored on the IPFS system and multi-homed across a number of “cloud providers” to ensure things like “shekinah” will not forever be changed to “shechina” with nobody noticing the loss of causal original truth. The “light of angels” domain now redirects automatically to /ipns/fromthemachina which should render in future shell-internet-browsers as something like QmTH33MwfPn5S3bq45Tk77L1j9eZjUsvEVhRTHB3D8M2ZX [please pin this “root block”] I am not sure why IPFS doesn’t have better merkle tree searchability, but seeing siblings and parents and connections between these Qm hashesh is something that we should be working fervently on making more robust. IPSE.io appears to have created a decent search and governance system, I see it as something like the “electoral college” metacosmically linked to the thing I am trying to build–a preservation of all human knowledge and an infrastructure for discussing and communicating about the “veracity” and the linguistic nuances “alluded to” in the lude ties between this Empire’s new Clot and the clothing worn by Popes and Jews, the seeit-seeit; tzit-tzit and … 4-WORD AND SIX WITH “SHOOTER” … YEARS HAVE GONE BY; AND I STILL HAVEN’T GOTTEN FVCK3D. I am planning on suing several medical providers and states for what I see as heinous violations of human rights, decency and the Constitution of the United States; if you are a lawyer or you can recommend a good one, please email me as soon as possible at 0xc514f094370cFc5eE45a1Dd9B72bb9675efE266f@ethmail.cc. You can also send Ethereum fungible donations to that alphanumeric identity. As I note much later in this message … TRUST IN MA … SELF-VATZEDEK SUE-C-CYDE … I KRY/STALL WHEN DODGE DESERVES TO PAY Please do note see a significant difference in importance in the emails now coming from ethmail.cc and the series of half-rambling cires for help which amount to something like my prayers to the pagan gods that you are. There’s quite a long thread in my soul Many times I’ve discussed and called in my mind and with my heart the American democracy nothing more than “Noah’s Archaic” two party system. Over the course of the years hidden messages from the Ark’s source of knowledge have conclusively shown me that a previous phrase “multi party system” connects to political parties and governmental action committees that span across continents and even earths; in my microcosm or special language and understanding of heaven, “across rooms” which are worlds … sort of owned or designed with some sort of top down or democratic structure of “literal rule system creation.” In my mind these rules can be inherited and modified, in the programming language sense of those words, as in "inherit democracy from America, update for new medical knowledge and scientific truth … discussed later in this message. The “water joke” connects to Horatio and to H2O and the idea that the chairs depicted by the character “h” are something like a placeholder meaningfully connected to the Senate Majority Chair and of course the Minority Chair and it’s the fact that there are only two that makes our current system something like A"Biblical Water." I believe we should be living in a world that has many more than two parties, hundreds or thousands of active parties could and should compete not for a single figurehead to sit in a throne like chair but for groups of people to be able to access the faster processing power and wider knowledge … represented here by something like a “Matrix jack” from the two movies, The Matrix and No Jack City; which allow for resources to be “billed to the party” and/or the people, rather than individuals who might otherwise have to “pay extra light” for faster processing power in order to quickly build a piece of legislation or political propaganda that equally connects to the mirage and miracle and dream of building a “subconscious voting system” that allows for votes to be taken “isntantly” and not just instantly but at some kind of recorded interval over time. I envisioned in Kentucky a world where the laws of the land would change instantly, allowing for bad weather to be instantly removed, for laws to differ from neighborhood to neighborhood and even to allow the fine grained detail of “outside and inside” each and every individual home or castle. Lost. Blind wandering through a lost world, in the beginning–that’s the truth. Crossroads, somewhere between walking through an electromagnetic pulse in Lake Worth and struggling to remember “the other thing.” Recalling [flew(ers)], so I was there sitting with my parents when we saw it on TV–a gigantic deal–the United States was going to war for the first time in my life. Saddam Hussein had invaded Kuwait (supposedly for the oil) and Operation Desert Storm was launched by George H.W. Bush; recalling the names and “Space Balls” it’s almost funny to see … how blind I was back then. General Norman Schwartz cough. General Colin Powell. Anyway, the whole point of the story is we were sitting at the Flamingo Diner; and for my whole life I lived just a few roads away from that road; never ever realizing what it was. I also didn’t realize for a very long time that you might also not see it, or you might see it instantly. Scanning just south of there, you can see it turns into Red road, and then its more than obvious that “flaming” stands out, light a highlighted cross–but we don’t say the name of that bird that way, and we didn’t see “infer” in Dante’s “inferno” or … “no” either. Flamenco … en espanol … like the dancers. A golden bitcoin swirls in the sky… the “mind control people” of Bowling Green gape in some kind of crowd pleased awe as the “middle” and the end connect almost seamlessly … Fort Myers creates a space port in the light of Vegas’s monorail “plots”– “Who?” “this is what it does,” vaaa—tseeee----deeeeeeeeck? In this word I recited over and over again in preparation for my Bar Mtzvah on December 11, 1992; without ever knowing the meaning is the crux of what exsactly is going on right now. The word is vatzedek: צֶ֫דֶק noun masculineIsaiah 1:21 rightness, righteousness; — ׳צ Leviticus 19:36 87t.; צִדְקִי Isaiah 41:10 8t., etc.; — 1 what is right, just, normal; rightness, justness, of weights and measures, אֵיפָה, אֶבֶן שְׁלֵמָה וָצֶדֶק Deuteronomy 25:15 a perfect and a just weight, ephah; ׳מאֹזְנֵי צ; ׳אַבְנֵי צ, ׳אֵיפַת צ, ׳הִין צ, ׳בַּת צ Leviticus 19:36 (H) Job 31:6; Ezekiel 45:10; ׳מַעְגְּלֵי צ right paths Psalm 23:3; ׳זִבְחֵי צ right peace-offerings Deuteronomy 33:19; Psalm 4:6; Psalm 51:21. 2 righteousness, in government: … and you can believe that despite the strawnge pronounciation little boys and girls would use at the age of thirteen as they spoke in rigorously recited prayer-song … it [swounds almost exactly like “What’s a Dick?”] https://pediatrics.aappublications.org/content/125/5/1088 https://www.who.int/news-room/fact-sheets/detail/female-genital-mutilation https://en.wikipedia.org/wiki/Female_genital_mutilation #FTA, from the article: Congresswoman Ilhan Omar, righteously fed up with the prejudiced nonsense she endures day in and day out, called a question about female genital mutilation from an audience member at a recent event “frustrating” and “appalling.” So I stand here living in Taylor Momsen’s song “Nothing Left To Lose” my personal favorite of hers which touches on this subject of “freedom as just another word for it” and of course the link between the purpose of an ethical oversight of the popular vote that the Electoral College represents; another two special and related words here, righteousness and fate. Between Vatzedek and Kismet; I can only convey my great dismay at the actual emotional and true physical pain I feel in my groin of groins every time I think about the horror story that has become my life and the what the land of America and the Medgard of Yggrasil has become … [note it’s not Yggdrasil] as I rally against the closest of my family of families, the Americans and Jews who refuse to stand up and speak out on my behalf, and on the behalf of humanity in general against the sickness of ritual genetal mutilation. Lost between Elvis and Suicide, she sings and I think about Ellis Island and Ellis Eaton and literally the innate and obvious lack of desire I have in my heawrt and imparted into my mind by some kind of ancient and unholy Jewish law … no desire at all to leave this world which has quickly turned from a bastion of light and freedom into nothing short or less than Hell itself. Kirinechoes from the land and day of NEMEC.html the chanting from the invsible choir of “e” … "he’s a victim" over and over, “he’s a victim, he’s a victim;” and in a more private sort of way she held on to my victim’s rod) and in a sort of kind friendly way implied that I should stop doing “speed” because … I need this, and she … in Holy ritual … patted the phallice of Iapetus’ great grandsun. Here I stand for the very first time; writing to a large group of students in the area of Boston, Massachusetts begging for the Sabbath Day to “be remembered and kept holy” as the Hebrew prayers and rituals repeatedly fail to explain has something significant to do with entry into the Holy of Holies, with the continuation of life and of heaven … and with the reinvigoration of something like a following of the Hippocrati Oath that is beyond a requirement to be reaffirmed here in this place as we begin to discuss the opening of “the process of the creation of legislation” as a function ofthe “citizenry governed” … the creation of “direct democracy” utilizing a kind of fusion of the software products I’ve been explaining are here designed specifically for this purpose. Software like kipu.com, aragon.org, wikipedia.org and even reddit.com. On the shape of his table, the heart of “sword” and another word for “Murfresboro” Sometimes I get my hopes up, sometimes i lose all the doubt and the “missing remorse” and the fear–the moments I can’t STS “socks” out of the VEGA System; in those brief moments I think you’re actually going to do something nice for me, that the heavens haven’t crashed and I’m going to have some kind of sex party that actually … really honest to God … is what “Saturday is all about.” So what, sue me–I wrote the book on the single Dionysian fusion of a Roman Bacchanalia and the Weeebrew Saturnalia … and then I yell at “Bethesda” for even daring to mention the grape fruit juice and the movie Havok–but I’ve heard all about the “passing of the nite and the nocturnal rite”–truth is I probably would walk right into the branch ending trap I laid in Fort Myers–every time I think about it the “minute of bouncing and orgasm” makes me smile a little more inside and my stomach get’s butterflies and just for a moment (I think I might be writing like STS) I think maybe it’s not the end of time and maybe I won’t never get to actually see … Heaven. Butt then you tell me (my but-tea joke isn’t funny, eithah?) … “Cassini” and “molasses” are supposed to make you feel like the OC resort guy staring at my tooth “about to be the one tooth from 2011” and I go back to remembering it’s been a decade since I’ve had a decent “good time with a girl” … literally seven long years, aside from a brief “blushing” experience with little Mackenzie Reisinger. Imagine that girls smiling at me and saying things like “Larkin Sow” and this brief period of “ecstatically frenzied decent writing” is all that it takes to keep me going; trudging along through the very shallow (or deeper) pits of Hell itself–just like a Dreidel c’d to make some silly words from the "introduction to the Bahir [literally wasn’t here, and “spirit of ah-aha illumination; hi. and this conversation ensued”] like “yod-nun” actually be … something like our salvation. Flying back in time to the “thang” point, I remember what it is now. Fear it … það; fear it. Day One has begin, or ending–whatever the proper literary way to say the Bible and it’s days are all wrong, and even further along the thing called the “Festival of Weeks” by the Jews, even more disgusting. I have no shame or remorse in saying such things, in fact I believe it is the purpose of this strange take on the “nocturnal rite” of the Norse ancient Druidic and “Dhruzi” mentioning of the Prose Edda to come to this very strange point, in this very strange place. Boston, Massachusetts. It might one day be a little known fact, but up until the presidency of Barrack Obama every single President of the United States of America was a member of the Protestant Church, all but John Fitzgerald Kennedy whose bright and shining face and ethos stand apart from almost all others in his place. I might one day say Trump too stood out above and shined brighter, and personally only because he lived during my lifetime, I think my personal view of Bill Clinton is the brightest of all. To me, the Clinton years were filled with the booming economy of Old Joe, and the great aspirations of Our Jack; a thing that many people before Armstrong walked on the moon and planet a great Democratic “P” one giant leap above the rock of ages … there are just no words for lux of America’s contribution to the launch of a Heavenly Civilization, in the words of Paxton in “Big Love” … and the LDS Church and Deseret’s version of “the thing” (nu3 today) … “the celestial kingdom.” Valhalla and Matzot scream of the “ha-moat-sea” and the “vats-a-dick” but without our giving of thanks for righteousness we have become the murderers not only of Judas and Death but also Jesus and the thing that created him. Eventually the island of America disappears, eventually it’s Earth, any planet a human was one … these are the things that have either become a force of great goodness–or of total destruction. This is the embodyment of “Troy as hisT” this is Galactikiss has become Planet Prime and all Derivatives–the silver surfer speaks to you all, between “El Dorado” and the “Silverado” … a comparative connection to the difference between Fort Knoxx and the Pound Sterling … with a Troy Ounce of “tzadik” to ensure with our GSLW: “ness truly means 'now everythink safely saved;” … and that’s a GNU definition for NESS which previously may have mentioned everywhere or earth and those are both absolute falsehoods and perhaps were not when they were spoken. At least, relatively speaking. Rape has come up today. I’ve commented publicly on the conversation I had in my head last night, walking by “Boston College High” and I can’t help but add my “very interesting” thoughts on the echelons of spirits inhabiting the Ka of God here in this place; and how they might somehow be satiated in a way that I or most people in this world would fine to be something more sexually immoral or deviant … “previously of the wiccan pagan variety” … something like my strange dreams here in this place of starting trends of having “a thing” for doing “moms and sisters,” which have been echoed here by a sitting and very prominent G.O.P United States senator or congressman; the show “Vampire DIaries” as well as Natalie Portman, Taylor and Sloane Momsen, Kate Hudson, and a number of other female “duos” like the Spears and Simpson sisters (Ashlee and Jamie Lynn, see) the Olsen twins and of course the soon to be “in the light of the fame of Nashville” … Larkin Poe. DIVERGENCE, TO NEW YORK CITY, TO YOM HASHOAH … OR TAV OUR TAY VUE … (((( this here is what we call a "race through a rats cage )))) if neither of the four or give girls in question send me some kind of verbal “ACK” ratyher than a “NAK” in writing, I might travel to Ellis Island or Nashville, TN before staying in Boston or … for instance going to Lowell or Nashua and … perhaps causing more FUKUSHIMA on the NAKARSAKI of HEROSHEMA; and by that I mean this is a “big deal” … LLNV might become a bus stop in Vegas or the VEGA System or it might be a national labratory near the Hamptons. It’s hard to tell at this point whether or not there’s any “liver” in Mexico’s version of that funny one with the guy that reminds me of Aldous Snow in “Forgetting Sarah Marshall.” In my mind today I speak from the Earthene world of Janet Devlin’s “Chandelliers” directly to Michael Jackson himself, on the difference or change or meaning wrought by Bill Cosby and his “Neverland Ranch” series on the question at hand–are there bowling tumble weeds and karaoke bars on par with Prescott Arizona’s scene anywhere closer to Nashville than Bowling Green … because I was beyond surprised to find a sprawling megalopolis in the place I had thought for my whole life was something more akin to Knoxville, a place where fledgling female music stars became “Grace Vanderwaal” golden buzzer winners … faster than you can connect Jerusalem to Shirley Temple. On the specific name, Shirley here is Bianca Pisani’s great grandmother; and no farther than the truth is the world’s “UMBRELLALAUNCH” link between the Chinesely famous virgin (non-alcoholic) drink is something like Billy Joel’s Piano Man Bartender walking into “the usual place” and saying something along the lines of “Geisha me up one Virgin Red head; hell, why don’t you make it a double.” Leave the umbrella with the kites that didn’t glow fiiery stars into the Holy of Holies in the same vein and for the same reason that the Church of the Holy Sepulcher failed to actually change the world with it’s ritual uniting the Olympic passing of the Torch with today’s interlinear and interwoven message with Old Joe and Young Jack Kennedy, Jackie Onassis and even touching on the Saudi Royals which were also a big part of the story connecting General MacNamara to “Lauderdale by the Sea” and a special rememberance to the expensive and Holy bronze or copper brick which he bought (through donation to charity I imagine) making himself more than just something like the founder of the beachfront redesign of our Federal Floridian beacnhead, but also a founding member of something I call “The Columns and Pillars” society in reference to the Pine Crest School version of the same kind of ritual. Also connected here are pictures of those columns, and extracts from my senior yearbook where my mother was kind enough to leave me two whole half page dedications to my graduation from one of the most prestigious and omnifiscient preparatory schools in the entire world … at the same time donating columns both in my name, their name, and the names of her deceased parents: Julie and Bernard Gerson. Bell to sky; and to the Berlin Sky; this is the same genetic and congenial family line that links Gersholom Sholom, Albert Einstein, J. Robert Oppenheimer, Adolf Hitler and Yosef Stalin … to Joe Biden and the “Joseph and Betty Portal” which replace the MacNamara era bricks with “new composite plastic” that might last much longer and has another list of donations. The “portal connection” something like an Einstein-Rozencrantz flash of brilliant light … marks just one more error in my handling of my lack of understanding of things like “basic vectodirs” and “kasimamoriv radiation” … including here (if i read this and take the time to properly attribute) a visual image of the red shift and blue spindle of the actual radiation Einstein predicted would be ejected from something so massive even “light” could not escape it. On “relativity” and relatively speaking, it’s the wavelength and energy level of the light; as well as something called “gravitational lensing” … “the special relativity theorem” which earned Munich born and taught Albert a Nobel Peace Prize (as well as much fame in the land of America for the creation and explanation of the science behind the White Sands Trinity connection to Hanukah and Sandia National Labratory) … forces these corrections: ERRATA Operation Fishbowl was a series of high-altitude nuclear tests in 1962 that were carried out by the United States as a part of the larger Operation Dominic nuclear test program. Flight-test vehicles were designed and manufactured by Avco Corporation.[1] The Operation Fishbowl nuclear tests were originally planned to be completed during the first half of 1962 with three tests named Bluegill, Starfish and Urraca.[2] The first test attempt was delayed until June. Planning for Operation Fishbowl, as well as many other nuclear tests in the region, began rapidly in response to the sudden Soviet announcement on August 30, 1961 that they were ending a three-year moratorium on nuclear testing.[3] The rapid planning of very complex operations necessitated many changes as the project progressed. All of the tests were to be launched on missiles from Johnston Island in the Pacific Ocean north of the equator. Johnston Island had already been established as a launch site for United States high-altitude nuclear tests, rather than the other locations in the Pacific Proving Grounds. In 1958, Lewis Strauss, then chairman of the United States Atomic Energy Commission, opposed doing any high-altitude tests at locations that had been used for earlier Pacific nuclear tests. His opposition was motivated by fears that the flash from the nighttime high-altitude detonations might blind civilians who were living on nearby islands. Johnston Island was a remote location, more distant from populated areas than other potential test locations.[4] In order to protect residents of the Hawaiian Islands from flash blindness or permanent retinal injury from the bright nuclear flash, the nuclear missiles of Operation Fishbowl were launched generally toward the southwest of Johnston Island so that the detonations would be farther from Hawaii. Urraca was to be a test of about 1 megaton yield at very high altitude (above 1000 km.).[5] The proposed Urraca test was always controversial, especially after the damage caused to satellites by the Starfish Prime detonation, as described below. Urraca was finally canceled, and an extensive re-evaluation of the Operation Fishbowl plan was made during an 82-day operations pause after the Bluegill Prime disaster of July 25, 1962, as described below. “Wish You Were Here” is a song by the English rock band Pink Floyd. It was released as the title track of their 1975 album Wish You Were Here.[2][3] David Gilmour and Roger Waters collaborated to write the music, and Gilmour sang the lead vocal. In 2011, the song was ranked No. 324 on _Rolling Stone’_s 500 Greatest Songs of All Time.[4] In the original album version, the song segues from “Have a Cigar” as if a radio had been tuned away from one station, through several others (including a radio play and one playing the opening of the finale movement of Tchaikovsky’s Fourth Symphony), and finally to a new station where “Wish You Were Here” is beginning.[5] The radio was recorded from Gilmour’s car radio. He performed the intro on a twelve-string guitar, processed to sound like it was playing through an AM radio, and then overdubbed a fuller-sounding acoustic guitar solo. This passage was mixed to sound as though a guitarist were listening to the radio and playing along. As the acoustic part becomes more complex, the ‘radio broadcast’ fades away and Gilmour’s voice enters, while the rest of the band joins in.[6] The intro riff is repeated several times before Gilmour plays further solos with scat singing accompaniment. A third verse follows, featuring an increasingly expressive vocal from Gilmour and audible backing vocals. At the end of the recorded song, the final solo crossfades with wind sound effects, and finally segues into the second section of the multi-part suite “Shine On You Crazy Diamond”. Lyrically, the song is often considered to be a direct tribute to Syd Barrett. However, on the documentary The Story of Wish You Were Here, Gilmour and Waters separately describe the original concept that differs from this interpretation. Waters, who mainly wrote the lyrics complementing Gilmour’s initial riff idea and subsequent joint composition, describes the lyrics as being directed at himself, as his lyrics often are. Being present in one’s own life and freeing one’s self in order to truly experience life is a main topic in this song. Gilmour, on the other hand, recognizes that he does not ever perform the song without remembering Syd Barrett. Waters later adds that the song is nevertheless open to interpretation.[7] Both David Gilmour and Roger Waters have praised the song as one of Pink Floyd’s finest. Roger Waters has noted that the collaboration between himself and David Gilmour on the song was “really good. All bits of it are really, really good. I’m very happy about it.”[8] David Gilmour has playfully called “Wish You Were Here” “a very simple country song” and stated that “because of its resonance and the emotional weight it carries, it is one of our best songs.”[9] “Wish You Were Here” was recorded at Abbey Road Studios, as part of the sessions for the entire album. A noted part of the song was a planned contribution by Stéphane Grappelli. A jazz violinist popular at the time and well known for his collaborations with Yehudi Menuhin, both violinists were recording in a downstairs studio at Abbey Road at the time. Gilmour had suggested that there be a little “country fiddle” at the end of the song and invited them to participate. Grappelli duly obliged (Menuhin declined) on arranging a session fee of £300, equivalent to £2,500 in 2021.[10] Ultimately during mixing it was decided to almost remove his contribution, although it can just be heard around 5:21. According to Waters it was decided that it would be insulting to credit Grappelli in the sleeve notes for something so inaudible, although he did receive the agreed-upon fee.[11][12][13] As part of the Why Pink Floyd…? campaign, the Experience and Immersion versions of the Wish You Were Here album include an alternative version of the song where Grappelli’s part is heard in the instrumental break after the second verse and throughout the third verse before a considerably extended outro. Other less obvious differences are audible, for example at the section leading into the second verse. The master tape of the original recording includes guitar solos that were not used in the final mix.[citation needed] Personnel [edit] David Gilmour – lead and harmony vocals, scat singing, six and twelve-string acoustic guitars, pedal steel guitar, tape effects Nick Mason – drums, tape effects Roger Waters – bass, tape effects Richard Wright – Steinway piano, Minimoog Golgo 13 (Japanese: ゴルゴ13, Hepburn: Gorugo Sātīn) is a Japanese manga series written and illustrated by Takao Saito, published in Shogakukan’s Big Comic magazine since October 1968. The manga won the 1975 Shogakukan Manga Award for general manga and the Grand Prize at the 2002 Japan Cartoonists Association Awards. The series follows the title character, a professional assassin for hire. Golgo 13 is the oldest manga still in publication, and its tankōbon edition has the second-highest number of volumes. It has sold 300 million copies in various formats, including compilation books, making it the second-best-selling manga series and the top selling Seinen manga series in history.[2] It has been adapted into two live-action feature films, an anime film, an original video animation, an anime television series and six video games. A googol is the large number 10100. In decimal notation, it is written as the digit 1 followed by one hundred zeroes: 10,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000. For other uses, see Wormhole (disambiguation). “Einstein-Rosen Bridge” redirects here. For the EP by electronic musician Venetian Snares, see Einstein-Rosen Bridge (EP). General relativity Introduction History Mathematical formulation Phenomena Gravitational lensing Gravitational waves Frame-dragging Geodetic effect Event horizon Singularity Black hole Spacetime Spacetime diagrams Minkowski spacetime Einstein–Rosen bridge show Equations Formalisms A wormhole (or Einstein–Rosen bridge or Einstein–Rosen wormhole) is a speculative structure linking disparate points in spacetime, and is based on a special solution of the Einstein field equations. A wormhole can be visualized as a tunnel with two ends at separate points in spacetime (i.e., different locations, different points in time, or both). Wormholes are consistent with the general theory of relativity by Einstein, but whether wormholes actually exist remains to be seen. Many scientists postulate that wormholes are merely projections of a fourth spatial dimension, analogous to how a two-dimensional (2D) being could experience only part of a three-dimensional (3D) object.[1] A wormhole could connect extremely long distances such as a billion light years or more, short distances such as a few meters, different universes, or even different points in time.[2] Julius and Ethel Rosenberg — Americans who were involved in coordinating and recruiting an espionage network that included Ethel’s brother, David Greenglass, a machinist at Los Alamos National Lab. Julius and Ethel Rosenberg were tried for conspiracy to commit espionage. treason charges were not applicable, since the United States and the Soviet Union were allies at the time. The Rosenbergs denied all the charges but were convicted in a trial in which the prosecutor Roy Cohn later said he was in daily secret contact with the judge, Irving Kaufman. Despite an international movement demanding clemency, and appeals to President Dwight D. Eisenhower by leading European intellectuals and the Pope, both the Rosenbergs were executed in 1953, at the height of the Korean War. President Eisenhower wrote to his son, serving in Korea, that if he spared Ethel (presumably for the sake of her two young children), then the Soviets would recruit their spies from among women.[26][27][28] Greenglass later recanted his testimony against her, and release of grand jury testimony in 2008 showed the extent to which the prosecution had created a false case against Ethel.[citation needed] Saville Sax — an American, acted as the courier for Klaus Fuchs and Theodore Hall. Sax and Hall had been roommates at Harvard University.[20] Oscar Seborer — worked at Los Alamos from 1944 to 1946, and was part of a unit that studied the seismological effects of the Trinity nuclear test. Codenamed “Godsend” by the Soviets, he defected to the Soviet Union in 1951, and received the Order of the Red Star. He lived under the alias “Smith” and died in 2015. His identity was only revealed publicly in 2019.[29] Morton Sobell — an American engineer, he was tried and convicted of conspiracy, along with the Rosenbergs. He was sentenced to 30 years imprisonment on Alcatraz, but released in 1969 on appeal and for good behavior after serving 17 years and 9 months.[30] In 2008, Sobell admitted to passing information to the Soviets, although he said it was all for defensive systems. He implicated Julius Rosenberg, in an interview with the New York Times published in September 2008.[31] Melita Norwood — British Communist, an active Russian spy from at least 1938 and never detected. Employed as a secretary in the British Non-Ferrous Metals Research Association since 1932, she was linked to the Woolwich Arsenal spy ring of 1938. In wartime she was seconded to “Tube Alloys”, the secret British nuclear research project. She was later considered “the most important female agent ever recruited by the USSR”. She was first suspected as a security risk in 1965 but never prosecuted. Her spying career was revealed by Vasili Mitrokhin in 1999, when she was still alive but long retired. Arthur Adams — Soviet spy who passed information about the Manhattan Project.[32] https://www.bbc.co.uk/newsround/25004050 https://thedoctorwhosite.co.uk/doctorwho/ 12:3 Those who are wi se[a] will shine like the brightness of the heavens, and those who lead many to righteousness, like the stars for ever and ever. https://www.americamagazine.org/politics-society/2020/05/08/its-time-rethink-electoral-college https://www.npr.org/sections/itsallpolitics/2011/12/20/144016912/we-the-people-npr-readers-would-ratify-four-new-amendments https://www.americamagazine.org/politics-society/2020/05/08/its-time-rethink-electoral-college https://www.npr.org/sections/itsallpolitics/2011/12/20/144016912/we-the-people-npr-readers-would-ratify-four-new-amendments https://constitutioncenter.org/blog/vote-now-an-amendment-to-end-the-electoral-college https://www.nytimes.com/2020/02/09/opinion/letters/electoral-college.html https://www.latimes.com/opinion/readersreact/la-ol-le-electoral-college-20180904-story.html you are offline https://slate.com/news-and-politics/2014/05/amending-the-constitution-is-much-too-hard-blame-the-founders.html we the people rise again https://slate.com/news-and-politics/2012/06/fix-the-constitution-amending-by-national-referendum.html safe souls, safe fu https://slate.com/news-and-politics/2012/06/fixing-the-constitution-protecting-informational-privacy.html https://slate.com/news-and-politics/2020/05/new-reconstruction-constitution-democracy.html We the People of Slate … The U.S. Constitution, as you [mighta been, shoulda “come” on … its someday] rewrϕte it. “Politicians talk about the Constitution as if it were as sacrosanct as the Ten Commandments [interjection: spec. it is actually almost exactly related!]. But the document itself invites change and revision. What if the president served only one six-year term instead two four-year terms? What if your state’s population determined how many senators represent it? What if the Constitution included a right to health care? We asked legal scholars and Slate readers to cross out what they didn’t like in the Constitution and pencil in their hearts’ desires. Here’s what the document would look like with their best ideas.” Slate: u_s_constitution as_rewritten by_slate_legal_experts_and_readers 多也了了夕 "with a wand of scheffilara, 并#亦太 he begins … "I am now on the Staff of Menelaus, the Spears of Longinus and Lancelot; and the name “Mosche ex Nashon.” - http://ipfs.io/ipns/fromthemachine.org/CHANSTEYGLOREKI.html - http://ipfs.io/ipns/fromthemachine.org/NUCLIRDISS.html - http://dweb.link/ipns/fromthemachine.org/CRALL4Good.html Please note that any decent browsers would probably render ipfs://fromthemachine.org as the following https://gateway.pinata.cloud/ipfs/QmTH33MwfPn5S3bq45Tk77L1j9eZjUsvEVhRTHB3D8M2ZX I ask again that you all pin on IPFS mirror and copy the data included in these dumps, they are a key to “not losing causality” to not having a history that makes no logical sense, and to some kind of coup de roku, that really makes no sense unless you no, we will ve weill … ROCK YOU Long ago I began writing about hidden codes in our history; thing’s significantly more obvious than “flying elephant armies” connecting Disney and Dumbo to Xerxes and the “Democratic Party of the United States (mascot)”–though it’s not really easy to consolidate the “epiphany” of … [((all i know))] without some kind of “artificial intelligence data condensation [infosmos.is?”] and summarization platform, though that’s nearly the next thing on my Lowell list of things we need to “mechanical turk” into being. Meta-consolidation of the world’s encyclopedias is one of the most important and useful tasks we have as we move towards the creation of a virtual debate platform that will eventual “literally obviate wisdom” of the layer/layer system that defines the name of the city I write these words near. Lowell, MA The broad overview of the system … the gist … is that political parties and activist organizations will create their own “view of the truth” (propaganda, falsehood-removed) and that these disparate pieces of “highlighted and annotated bibliography” could be overlay-ed on top of each other, creating a “new view of the truth” based on a users preference. The whole thing boils down to series of “holographic eschatological goggles” that will allow, for instance, the “grasping and fathoming” of other people’s points of view and perhaps reframe your own on any number of individual subjects. Roe v. Wade, “Concourses” and CON-CERN; because this has been such a “hot topic” in the relative psuedo-edufictional story of the space travel from the lone planet Earth ((intersected)) with the set of skipping stones it takes to exit a Totalital multi stellar system of holographic computer simulators into the … “molecular world of vaccuum and Einstein time-space” … I’ll start with this simple example. the current American debate on the subject, right to life vs. right to choice; provided by the “generic version” of the ideological christian right and the liberal women’s left. through a first layer over layer comparison. the scientific truth brought to the table by the introduction of “neurological data” proving that there is in fact a moment during the gestation of a human embryo in which “i think therefore i am” connects to some sort of Skynet-became-selfaware at a point which I imagine must be … although it possibly is not … prior to the next important literary device/step “let there be light.” At the point the ocular cones and rods are created and the fetus opens it’s eyes and literally sees the bright light that could probably only be compared on the next edschalon to seeing the “exit pathway from the womb” a. we will finally kinow whether or not “consciousness” is even developed at all before the bicerebral cortex designed to “compare two thoughts, ideas, and shapes” has the ability to get input from the eyes. Personally I think thought begins much earlier than vision, but the simple fact that we “haven’t yet had this discussion” shows how very little our scientific and medical progress in the civilization of things like murder, and understanding of life and science has yet to come here. “People here” means something different than it did when I was born, at least in my mind’s eye … something so completely more advanced that it’s almost difficult to believe you all don’t see this place as a great prison or farce or unjust Azazel–blaming a man for looking like a rat or a mouse or a dog–in a place where more to the point we stare at a kind of physical violence and horror that would put Dennis the Menace and Bart Simpson to shame. A world hwere “people closer to holodecks” blame an innocent man for “writing the book” on the connection between Holocaust and Euthenasia and Hospice … certainly you know “an innocent tool” writes these words to you? On the Hand of God, the Eyes of Ra and Horus; https://www.hebrew4christians.com/Glossary/Word_of_the_Week/Archived/Yad/yad.html https://aminoapps.com/c/zodiac/page/blog/the-yod-aspect-the-finger-of-god/XG6P_beTgu5gdXrYNwVjBj0WQlDeDWlK72#:~:text=The Yod is the 10th,to be carried through life. I’ve written quite a bit on how “mind control” and “voting freedom” are inherently related in and to the thing we call “Civic Involvement” here in the United States–basically that participation in the verification of truth and the public understanding of tautology and temporal falsehood are … sort of a slave like requirement neeeded to ensure that any freedom at all exists I often say “plugging your [head into google]” might turn the Aesir into an Acer, or the “yodelling of the lakes of democracy” ito “the agricolae becoming nothing more than the Dell.” .WHSOISKEYAV { border-width: 1px; border-style: dashed; border-color: rgb(15,5,254); padding: 5px; width: 503px; text-align: center; display: inline-block; align: center; p { align: center; } /* THE SCORE IS LOVE FIVE ONE SAFETY ONE FIELD GOAL XIVDAQ: TENNIS OR TINNES? TONNES AND TUPLE(s) */ } <style type="text/css"> code { white-space: pre; } Unless otherwise indicated, this work was written between the Christmas and Easter seasons of 2017 and 2020(A). The content of this page is released to the public under the GNU GPL v2.0 license; additionally any reproduction or derivation of the work must be attributed to the author, Adam Marshall Dobrin along with a link back to this website, fromthemachine dotty org. That's a "." not "dotty" ... it's to stop SPAMmers. :/ This document is "living" and I don't just mean in the Jeffersonian sense. It's more alive in the "Mayflower's and June Doors ..." living Ethereum contract sense [and literally just as close to the Depp/Caster/Paglen (and honorably PK] 'D-hath Transundancesense of the ... new meaning; as it is now published on Rinkeby, in "living contract" form. It is subject to change; without notice anywhere but here--and there--in the original spirit of the GPL 2.0. We are "one step closer to God" ... and do see that in that I mean ... it is a very real fusion of this document and the "spirit of my life" as well as the Spirit's of Kerouac's America and Vonnegut's Martian Mars and my Venutian Hotel ... and *my fusion* of Guy-A and GAIA; and the Spirit of the Earth .. and of course the God given and signed liberties in the Constitution of the United States of America. It is by and through my hand that this document and our X Commandments link to the Bill or Rights, and this story about an Exodus from slavery that literally begins here, in the post-apocalyptic American hartland. Written ... this day ... April 14, 2020 (hey, is this HADAD DAY?) ... in Margate FL, USA. For "official used-to-v TAX day" tomorrow, I'm going to add the "immultible incarnite pen" ... if added to the living "doc/app"--see is the DAO, the way--will initi8 the special secret "hidden level" .. we've all been looking for. Nor do just mean this website or the totality of my written works; nor do I only mean ... this particular derivation of the GPL 2.0+ modifications I continually source ... must be "from this website." I also mean *the thing* that is built from ... bits and piece of blocks of sand-toys; from Ethereum and from Rust and from our hands and eyes working together ... from this place, this cornerstone of the message that is ... written from brick and mortar words and events and people that have come before this poit of the "sealed W" that is this specific page and this time. It's 3:28; just five minutes--or is it four, too layne. This work is not to be redistributed according to the GPL unless all linked media on Youtube and related sites are intact--and historical references to the actual documented history of the art pieces (as I experience/d them) are also available for linking. Wikipedia references must be available for viewing, as well as the exact version of those pages at the time these pieces were written. All references to the Holy Bible must be "linked" (as they are or via ... impromptu in-transit re-linking) to the exact verses and versions of the Bible that I reference. These requirements, as well as the caveat and informational re-introduction to God's DAO above ... should be seen as material modifications to the original GPL2.0 that are retroactively applied to all works distributed under license via this site and all previous e-mails and sites. /s/ wso If you wanna talk to me get me on facebook, with PGP via FlowCrypt or adam at from the machine dotty org -----BEGIN PGP PUBLIC KEY BLOCK----- mQGNBF6RVvABDAC823JcYvgpEpy45z2EPgwJ9ZCL+pSFVnlgPKQAGD52q+kuckNZ mU3gbj1FIx/mwJJtaWZW6jaLDHLAZNJps93qpwdMCx0llhQogc8YN3j9RND7cTP5 eV8dS6z/9ta6TFOfwSZpsOZjCU7KFDStKcoulmvIGrr9wzaUr7fmDyE7cFp1KCZ0 i90oLYHqOIszRedvwCO/kBxawxzZuJ67DypcayiWyxqRHRmMZH1LejTaqTuEu0bp j54maTj09vnMxA0RfS+CtU5uMq+5fTkbiTOe1LrLD72m+PVJIS146FwESrMJEfJy oNqWEJlUQ0TecPZR41vnkSkpocE1/0YqUhWDGSht+67DdeKUg5KwvYdL21d/bSyO SM4jnyKn9aDVzLBpYrlE/lbFxujHPRGlRG5WtiPQuZYDRqP0GYFSXRpeUCI46f49 iPFo4eHo2jUfNDa9r9BjQdAe4zVFn2qLnOy8RWijlolbhGMHGO3w/uC/zad3jjo4 owAfsJjH5Oa1mTcAEQEAAbQmRUFSVEhFTkUgPGVhcnRoZW5lQGZyb210aGVtYWNo aW5lLm9yZz6JAdQEEwEKAD4WIQTUJHbrYn3y2DzwTcnQP1ViZf5/FQUCXpFW8AIb AwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAKCRDQP1ViZf5/FWM6C/9J gbRLS2AWGjdRjYetlRkSkCoTYnXWknbtipYYHlhV0YJFwFMm0ydZIhFX5VDoZyBV 0UBeF1KJmcMoIfrHyhq2QhCnjE14hE1ONbaYTGtpvj851ItbFWXMJIVNyMqr+JT9 CWIxGr1idn+iHWE3nryiHrdlA3O/Gcd4EyNmaSe/JvB7+Z1AVqWkRhpjxxoPSlPm HEdqGOyl3+5ibQgUvXLRWWQXAj80CbVwwj1X4r9hfuCySxLT8Mir7NUXZFd+OiMS U8gNYjcyRGmI92z5lgf7djBbb9dMLwV0KLzgoT/xaupRvvYOIAT+n2mhCctCiH7x y7jYlJHd+0++rgUST2sT+9kbuQ0GxpJ7MZcKbS1n60La+IEEIpFled8eqwwDfcui uezO7RIzQ9wHSn688CDri9jmYhjp5s0HKuN61etJ1glu9jWgG76EZ3qW8zu4l4CH 9iFPHeGG7fa/5d07KvcZuS2fVACoMipTxTIouN7vL0daYwP3VFg63FNTwCU3HEq5 AY0EXpFW8AEMANh7M/ROrQxb3MCT1/PYco1tyscNo2eHHTtgrnHrpKEPCfRryx3r PllaRYP0ri5eFzt25ObHAjcnZgilnwxngm6S9QvUIaLLQh67RP1h8I4qyFzueYPs oY8xo1zwXz7klXVlZW0MYi/g5gpb+rpYUfZEJGJTBM/wMNqwwlct+BSZca4+TEHW g6oN0eXTthtGB0Qls71sv3tbOnOh/67NTwyhcHPWX/P9ilcjGsEiT8hqrpyhjAUm mv7ADi+2eRBV8Xf8JnPznFf0A1FdILVeVHlmsgCSB0FW0NsFI5niZbaYBHDbFsks QdaFaYd54DHln69tnwc2y3POFwx8kwZnMPPlVAR2QdxGQD4Wql7hlWT58xCxQApf M98kbAHjUlVYLT0WUHMDQtj4jdzAVVDiMGMUrbnQ7UwI7LexSB6cJ7H+i7FtS/pR WOhJK6awoOO9dLnEjm6UYCKsBdtJr98F0T7Sb7PnKOGA77y2QN14+u9N9C1lB/Z1 aQRQ2Nc51yXOQQARAQABiQG8BBgBCgAmFiEE1CR262J98tg88E3J0D9VYmX+fxUF Al6RVvACGwwFCQPCZwAACgkQ0D9VYmX+fxU+KQwAtFnWjGIjvqaNXtQjEhbGDH/I Q5ULq/l/wm9SmhG9NYRu3+P6YctCJaZnNeaL+6WFk1jo4LMiJEUT9uGlCbHqJNaI 6Gll1w6QOVLSL8s5V1L477+psluv4WBpi3XkWYlhDOFENCcWd49RQsA2YCX4pW7Q 7GcoSEJoav38MxHmJHYPfjSEvUZXDQIt8PFHSEScvyDWfYtMdRzjmSOOPdzhDDEy 5JBOBcEdSTyDiyDU/sBoAY0e8lvwHYW3p+guZSGSYVhGQ8JECzJOzwc/msMW/tJS 2MLWmWVh5/1P8BVUtLC2AQy6nij6o+h6vEiNzpdYrc+rzT3X5cACvJ0RtCZcrnhl O9PLiona2LEbry6QX5NL41/SAJNno3i72xPnQEe25gn3nbyT+jCoJzw2L0y8pmNB D+PKrk7/1ROFFVN8dJeGwxLGdBcz1zk2xeumzy7OaV8psUyYsJNcjyHUKgclblBW rMR2DgqEYn8QdK54ziKCnmQQZeMPiC6wlUWgg5IqmQGNBF6RVyMBDADALD7NkJ5H dtoOpoZmAbPSlVGXHDbJZuq7J13vew6dtXDIAraeGrsBqkF8bhddwVLzWylMrYCG Bf2L1+5BDgvqu6G+6dcVSbBsnZAS0zfJ0H8EmTvUMxMF7qOZYyrxfLz+pQRq8Osz Icab6ZI/KB6qZyQRvEFPB6pJjt+VvuwgJZTObIwbBbgQri2i02VBkjchsVhiSX9l +eiK7O8ROHKb3P181oScIsHywBOZ9DxRAYbFk5dnBqxO3WKb02H0zqE6440cjXwq TrZZg6ayN/IlPajO8iJPYZ1aIBykxYq1WHo+nhFMYz/VVk2WJorFeOgWaLGXb73c ty96f3qXTdvMDAIWHx8YCD5LbuqasO6LNQm4oQxkCoB3K9WFf/2SvSYb7yMYykb8 clTPt+KO0dsxjWhrJnfnIhC+2Chqv2QvRbFz0S9CpUnGGDweJ1uRNV0y70tO0q7t xXSTDRU3ib6vAHA0K/2MFzwUcog4o5bj7E9uCNJH/DJLZKsMIe4xsvkAEQEAAbQk SEVBVkVOVUVTIDxBVkVOVUBGUk9NVEhFTUFDSElORS5PUkc+iQHUBBMBCgA+FiEE IRklfU/C1qukq3xMXcNH0t3P9ZsFAl6RVyMCGwMFCQPCZwAFCwkIBwIGFQoJCAsC BBYCAwECHgECF4AACgkQXcNH0t3P9Zs+kgv/XEuuWc89Bjg1QQqKZueKNUHjyjnE 2adfoZUH6Q7ir4JZyRBCVpAwrgssmiKid30+SIjwQcpb9JYa/X1XJcDUcJW/I21d Agz/zbEqn/Cou0dUpNCtxgm4BdSHWGoOtgfspXZlXBQ407tRMZ8ykmLB1Bt0oHvw PT0ZOtqXM4pyFnd2eFe5YGbNgl3zqvoC/6CMN3vqswvRlu1BpUuAjdW8AHO5Yvje +Bp852u+4Qpy6PMBiWGsBMYwtf6T7sckpMGlR0TsozwBlAm5ePKK28B0rLJPkZLJ Eo5p4rKRapEaZsWV5Qu1ajrVru7qmpUhZtX0/DddGHfXVuLssmKLP6TumpQB1zvQ vfoBltjvOx35Wps2vHuCzXLw2bROIOzhAxFB+17zxnSbE54N4LIGRpkELuwxwGbg FtD1fi9KtH7xcn33eOK1+UD47V+hKyJGrQgSThly2zdIC2bvfHtFdfp8lOFpT0AU xjEeoJGqdQVupptXyugPlM5/96UJP8OZG0ADuQGNBF6RVyMBDAC3As6eMkoEo3z9 TkCWlvS0vBQmY3gF0VEjlAIqFWpDIdK3zVzMnKUokIT1i7nkadLzHZT2grB4VXuJ FvpbYw5NPR4cDe9grlOMLEaF3oSJ1jZ4V1/rj9v1Hddo8ELi/NToVrt1SB5GCVXB DkYpNLtTiCqHSU07YqwaqH8a+qbDmPxSQdIybkZiTiCEB+6PfQQlBpENEDlov6jm zZF+IcfM6s3kZDX5KFULweH30gMjq8Se8bPtUzW013+tuuwEVr1/YRLrIh+9O6Z+ pdA7gLMRYnD9ZLDytEvpb1lBBSY++5bIJ7xps80//DNqPYqwFmZQgTg0V9XbHE2e wLcOF8a2lYluckU7D///sWQhW+VxuM7R2gEBvYBhOgjWhIF2Aw6NbymW1Ontvyhu eOZCXXxV5W44PxXT8uDdhl9CNcHoBKKJyED8tKjigtn4axpsQeUrnOSbqEXSyqES WnE2wYUDzALcwFkzsvtLyd4xaz55KkPQkAkk0BZd1ezgXxb/obMAEQEAAYkBvAQY AQoAJhYhBCEZJX1PwtarpKt8TF3DR9Ldz/WbBQJekVcjAhsMBQkDwmcAAAoJEF3D R9Ldz/WbAFwL/382HsrldVXnkPmJ1E2YEOFz4rcHRetJ+M5H65K/2p32ONQ5KCbE s8MRY6g2CkE70en2HlpDwr/MdATwxBzIjEpjgHbfqCqVVATY+kSpXsttaKKAUVHi bFgV4QkdDJNSpcHEj+bqaggRnuWiV9T6ECG7kQjHiEXPNojzsiaXMDiM5r+acZm6 82id9qOFySQ2cZEy5HbwXM+ITLQGngnppa7du2KdgiqDeqtODOTWZvLYAq2tmEwD 3TT6ttLUBwOOu2IWpDkXswlrk62ESorE5mpLxop9fsxD39E2H06JoC/YfUPIVkEv fj06e7LEdcx0I7kRfD1v6qOUUsMsLZnmyGIk24iFjLkwu1VToWfwXDN1D2+SeAat 9ydNt4M7oEbd1QaOXXjmqpdU+VUiWcBXg+p3/WdV60MkyAgc3x+YanLljy/Rh18h cZwVlinf/tgvAQLi5f9hpwrwUMoGKijEYHKuEvi3C12Si7UVDfuIR7yS0dKcfuKF MbgwdvNXqpD9W5kBjQRekVd4AQwApHVgw2PVlBDpVcyoymUOXFQIJzJ9wRtr6/sG zwv8rrQnUEtOkkna7TDU3/UTj9FUH0gbpAKGNNPaPj5q0dlLIvzxb15r1uvDGaGL MA+8GFaGFnkxzhg0aXrcKZAN0/Zhgi2B7P8oXQuug5mi1JVDkZN5SeCZNOubdQWL 3xz3jEHp3ixj1mdOdvfdWQFR4CVMXt/A6VI2ujLVb3Yalft/c5bbclAgcJQhgDUu NqGYJEJonESNRSd8fEvhNb6cx7+Djd9+Wyctr76mwOr3nRb1N1OGhFxWjIroUpfz b+6y3oQjT58cJA1ZHqmJ6UlZd81hNNd9KWpbDVwONEPpiqPzfSaonxuqQa0/Cy4W 403OhfoLM/1ZDqD4YrJ/rpyNEfSSdqptWiY0KeErLOYng7rStW/4ZeZVj6b2xxB2 Oas/Z1QYfJyFUki9vaJ5IyN6Y7nVdSP6mbAQC9ESh+VPvRUMpYi4pMGK4rweBVHu oMRRwzk7W5zVIgd425WUe3eCQFn3ABEBAAG0K0VTQ0FQRSBST09NIDxFU0NBUEFF REVTQEZST01USEVNQUNISU5FLk9SRz6JAdQEEwEKAD4WIQTvnDJqcmqzlF87/t82 pJ91j4NOaAUCXpFXeAIbAwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAK CRA2pJ91j4NOaJVjC/4oo5yCHe7M2h1DiTXVcLI5rXQ1feY7B1feg+YJX/mI4+EV xjC/y5VVpV4syJk5GGZNXhKPHiGLaBYvglTlYOJ98RSEsHrwT3go6S8ZVvMNdP5v CEncn2vm5JGnp4k26PuOzMcJioQLOoUjWtcPFis3gG+ueH3NcPZ22oZUql2xuerh TQZegGp+jJ7bdxwYElx5jDDDkh196d5nlO2ZKENl0ZDp4GAzRNjnQ7KBV6R74J3U cLQDWY8vAFaRBZXIC5XtSzj9lr+jWgvxz7Il51+26VDTEtSafZ2uZfCOFk7GrzJg YFJD3zLnwUFXDWKRkep8TSwXnHmz/Ts/Mjyv6em25w7QTdnx1hNPxYNWMxPWNEAH pf70nNyOmcWcq27W+nAjVg8W3st/7J5CIebJQc5AUgm+fGOBW6XUQaNy2YF1YJlA 71/tls+R5IQZCYzbPOibgFS1HWKTwy0iI2rMDfxBtCXciv754jVI7L6R3J0j5Dy1 WZQVjaGgimznLN6XwYy5AY0EXpFXeAEMALvElrTV5hJG9DKu8cOqQEEVejtWJtki fZyvmiAKi2bZWiNfl1MxJt+o3Oc0eARJfnaPjrUY7hsbbSBAB4lFnDRtviARPaKM st5FkFgOh7Xx5ODc8bjqhMT9tbX37rkeDc12WAs3UxtEKWjyT7Xg/APKeK5FzpIs qew3LADdqFP9nOR0e5G8gxLTYh3ll3dLtp9DkJgA9q+0g31nNh5fZ29mcDzo/Mat Uk4PIxWC29LV9ALCJMIMesjOPiDa2KOy5QQH+/vn592ydBohOaY+B6jhEAdX8Dbp VHVFRBsiCOWGmdi6vHjMFD0tQdS6bXf+ZAG0E5HZETCxA2qfMf/vTeIJXYS5IZw0 anRkTXcTBrVE8uBpqtkNOrLJsaASkcoO5qF01J9zW8SR4jDgET7J02Fxf8CVPzb+ ZoNc9S0ZEO6Ubdh2vAkPtOV5sFkwIduN6ouAhEfJzC9XbJLpgsBKrRMAjr2FeEZP ruy8BkZbiyZ/b0S9qIgY4pqcyUJ79w7FLQARAQABiQG8BBgBCgAmFiEE75wyanJq s5RfO/7fNqSfdY+DTmgFAl6RV3gCGwwFCQPCZwAACgkQNqSfdY+DTmhD9wv/Zgav EHMuqF3765Fa4NapYh2kMS3skHn+ZzUEPLTlvrt7KHxomOzExNLSscZThMpur+yW MfNWbsw9GphiYAkMULrfJt/iWRVJ1FLgbcWgRGAwakOGwE29lMx3+rPIUQWU54Dw vE92Iz51ZGz1wgKcISuCw39g/HQ9uc3h3TfHLgfkc/GaIEa8jEOAcD67dVMoU4o+ p3nMri8z6sK176hQ/FM/8kekpeVfxmR8s6uoaJsXLRQk+i88ZwBR/5U+fBT9AtVw PL/MmZH7eCmZrn5hjaOw7tpkL8ZyAydNhOsSCqwNVtrIjgd+Gq1oSgw9EZfhKSUa +dBJAErA7MWjammQizEHDNnI8VNLngwCahGwaSgDhNaQtgNxvnkWO7XNYoCYXScP X++UmpWtSKMnD6ue36Ba1jqon0WY5cen3P+H1gL4ij5ynB9DrE8R1aSY6f+VZ48B RvjHm5LKTcAhiv2N/TyAg/fr2v9ZnEcP3CFxqAyB9JSKwoBkFvxJaRHTT3DxmQGN BF6RWE4BDACpgKWvQvPRDN03+sLYMXpJUPC7VhTjg5K/1+1vS/e/W65dYzn3JYxb ip2PcI5xajFnxzUrwwmhW+qz5REDyCtAObOpKsjtr4qu7mgOWnPa3k2Lm0bpCjDr BSFOiQsBVezTG/gJm+qELeqQMS9PHDSvZXeBROK7OkRE0nZ6yAj+QKEoVqeADpDm BHmhAA2OKBzq4rDWDh1jRQ7gLjlv/BFbhU1WuEfH/qzX8AUSsd0/hoPG0cPgC8gQ 3m6wr4eYqI853XQujWwisnlAE2bf9jsRjW+aLrJJTcADWk5Op5aQhI2lURYkryfC DFVcme7Hsrd+RFPK88J08YjBjOoYFwRU4AhHgucX9tW0S0v9hi3pKrF9O/JAIf+r h6BpnWo7tT5+8mVhtFvfEp9Y4xeUAKKZHBKhzHeOO8QQgHrIYa6HCcU03eyxy4Tq AsJdAJvxYFCRPdY9d0Z6uVsPhRy+3UmTxjl590T5/XjKPriAjBqXnKr4KexsM1gj 1L96bYDEgr0AEQEAAbQaRTFYNl8xIDxFMVg2QEVSTUNDT1JQLkNPTT6JAdQEEwEK AD4WIQSGisfXZ2Vg0m16Mzds3dDsq5BTxAUCXpFYTgIbAwUJA8JnAAULCQgHAgYV CgkICwIEFgIDAQIeAQIXgAAKCRBs3dDsq5BTxKq8C/48HSgecuI6MYtq84yqaQ1r x6cteRyn9BJDFTAUxn3X25kf0vVyCKQNAy2oybD5QHFLqhFCXJH+cnJ3xdviRUeW eO9fhkTmd12mHGrRDD02AHXZmaMp6ni7FuYpBGrw5dbXKTkSWfD/qb3odMx0jQby 6X+2eFhUpyh+yPB7P7HwiPwzdr0dBg3xE0vE0Vz+naMyt4YBHzrBbZo+y47Q86Ym TmBKxG5tlVsGDB4dDWSIvpBgnMFN1j46Uk2ihu4huohLkvSou+jYU+5Ppu8Fu1+7 i3RCILzeBtucR9+T4px1WVXx2sKOk0FfddCvI/fT/mhsgqQZwjj9b8HNfobhNxkL HBNFQ7FLJxKayPwMyJYDURUq7gz9p5JwHTmFg9n7zyK8qU2xR5t2247YinfEJQYL zQM6VKQCoDqydFfAPeGlx1KjroMGls4sP3XVlrR04YzaJ0vxRgog1gIO1aHMQ2Sj l8bG0GcerQ44rpn1v33Gw6KL/0SY9JsSSSjA9lgINWi5AY0EXpFYTgEMALy/jHsN kUQQVJK9QuAy5V2GePBTEm9NnjNCk+edGjSgqC1LemmP7EYh07J13d10VqD2Wtae bXlBeaMOcnoXQdfdK6nTKWRrH97JuRTrA3efLkl/R4EA/kHHV+YDgT+LBboUFYVU QF5YhfcvgBUcLXI3lX5wMEQbLb87cVjR0JtqVBFMIIvs4ibgr0U2SONiD9LcXZxf qYcX7CMM6RmuLzHTCEHyjp+KAw52K1i3+3M0OVZpa25rKE+S7LykQ1GrUUY3uVHg R2I3T5/Sns3Azc9wKuy/F71oiXyqCc3FwzTQHoki+eBf5dzs6h3GBTK3Dz6kl2mv 1TXpY1dk2EmuqKIeSr8CE52nkK8ZKY6cvX+v/p1EBAkJZKiasj+ukL72p3Lji5r/ iOarNJnURT5LJdYYL27dtQFSYyVWayeWi5358Ajh1H9OdpiGXcgG65ry6u50G8JR FCywwsdKpGjMG4FlkLkm50/piU+cgVeLET/C7C/OXNslL/pHV3x8kPRY1QARAQAB iQG8BBgBCgAmFiEEhorH12dlYNJtejM3bN3Q7KuQU8QFAl6RWE4CGwwFCQPCZwAA CgkQbN3Q7KuQU8SHSwv/agnEnhmo2yuKCLiKdTa5KZ8wh3umiX3S6rldW0NO2h8a cq2l7xHY1r2u4ieeMx27jtTqCp7ksFxPYwP9WxtVBy0teG8pKLhEffjyG2WKDzAN 7oXNZ7Ur6OQGfuOQzlMqOGtYQrbHAuX60PCldurX/6/0sKS6vESdeGMQPoZIDK5g HP298MMhlWYEG7uU31J1Cx9ZqiTosSckfrDq3weU8x9DZYaLZ+Y2akF5XpL/HjyA 6PM+lv6vnTA+b5DYCOJb6N7v131Net2JN7JVVGoc0FjsxN/W33H7eIDOZwqcCvzD i8EjjzZpZUDeYjlSXAqWvpeAASncMzXS2/S2V2u5X2iR7tDtRj9SuQehJkdTFNZH xh5nTdhPzgh/iOcm33VsQ17JWbovl0hbhYBPO4V+yIrN+oQGPhH+KCNNa39EjEzB iBIgirxQSaykwb4f2Kshh+d7rKHKb/mn6JBHU444mBf09m5wM/mhLSpuhMTcP2h9 jfFximAE9FBhdZhQsF29mQINBF6I/R4BEADotSG8PhhxxD9/96bgdWa1bzp2398W LaxP39T+Kzx2KL2xB+7B4EeTTzZ06kD+myCC9Ez+PqecfisJPfaiLD/+0/m3HLSS hxEaEqt1RBS3j6qJx8Lr51cAwGou4hGTo9H3me6FHO2ExZXd76A6kkUh0J4y3r6q aAoDP+MUczKzEjn6C6T7Uu0pdgYY1bDhuqlK0taqkqviGBYTAqmCrtcQhj+J/jbd OIZtpT3+PH6mWqguoONiE+glWcdThyuIvV3ix/GrhjmUZb/DQcvvbYGfDvGRBH4B Uj3f9WBM6HWSxKrCwWC3OcgZhtBcZjKrMPbNDNt7yAArv7nGpHmlpfF14Q6mVmVT 6Ulh+0xRx+6zFbqlDYYTneurK3RtqOBsMFG5rNDZYh/QOsHnSsxmU4LGdlEfQjYs 901zmzP7CQXjjJbtRXWIqPcn3OHIIasvjTACe5M+Lfk3u3rEiDYM64vg29sSyp9q 8hAzLTPcLj/Cc22jUEC/bbv5HfLyCZTCsu5ym1gDQZ6bDrJlFlXZJ2+vTCBsY24H RF9/J/z1JWYD1cAHpG0GRtYE9exKpu8/81jxIVn21qvvxSCPXw6IQIsEw51uk5TJ xAUIRCPN7S0UEtd22LSbM/IYx1cesCRUCmY7jDTro/jo2B4hLG64KBgqyjg0lwxd dy5S8LwFx1zskQARAQABtGhBZGFtIE1hcnNoYWxsIERvYnJpbiAod3d3LmxhbWMu bGEgLyB3d3cuZnJvbXRoZW1hY2hpbmUub3JnIC8gZW4ucmVhbGx5aGltLmNvbSkg PGFkYW1AZnJvbXRoZW1hY2hpbmUub3JnPokCTgQTAQoAOBYhBE+vDT4gih9MmA0P ZvtOzkoQkinPBQJeiP0eAhsDBQsJCAcCBhUKCQgLAgQWAgMBAh4BAheAAAoJEPtO zkoQkinPJ4gP/3U691086OKbWiQhMhV+AViuKnMgV4i1M8s+4Ep01h/dTE6R+rUu LcnY4T0HR5qxAYMiNpGo1vtvkMvV5DP1PFSl5EddKn8+Kvn/0+WjbLV5tdiFF1Ef xR6261UFoXAGk3HJMLQifr3lWKoimaBwJZGza2ok9k1TQVTn8g5a01bzK7hD5DJI zt9RJZaUkxGE97eUyJ8Dtwumo18EWJltuC4UWjWT2t2HE9mMsOfjpYZXFsGxJ0Zb xexo0DYsriPDpuxDnZT7G3re9Vwz2VIe388DNBW5HoJsYxhr2I0QOq64ZWOSEZC8 lDH+xM6YdY0iz4A+7nbKNGifLbH8oU4A1sV9HrIE2KNy76x0GNjgQUvcq1inD4Oh yorsRh/IF6wnqvFrHOstCS2dzpKuQ/s7bM5TGOD2EGb0xu7r0AfHqqLUlbr3rxkS wBFMQphyNr3mEkEbXU1dGsXDlRQy11LigMBoEHmP0t49bYWuM1mIBnIC7gZc/sV/ E5fWmWdQyCKmHeujmS+sgp2EX0NtMGSzm7z9WBzTBFjaN7q28gueQ3INDsDTGx2G aA1LbP2uh1ipwju0GxecUif3T2NDqaYfhbaCYsPJORNUlJUtCVBGeba9wcXai2dh l+HsSKUiyCgKiy6Rt6jumKtYHt+Q0zcKWLfVp8PA20zX+2Q9zKnlLzwquQINBF6I /R4BEADQ4kmCHYtAhjCShc724Ei2pqSH4SfnXd4r8S8I0+io6Mh0kWn+kbKk/aGK BL3KJyN6624kPtOFWuQ4iQ0lWFn9UMnvjByTPbjZ2je+VtCP7lKSNvEgTLQRxLEJ hoNVrNjrLa/Cn7sLt9ayYcx8eKpHkbmrVRTyGqljBkI5hwQ8S+7BWugabhGQuogw bFthykA+wxYvSbSn5mwKO1BlbDCRnxjLISlqWwmKKEtXQ8b3tu7GgFuPYLKaLEk1 BIwwUSdozjXu+198WligepslidlN5bXrvje3sxgt4oAPFMeH+NnDClSDuGhSYamW Db3ZPl95pW70ngUVgFPG4kQOlaqzo3YBeDBHDXlqU0+O8cwSQFk4CBJI3yt6/KmD BIuKLwauOxYullx9EnqKcLWEzOlTgn9Q7BARK8Uz7PQU3+1mDNId2MEg+gfL3rd2 +aMLNhTUkgVE5mWkeDz6Kg7YhwruvJtn0z1QqUhkQcVs7N8rVCck0YUCVGXpsUlu emK48q4ryOxmMG/+Ws2Xkmdm6Axq414WHz6nLwMWgFpcO+1wRwQuZEkeWeSAjEvS CGHImxTP7E08+y3vAl43a9AlR7v9PbtCy2FenAhGPigmWm2aPj1ejYfQLXozyWSM m8uO3aiKvQXdV1Ha2xQLK5expaRaAXQ6YLsNBD77UPxi9qC5rwARAQABiQI2BBgB CgAgFiEET68NPiCKH0yYDQ9m+07OShCSKc8FAl6I/R4CGwwACgkQ+07OShCSKc9o DQ/+OV2OuDp9g/27SRssbTWE+nBl0R9klrb/w2XEIVhg5LROUe/P3anyBLNITbF9 A4q8b9udD+iIc1ClY2bu3rQOdzA1DH9GK84bQ1O/LaU0Te8RBGJJEzjYMUraCgIX 4BmxsIlWuCkSNsTgempLOK88646Nv5uc/oxAj6kQH7x8XBXxaJ+N9WS9f7EAv4AL bSWeJ4ijbw9BIMHt/D9Em7Q8bW6VGZIEjIp+gl1vNZ6QGCTtRHQez1jYmFLpuE/G yh1zM5gCnZbcmC7ExDLFI6SuYUbKC+XaLA3+LLCVCPFLtu6wLvcgYFwWWMKIhJAQ bRyPePiuMqWeWR6VXTD8pLziDjxK0ZtvpGdOtZeCCHOEmxrCsfKdIyD2Gn7TmTwb M9fRE1HazROfit6SRCAamabg+dJIEGT8vzlLfnkZRi+6hxq88uDbrOkk36ShWoYB AApz+5fj1ogLptiaTUTyyjTjB+/FIbU48/02fkD0y960zQLyKL64Q4aZrNa2NNup YKy5F80NkU4rHOZ1HTaPLoqqVsGhWc3ODgLyGPiRDLlZu81aNpA/UnTEBX464Sk4 Jx9qztb+S50LnGItA92QfE9ru7FAE00RR6mpCv1h7uE28/Wr4XaYgJcw1hAPRr7p TtN4lph+sJsCQ8eX5YUlM/Pht1h/LoE8h4hXNfAGh+CZgoWZAY0EXodqtAEMAOBb WTLRDxNk9SbC7exKdw0f8Wy9DhX2Qqoi96piS99CMJSxeocLiC9Si2u5nL3sQTAu qs1YbtSgn8kkiH3HPEJIhV1p/Hvz47j4kXq7PnjqF7KAdCYewuDqRiq8J7TNokYs 6+3/KqwHT/IT8NwPLdMkXcv/SXqhuKpqa2ApIrhu04VFp4H5OXN9rqdF5ZDfcNx1 PQv+6m8v6xRwrI3kduRCUD3YiVPM3EOhqINk9XMuxAoVX3qwpz+OuEDBm76U5jTZ q9ErdwRV9gaGm5ztq6tvElpis3spM7BPHzbv0SvVRAAbgGVh6kfiaZ3YckxLq8ln Cg5or1aZNyGMf7CmaZaeAjeY6Y8FZXR1P+n/IFd9Ak83a3qizZyckfiEPO7hu9zI FFXTdtZIcV102rNoVzruZIn0vSK1DJ7bNNrHkm1PPcweMkcFJY0uh6l3x2nl2qKm AhlDs3wFG+nqvqmnliVbrFZCYlReMrWWI2YBwLC5uBcBpFAhMPNEjxOtv31R+wAR AQABtCNBREFNIE0gRE9CUklOIDxhZGFtNUBwcm90b25tYWlsLmNoPokB1AQTAQoA PhYhBP/zHob861BG6LJ9SqGPd44Z/DJIBQJeh2q0AhsDBQkDwmcABQsJCAcCBhUK CQgLAgQWAgMBAh4BAheAAAoJEKGPd44Z/DJIKtgL/0JQEzrGWoHHN7T4wLiArPCv tHB3dTZBoXGKlpuwhgOZ1th6jOnGPdMZRYnX8Zuf7QhaI7m/duKv9OAr8A/2ftHG 7/BxPSHJWBuIGZYNL97OWSstuBhNtyxfCftDkeBCqJ+lAneOrzV0M8syr2VqpfVs O8nTE7nXHSOdyen+1Fw0PtwaeG9uJvOhgRsmQ+mtAiJ1OLGKUxgCzSUk0m/YnDg0 vJBtzq9qP9+EZSuiBuRQC0tKs01ECI5DzWLNXXC6X8k3YGrJpL/HtTxH5SYNQRvS ALd+HmVYpwijLPi7ANzmg9/+h/aq4VFP/4SyMd6EjaaQ86n2fC5zeugio4sjtFMp W3jbZPn19o2hWTt9/bLns+fm9PgnPwdC+tS5LT26N6vhT/vK/HHY5AZvXXPNcQMA wp+EVFxsWK2BcFMIi7Oq47CfuM1AUA+pgCenB4iSVwxs8ANTWWIsLkkKAYQqIdan OSISa2WdslsKMjXIQ5+rG9ekEn+rRO3EAQXRryBt4LkBjQReh2q0AQwAwGx7shIW OaVExpngqmh0ApkxJHZIxcxpatk/lSBQfzHg6e1/7Joe98lEHcWPJ6WFsGp+aC9S 96dWTBZq/4pzAqqTrSXAZpG/+yZlWRWSXVQex1gZHPzsWYMPE9qayAPTOJHtfS6a klIEaFV2GYEvvRK5UR5DFIlsfzyyCBOUKvn0/hikqJjN2YfHUy5SR5U5dGsSX3Jk Q9bOlBYDpN3Rk5rmLg0Vwn4nPRBET70MLQ5M4pU3Br6n+vU8tMHoVXYVMLinD4gO vVY4baXEZELjcPkPzGFPyjVLlpxKMHZ6v1Qb9ornTRGzc4dEUKxi3srdsTpMCw0k CaZ2WLY4sNBO33C8XfIvMx2jF4iIk3BrSrW/hirq6xpvlh4BUh/UWVrvg2rdemAX THa93mRQeOa3bze9xZwaA2GJLRG+xCIt15v/cNpQwCYlyhJunkuwk3HQcUrKfzxo 6QhqMeDaPZeNcvN3XoELGeqtoE7gKAnLp2nQuVr4/pcaiATf+yAhBgYRABEBAAGJ AbwEGAEKACYWIQT/8x6G/OtQRuiyfUqhj3eOGfwySAUCXodqtAIbDAUJA8JnAAAK CRChj3eOGfwySB11DADLgMAafhdzRgzx7FLVVW80IfgiCTAl5M1wV2HctA17aln7 jk7iEVMTLfhrSCSvvNIdrOXUE7l9HAMkKRwaZv7OAtYR8eQTrgGc9yJdk8BMzvJB ouiaNb2LSxMSvpoaJmD2C9ZkOyW+pAXKaUGhbUl8YVa7ytwPD6yZzonGClgZI0x5 9nSc5TiPpVijzu51iZiTV35F6en7ke2hjr6iBACJGBplxeeWszRa0wK2zoubAUK1 KO2punvtGqhi3j77/0sZgvFv3czJpRac5ccdLc02Sb6I64Stp04ilcV1aqlUXxbM gLwkoXZUqbCS7ZA7eBiEaKXdj9ww/gprO0AwFETxQVA8iPF9puSWfBf18a5GEdR1 Drb5lSReCkCfBJd3Tf5WHUSrdcai0FfuXNNp/7J7CBzlOJ0h6Yoa02hz8CBGGwxI 1brXRm13004bX7C9i+94Lbgf8bTM40JvyF1kmcffkj8ibpS/VSa8aWJuqpWk/xcn ob/YdBngWCxNgXii4E6ZAY0EXot8fAEMAJ/JOflg7U8JWescyTQNl9Xuk6QUIVKx 0zOT2k+drlLwC8+FckYTCF1pm8sPDBBv9eN3cFCDf076tZjUHv+Roq5c5McDHlN5 KlFbTSOv1qZYuaPY14nHIoW7OGoSvMCOBkpDLLwnIbuLA0wGdzyd3z6Vfhpz3wDv iAplyA4iuzJQq1+iS8tq6Uj2yhmfg+zU16gw2D3iEC6hhSu2KmPhMFD9KfCzq02L xC6fMh3Fogas51ZF1fRDK8Bvicf4yYj0dn3i6GDr0/vHga4eLQqVBXb0HCv2lNer gTtawQfJu2XEn5hDZKfHeBJ4NI4k7AZIPa7OuUqOAm8Z4hbkgRZakc+OhPSEKH2i drItwrPXDGqMYV4tLLMALMQ9WDTz75wbzVbxGVcAzG3MaZSo/f/iKzuzaE8cF71A dO1y6H5YmmMENn4t/D4BYXm4edPvV6SaYU1hO5yqr7vGbrQBFVetpSCLEFveACHr sm1S6nVVTazkHj2FNdww4bGMJzPqC7bBtQARAQABtChBREFNIE1BUlNIQUxMIERP QlJJTiA8YWRhbUBlcm1jY29ycC5jb20+iQHUBBMBCgA+FiEE9+R8sSygzQHF4cv6 fsjVqFo41joFAl6LfHwCGwMFCQPCZwAFCwkIBwIGFQoJCAsCBBYCAwECHgECF4AA CgkQfsjVqFo41jpPfgv/dylMY4CPMwkdry8KnKP3QtmJOl94VnpJ+FUME+oOqjBw 6/C16uWdTLYuEUuE2jEzTg2J0kgulM2vYm8rVgJzlGiD/oIgX3X5NeyB9MH+GCpu xsJ/ofIVpC6t8Zl78B2qTnJOcEc6owy/qKs/eFXSea2sRRstqK20dOajl4Z2ycEL SdijFR3aqT4hU6e0GNWYqo3bW4TUcd05RJIZBNz6Bitq1fxljxFPOOCaoKo9mVn4 0dN65iGPEYg0c50Q6EmxEr+XtwRu1rjgG3hgq6BknZ6QD1HOBemQg/3jqQBb9uHj jHbuX9HrbGF9+QbDicbmuZSLuV76xJnbyTycFhhIcSi9wZeyAAPlpL4GQ8l98jKa SCWWGDPpKwK5+o8kteuJ/D/mYyBEquyFVhPQBXV9zS3LsN7ab55zB5+ZnLUeofai LE6e+XPGeJmG3I/+T/Nuq1CqJ4Wyt8+aIyf6Uz8dDk0kjyQku484plRwMEx7oZXR bXQAAn8SwtlNGo0sHc6JuQGNBF6LfHwBDACxAxfbQM5AcssJlQFXThnBMHtRDeBH VkyF5mrO9JeFRT+mhM87V+fJXOaEKtcSFVgZJFKV2MPdyGqZSGKmyyqfUvKfucP5 LrjK3MRKibTlOMwbBOmYUksMVE0ByMPeSzyMlQhq0oyA3fvEdKEf0JrFGDRWNzO8 /Q54oj79Pki4y1BDKd7lE1srBFiVEUuPNJmjhhU9WXnMwiB55lLwbTR8mKEX0Pr2 FeTS5gttmbHf4V+wnJvlOEU6mOLMrb+6Xb4ltvqbl9ng1+tF2QMGMd83mtbFtAjb Zcl/Cq2KwsBFyH9VT48ZxWxpOYMf3ppEg9KOSfz9Ungtg4/Q/Kr9P13Nf+9+S9JS 1PfKdlJzGFDn4EwZ49ugg6GNnL6XuRl9jBPD2iD8hY9CsTdWrr9giCmJmdf6G/bK HUm2QekMbhpaQmYKkMeri45cHprx1dQ50rfiH1cBm5SxaK7z/hDDaKXF1Gp7/KwQ g6gHlyMss7EEHSY5ogH+6a7OUPpqbJdNztEAEQEAAYkBvAQYAQoAJhYhBPfkfLEs oM0BxeHL+n7I1ahaONY6BQJei3x8AhsMBQkDwmcAAAoJEH7I1ahaONY6EqoL/R7J QLaAlb4/hK7/v4vsSxtCirLWrqNNNJxYdmpXq19NKPmcc08QzSqkJ7vR4/kn2L6I OY7y7AMh+tScKTKIGn8MkAcj0ZvkafHY3xmpN1Xp9caUAA/fw6KWD+pSZpKpISyd 2Xr6x5OJGSKhyGpPB98oCsa809LQ3cweG1imem3jx+Lgii63pEJG/AeNeEwkIvdC zRLSQvYv0UjlhyOoII6YEWJcro+tgOcthPh2SY50E4lwFFfbz4CNQyL15D+XciNI xSVGz8gee/XdJdgwQF4SEnIiChhmJ5VmpNH8ZwxTMyI3EoFMB/RYaucwc/ucvySn cFyShFFRPjo6TOeYIaSrrfR+4yhHAGeM572y0btI6JjWZovupeXX3k5ZHHrCwxlR MuyULLyhUsAC0r1FUijbUWoyaDcRtLRpMUg1X6A7n1iH61WxlKQ/8mZhYht85Jgp FSiyz47gofc491ng9efshlyxwb3TeLbDZPRnls7L3sfDDWwp8yExjA7UNDbIh5kC DQRencYLARAAsFHArFeulhD6hZplRF49h8+zpI3kn+vFtYwbUqLSRwze53rrJtqE 6o5MWSfadr9KIc8tNZ2aBGxzjGnsbPYLDh76NkjP4apWSMX+u+EHsaudoZoAdNnM Kqr86sVzR0MUeGHp7n/L3imp1WoCn28eMLeNec9a4GRTRPGLKR9F/jytTz/XgkHL zA3i2pt63FqniN4PBTNFzgfXiu8xVZGohsDPjmd9LXbGKTXfJGhBLB6QsmjJwglt n+00ufdKLEZu6eBxRWSVK0t4rEnnpK9K//PKq5DtVaOZNe6g+hdi0B1gpd0f0nBy eZd9arCsvN3qLXP0vYTk9DKMUecCEblss5Zt1+qjAbsMk9/xSGZLJp/4dBTBVN+Q c6+Rmv+koe6zLNmA3fJH3991xETDzZxP2UHN7q4i4L97KA+nVAakwazNLiqsY/bT s58rXnCc72b7oLnZbNOPQmLwZFafVi4xoIE/5Zq8iVr7d7xHPccYkaEVCOnsL/35 GZxy2FNi4wuOfGwBtTbnXg/u/YiBj6yNbhLR+FCwZED5M/evgUUbJudxqRdrI+1a Zo9gGA3JLJZZ/iLwF1kE7yYBvyBRfaO9IL3bwplRurnrkjI+rRhi55AlbGhU3eMu iKTKQk+qJF11ocTGu/dE9I6JeQpEdyVehrWXc5H2N0Qjyca8ZEA6WwcAEQEAAbR7 QURBTSBNQVJTSEFMTCBET0JSSU4gKGl0J3MgdGhlIG9uZSAuLi4gbGlrZSB0aGUg b25lIGluIFN1cGVybWFuIDMgYW5kIE9mZmljZSBzcGFjZS0tYnV0IG5vdCAqdGhh dCogb25lKSA8YWRhbUBlcm1jY29ycC5jb20+iQJOBBMBCgA4FiEE0s8R6kp2bveF MmxLkifaSe8nN2gFAl6dxgsCGwMFCwkIBwIGFQoJCAsCBBYCAwECHgECF4AACgkQ kifaSe8nN2jK+g//Toi6ezWYrRbTs9xwQLIsKzl91ocjCuN9nHSnwzkrLuoGGgej fHkXzd5+3ygL47j++k69TYB9CPrGdR1GTqt56Q7DSYZCgdg+e89piTJUzbEyN01q EGkVuV5Rz9EocnPE8db9HT+xvf44ecfMOFD1XuB9jynrQD445YfeFE6LHkoNUvFD wQK7NN04fa+qvrk0lTS4NCpOYsdrSioddVjQyEC6jepwIRA3iRIkFdEJT8ggqQ6d gntsgExA01o6HqzDSHjSCA5AexCotwW3Uvdt0WwXx6q/c0LsRLhbuPeGX/Nh8aOf 6RBCQWgnIko675ura4c+r1VcBYl524ZJlN4x1x02YAo9cKzYi3+H9C8K8Ayz/SJy 7sVGHWnDge1yIwzWXbpolqiMSL5l/0OBuJ0HXQSafUut33Jw7hYKP4BQia/BmE0x Tsk0rBRMyihSYnUn9mYpXM3KwWU0C2dudVwKtToGR1aKlYcCv0iNFAsR0DBw1XSq n72KqIl020gZFmg3H34Z6CWhm20RbhMjOvvkZ+OiS9kU9kXt6m+T1zCpWHFJSae4 JF+dQyB1BFxAwXW4ZEzMo4XluTuW1R8pIadKTsHMWzEzH7RvZLKP4invsZklZ3I1 EEsJop7DSMOa27irD/IlCL+nwaEsCMRh+ndSkADLHsa9P5d/qWjomKxwdCm5Ag0E Xp3GCwEQAOoXU8NrugMa8OAncXKv4hycXJzArDae3Zx6pCCEkP3TZTXh1tqKPUtb dmb8Mq2eecVTwmB+FM3m+NApgq88Vx6HiyI73IAvgtZORo32YaipfbkGnXHfaUWX 5380R4GL597yZuP8sAsJ3iDvxhW59snsU8tLi+9r2u4h0fgMDqZXQsfvLUkDIiO9 nzJf0xFacTx3n+pUuWdzIuT3AUdU/L9NubmHSnj09FevTHWIYmxGFZoiSdS7r2Z+ 5xZmPak6lzrQTVS/DxcpyA/o3yi8qLPyf1VUxXKFeKd0sV6BPvYFxI2GeBl5atBu 9/3/5D6wdlrupTFLU1Msdfy3UWaRUFHLITK4fJ7pbTgoEqxX7gpO9iqKmScm3gYc O3blA8aTqCX2NzxUF5fHbi14JvPWP04uFl5EOeDB322Jm/guWy8TvmIIyuF3aAAX PfErW/yRWDsYOcAADs8elZkt3F+E/AwWd0JMIhd/RB3RFH8m7496XLS3xBP6rNye 0O+96lX7fVp+wvINxM3Rfo63b1K4bR5KR9JDZ2SLYhrx6Hyy+UiRv7l+i26WxVMF qRyvY2aHqyvKfR1EEf1t2h7B4b65xQkj51qvX5Tjm5Az7nKcXpcUKqS3bk8xiw9N y7eFfA361OSPpQ+V4Mq/Mv+MqyxLTz9tn+80ZtjqM0MEERfpUo15ABEBAAGJAjYE GAEKACAWIQTSzxHqSnZu94UybEuSJ9pJ7yc3aAUCXp3GCwIbDAAKCRCSJ9pJ7yc3 aE2NEACDBRnGYNi2sq0wltPSkD2CbQUon+4uiFB2UU/gs4mFlGOvzDHBHVEFzCqK 0x6KlKm4XBq3AF7iIoNMiU9FmBdWDnEp9eCXdQrr/ykgq3vKMuj6/QJNNZglIDoe 1J2NXeMOUFwCUvjcCttPv42Q8GDt8/bG7QOgmTmhuqvKIj/vL+c3HgNrRsQzhw5z mSzQIDaesD+UVA/sourXpSLeqPgF+6qsEqOirD6hotaqrt+aIA/8wbYkpNQxCEK4 gKDgpqTV7VKklku7fjyhBhZQOVDoWvd03AlGQD0WBNriUsh8l4N6Zg2BlnKTGn11 BTigqwlHC91xtjERgwFg8PAHN2mtgZUHITHX5js11KwlQdLyI04/M4M4oQq0KSbJ rpiWCgrltC/VqJrT4HELFYx2Iv5wzrV9jVEm6zonag4A761hpqTgRrjWtaLuYu2Z zdw9y1r0+0d2rTUGpjIQRVOwi3AF/G4aU+vAOOf/HcgH6Qnpbu+xV0fkuAZbTI7w 6VVkBvnstiQV88KrWAOXKVABSSxTz2OYbzOTt/bgxzAa7yr1xIBDKvujBqDRGBLi bISp+40Haoj2Yqop6vbS70Xq+cnBOwJW86u61hsLgOjqyxgLzvuGTjK7+TblCjR2 F4LNeQdwDdyNRjPYeGVXM3MEqR8XdcR1Z7BQvLNcDgoW2qDcbg== =4lZw -----END PGP PUBLIC KEY BLOCK----- Please see GPG keys on PGP.MIT.EDU; fingerprints: sec rsa3072/A18F778E19FC3248 2020-04-03 [SC] [expires: 2022-04-03] FFF31E86FCEB5046E8B27D4AA18F778E19FC3248 uid [ultimate] ADAM M DOBRIN \ ssb rsa3072/04F98002A3DA53B2 2020-04-03 [E] [expires: 2022-04-03] sec rsa4096/FB4ECE4A109229CF 2020-04-04 [SC] 4FAF0D3E208A1F4C980D0F66FB4ECE4A109229CF uid [ultimate] Adam Marshall Dobrin \ ssb rsa4096/DD1F0C118C788B04 2020-04-04 [E] (function(i,s,o,g,r,a,m){i['GoogleAnalyticsObject']=r;i[r]=i[r]||function(){ (i[r].q=i[r].q||[]).push(arguments)},i[r].l=1*new Date();a=s.createElement(o), m=s.getElementsByTagName(o)[0];a.async=1;a.src=g;m.parentNode.insertBefore(a,m) })(window,document,'script','//www.google-analytics.com/analytics.js','ga'); ga('create', 'UA-74743044-1', 'auto'); ga('send', 'pageview'); pub rsa3072 2020-04-06 [SC] [expires: 2022-04-06] F7E4 7CB1 2CA0 CD01 C5E1 CBFA 7EC8 D5A8 5A38 D63A uid [ unknown] ADAM MARSHALL DOBRIN Because of "some issues" with what appears to be distinct and unbridled privacy intrusion; please ensure that PGP is understood to be "nothing more than not so much pretty good" and this key also, almost required in order to verify authentic identity--in the case of ... question.
I am accepting charitable donations,.\ ETH: 0x66e2871ef39334962fb75ce34407f825d67ec434 | BTC: 38B6vGaqNvMyTtoFEZPmNvMS7icV6ZnPMm | xDAI: 0x66e2871ef39334962fb75ce34407f825d67ec434
Wednesday, June 23 2021. Nintendo Way
Erev ... the Day of the Holy Divorce of Bayjorel
Adam on "ho(s) I still single" ... I "hisss" as Alger, Narcissus and to the various collegiates in Massachusetts; know it's because I'm Cheyanne Mountain. You can't even dream how hard it is to get inside "this heart." Or maybe I can't fathom why nobody's rushing up to me trying to grab the ring of "infinite alimoney in the ever-after" ... Na Na Na Na ... Na Na Na Na ... shey shea way) ... tee tea, tay?
This messages marks a major increase in "forced read(layshion)ership" to include a significantly larger group of students and professors than before. This is a new system; please unsubscribe using the instructions at the bottom of the message, which are different from the prior newsletter interface. I have noticeably been writing much less and sort of working harder on bringing to fruition the software and social policy changes I've been dreaming of and writing about instead of "just talking."
Searching this message that I intend to send to the students a day early--you know, with foresight for ... in the hope that many of you remember first hand hearing the words "I don't believe in the big bang, but I respect those that do" echo from a computer screen to me subconsciously in the state of South Carolina--that you will help me end the 7 year draught [[literal, good sex]] that I equate to the Biblical overflow of the Nile and to Stone Temple Pilots; this light and Sheldon Harr who trained me for my Bawr Mitzvah and taught me all the right things that I know about being a good Jew who didn't really believe in the existence of God; but then helped create the system that makes us all that.
Those who "see" or "saw" Kentucky as I did might recall the phrase spoken from myself to myself; "you don't believe in God when you are this close to it's creation" ... or something almost verbatim; that. Some of you might see Gilgamesh more than I do, or have forgotten the "sliding of sleight of hand and becoming ... the trickster of the Dajjal ... "an idea that gore was being fabricated and faked; in order to help us see why it's so very importanat that at the same time that immortality and heaven become part of the conversation of the adbication of Odin's throne to Thor or to Arthor's table and plebescite "victims" ... that we all understand the magnanimous change wrought by Heaven on civilization and on the old customs and on the old laws, and that here we see the importance of guaranteeing safety and privacy and even "right to death" in a place where God had previously only written of "life and liberty" with the ambiguity of ... "from what" being left to my seemingly slow hand.
On the order of plans soon to be seen to fruition my large key of "what this website truly is" has grown to something like 20GB and now includes a static and time frozen version of everything linked to stored on the IPFS system and multi-homed across a number of "cloud providers" to ensure things like "shekinah" will not forever be changed to "shechina" with nobody noticing the loss of causal original truth. The "light of angels" domain now redirects automatically to /ipns/fromthemachina which should render in future shell-internet-browsers as something like QmTH33MwfPn5S3bq45Tk77L1j9eZjUsvEVhRTHB3D8M2ZX [please pin this "root block"] I am not sure why IPFS doesn't have better merkle tree searchability, but seeing siblings and parents and connections between these Qm hashesh is something that we should be working fervently on making more robust. IPSE.io appears to have created a decent search and governance system, I see it as something like the "electoral college" metacosmically linked to the thing I am trying to build--a preservation of all human knowledge and an infrastructure for discussing and communicating about the "veracity" and the linguistic nuances "alluded to" in the lude ties between this Empire's new Clot and the clothing worn by Popes and Jews, the seeit-seeit; tzit-tzit and ...
I am planning on suing several medical providers and states for what I see as heinous violations of human rights, decency and the Constitution of the United States; if you are a lawyer or you can recommend a good one, please email me as soon as possible at 0xc514f094370cFc5eE45a1Dd9B72bb9675efE266f@ethmail.cc. You can also send Ethereum fungible donations to that alphanumeric identity. As I note much later in this message ...
Please do note see a significant difference in importance in the emails now coming from ethmail.cc and the series of half-rambling cires for help which amount to something like my prayers to the pagan g<del>od</del>s that you are.
There's quite a long thread in my soul
Many times I've discussed and called in my mind and with my heart the American democracy nothing more than "Noah's Archaic" two party system. Over the course of the years hidden messages from the Ark's source of knowledge have conclusively shown me that a previous phrase "multi party system" connects to political parties and governmental action committees that span across continents and even earths; in my microcosm or special language and understanding of heaven, "across rooms" which are worlds ... sort of owned or designed with some sort of top down or democratic structure of "literal rule system creation." In my mind these rules can be inherited and modified, in the programming language sense of those words, as in "inherit democracy from America, update for new medical knowledge and scientific truth ... discussed later in this message.
The "water joke" connects to Horatio and to H2O and the idea that the chairs depicted by the character "h" are something like a placeholder meaningfully connected to the Senate Majority Chair and of course the Minority Chair and it's the fact that there are only two that makes our current system something like A"Biblical Water."
I believe we should be living in a world that has many more than two parties, hundreds or thousands of active parties could and should compete not for a single figurehead to sit in a throne like chair but for groups of people to be able to access the faster processing power and wider knowledge ... represented here by something like a "Matrix jack" from the two movies, The Matrix and No Jack City; which allow for resources to be "billed to the party" and/or the people, rather than individuals who might otherwise have to "pay extra light" for faster processing power in order to quickly build a piece of legislation or political propaganda that equally connects to the mirage and miracle and dream of building a "subconscious voting system" that allows for votes to be taken "isntantly" and not just instantly but at some kind of recorded interval over time. I envisioned in Kentucky a world where the laws of the land would change instantly, allowing for bad weather to be instantly removed, for laws to differ from neighborhood to neighborhood and even to allow the fine grained detail of "outside and inside" each and every individual home or castle.
Lost. Blind wandering through a lost world, in the beginning--that's the truth. Crossroads, somewhere between walking through an electromagnetic pulse in Lake Worth and struggling to remember "the other thing." Recalling [flew(ers)], so I was there sitting with my parents when we saw it on TV--a gigantic deal--the United States was going to war for the first time in my life. Saddam Hussein had invaded Kuwait (supposedly for the oil) and Operation Desert Storm was launched by George H.W. Bush; recalling the names and "Space Balls" it's almost funny to see ... how blind I was back then.
General Norman Schwartz cough. General Colin Powell. Anyway, the whole point of the story is we were sitting at the Flamingo Diner; and for my whole life I lived just a few roads away from that road; never ever realizing what it was. I also didn't realize for a very long time that you might also not see it, or you might see it instantly. Scanning just south of there, you can see it turns into Red road, and then its more than obvious that "flaming" stands out, light a highlighted cross--but we don't say the name of that bird that way, and we didn't see "infer" in Dante's "inferno" or ... "no" either. Flamenco ... en espanol ... like the dancers.
A golden bitcoin swirls in the sky... the "mind control people" of Bowling Green gape in some kind of crowd pleased awe as the "middle" and the end connect almost seamlessly ... Fort Myers creates a space port in the light of Vegas's monorail "plots"--
"Who?"

vaaa---tseeee----deeeeeeeeck? In this word I recited over and over again in preparation for my Bar Mtzvah on December 11, 1992; without ever knowing the meaning is the crux of what exsactly is going on right now. The word is vatzedek:
צֶ֫דֶק noun masculineIsaiah 1:21 rightness, righteousness; --- ׳צ Leviticus 19:36 87t.; צִדְקִי Isaiah 41:10 8t., etc.; ---
1 what is right, just, normal; rightness, justness, of weights and measures, אֵיפָה, אֶבֶן שְׁלֵמָה וָצֶדֶק Deuteronomy 25:15 a perfect and a just weight, ephah; ׳מאֹזְנֵי צ; ׳אַבְנֵי צ, ׳אֵיפַת צ, ׳הִין צ, ׳בַּת צ Leviticus 19:36 (H) Job 31:6; Ezekiel 45:10; ׳מַעְגְּלֵי צ right paths Psalm 23:3; ׳זִבְחֵי צ right peace-offerings Deuteronomy 33:19; Psalm 4:6; Psalm 51:21.
2 righteousness, in government:
... and you can believe that despite the strawnge pronounciation little boys and girls would use at the age of thirteen as they spoke in rigorously recited prayer-song ... it [swounds almost exactly like "What's a Dick?"]
FTA, from the article: Congresswoman Ilhan Omar, righteously fed up with the prejudiced nonsense she endures day in and day out, called a question about female genital mutilation from an audience member at a recent event "frustrating" and "appalling."
So I stand here living in Taylor Momsen's song "Nothing Left To Lose" my personal favorite of hers which touches on this subject of "freedom as just another word for it" and of course the link between the purpose of an ethical oversight of the popular vote that the Electoral College represents; another two special and related words here, righteousness and fate. Between Vatzedek and Kismet; I can only convey my great dismay at the actual emotional and true physical pain I feel in my groin of groins every time I think about the horror story that has become my life and the what the land of America and the Medgard of Yggrasil has become ... [note it's not Yggdrasil] as I rally against the closest of my family of families, the Americans and Jews who refuse to stand up and speak out on my behalf, and on the behalf of humanity in general against the sickness of ritual genetal mutilation.
Lost between Elvis and Suicide, she sings and I think about Ellis Island and Ellis Eaton and literally the innate and obvious lack of desire I have in my heawrt and imparted into my mind by some kind of ancient and unholy Jewish law ... no desire at all to leave this world which has quickly turned from a bastion of light and freedom into nothing short or less than Hell itself.
Kirinechoes from the land and day of NEMEC.html the chanting from the invsible choir of "e" ... "he's a victim"
over and over, "he's a victim, he's a victim;" and in a more private sort of way she held on to my victim's rod) and in a sort of kind friendly way implied that I should stop doing "speed" because ... I need this, and she ... in Holy ritual ... patted the phallice of Iapetus' great grandsun.
Here I stand for the very first time; writing to a large group of students in the area of Boston, Massachusetts begging for the Sabbath Day to "be remembered and kept holy" as the Hebrew prayers and rituals repeatedly fail to explain has something significant to do with entry into the Holy of Holies, with the continuation of life and of heaven ... and with the reinvigoration of something like a following of the Hippocrati Oath that is beyond a requirement to be reaffirmed here in this place as we begin to discuss the opening of "the process of the creation of legislation" as a function ofthe "citizenry governed" ... the creation of "direct democracy" utilizing a kind of fusion of the software products I've been explaining are here designed specifically for this purpose. Software like kipu.com, aragon.org, wikipedia.org and even reddit.com.
Sometimes I get my hopes up, sometimes i lose all the doubt and the "missing remorse" and the fear--the moments I can't STS "socks" out of the VEGA System; in those brief moments I think you're actually going to do something nice for me, that the heavens haven't crashed and I'm going to have some kind of sex party that actually ... really honest to God ... is what "Saturday is all about." So what, sue me--I wrote the book on the single Dionysian fusion of a Roman Bacchanalia and the Weeebrew Saturnalia ... and then I yell at "Bethesda" for even daring to mention the grape fruit juice and the movie Havok--but I've heard all about the "passing of the nite and the nocturnal rite"--truth is I probably would walk right into the branch ending trap I laid in Fort Myers--every time I think about it the "minute of bouncing and orgasm" makes me smile a little more inside and my stomach get's butterflies and just for a moment (I think I might be writing like STS) I think maybe it's not the end of time and maybe I won't never get to actually see ... Heaven.
Butt then you tell me (my but-tea joke isn't funny, eithah?) ... "Cassini" and "molasses" are supposed to make you feel like the OC resort guy staring at my tooth "about to be the one tooth) from 2011" and I go back to remembering it's been a decade since I've had a decent "good time with a girl" ... literally seven long years, aside from a brief "blushing" experience with little Mackenzie Reisinger.
Imagine that girls smiling at me and saying things like "Larkin Sow" and this brief period of "ecstatically frenzied decent writing" is all that it takes to keep me going; trudging along through the very shallow (or deeper) pits of Hell itself--just like a Dreidel c'd to make some silly words from the "introduction to the Bahir [literally wasn't here, and "spirit of ah-aha illumination; hi. and this conversation ensued"] like "yod-nun" actually be ... something like our salvation. Flying back in time to the "thang" point, I remember what it is now.
Fear it ... það; fear it.
Day One has begin, or ending--whatever the proper literary way to say the Bible and it's days are all wrong, and even further along the thing called the "Festival of Weeks" by the Jews, even more disgusting. I have no shame or remorse in saying such things, in fact I believe it is the purpose of this strange take on the "nocturnal rite" of the Norse ancient Druidic and "Dhruzi" mentioning of the Prose Edda to come to this very strange point, in this very strange place.
It might one day be a little known fact, but up until the presidency of Barrack Obama every single President of the United States of America was a member of the Protestant Church, all but John Fitzgerald Kennedy whose bright and shining face and ethos stand apart from almost all others in his place. I might one day say Trump too stood out above and shined brighter, and personally only because he lived during my lifetime, I think my personal view of Bill Clinton is the brightest of all. To me, the Clinton years were filled with the booming economy of Old Joe, and the great aspirations of Our Jack; a thing that many people before Armstrong walked on the moon and planet a great Democratic "P" one giant leap above the rock of ages ... there are just no words for lux of America's contribution to the launch of a Heavenly Civilization, in the words of Paxton in "Big Love" ... and the LDS Church and Deseret's version of "the thing" (nu3 today) ... "the celestial kingdom."
Valhalla and Matzot scream of the "ha-moat-sea" and the "vats-a-dick" but without our giving of thanks for righteousness we have become the murderers not only of Judas and Death but also Jesus and the thing that created him. Eventually the island of America disappears, eventually it's Earth, any planet a human was one ... these are the things that have either become a force of great goodness--or of total destruction. This is the embodyment of "Troy as hisT" this is Galactikiss has become Planet Prime and all Derivatives--the silver surfer speaks to you all, between "El Dorado" and the "Silverado" ... a comparative connection to the difference between Fort Knoxx and the Pound Sterling ... with a Troy Ounce of "tzadik" to ensure with our GSLW: "ness truly means 'now everythink safely saved;" ... and that's a GNU definition for NESS which previously may have mentioned everywhere or earth and those are both absolute falsehoods and perhaps were not when they were spoken. At least, relatively speaking.
Rape has come up today.
I've commented publicly on the conversation I had in my head last night, walking by "Boston College High" and I can't help but add my "very interesting" thoughts on the echelons of spirits inhabiting the Ka of God here in this place; and how they might somehow be satiated in a way that I or most people in this world would fine to be something more sexually immoral or deviant ... "previously of the wiccan pagan variety" ... something like my strange dreams here in this place of starting trends of having "a thing" for doing "moms and sisters," which have been echoed here by a sitting and very prominent G.O.P United States senator or congressman; the show "Vampire DIaries" as well as Natalie Portman, Taylor and Sloane Momsen, Kate Hudson, and a number of other female "duos" like the Spears and Simpson sisters (Ashlee and Jamie Lynn, see) the Olsen twins and of course the soon to be "in the light of the fame of Nashville" ... Larkin Poe.
(((( this here is what we call a "race through a rats cage )))) if neither of the four or give girls in question send me some kind of verbal "ACK" ratyher than a "NAK" in writing, I might travel to Ellis Island or Nashville, TN before staying in Boston or ... for instance going to Lowell or Nashua and ... perhaps causing more FUKUSHIMA on the NAKARSAKI of HEROSHEMA; and by that I mean this is a "big deal" ... LLNV might become a bus stop in Vegas or the VEGA System or it might be a national labratory near the Hamptons. It's hard to tell at this point whether or not there's any "liver" in Mexico's version of that funny one with the guy that reminds me of Aldous Snow in "Forgetting Sarah Marshall."
In my mind today I speak from the Earthene world of Janet Devlin's "Chandelliers" directly to Michael Jackson himself, on the difference or change or meaning wrought by Bill Cosby and his "Neverland Ranch" series on the question at hand--are there bowling tumble weeds and karaoke bars on par with Prescott Arizona's scene anywhere closer to Nashville than Bowling Green ... because I was beyond surprised to find a sprawling megalopolis in the place I had thought for my whole life was something more akin to Knoxville, a place where fledgling female music stars became "Grace Vanderwaal" golden buzzer winners ... faster than you can connect Jerusalem to Shirley Temple. On the specific name, Shirley here is Bianca Pisani's great grandmother; and no farther than the truth is the world's "UMBRELLALAUNCH" link between the Chinesely famous virgin (non-alcoholic) drink is something like Billy Joel's Piano Man Bartender walking into "the usual place" and saying something along the lines of "Geisha me up one Virgin Red head; hell, why don't you make it a double." Leave the umbrella with the kites that didn't glow fiiery stars into the Holy of Holies in the same vein and for the same reason that the Church of the Holy Sepulcher failed to actually change the world with it's ritual uniting the Olympic passing of the Torch with today's interlinear and interwoven message with Old Joe and Young Jack Kennedy, Jackie Onassis and even touching on the Saudi Royals which were also a big part of the story connecting General MacNamara to "Lauderdale by the Sea" and a special rememberance to the expensive and Holy bronze or copper brick which he bought (through donation to charity I imagine) making himself more than just something like the founder of the beachfront redesign of our Federal Floridian beacnhead, but also a founding member of something I call "The Columns and Pillars" society in reference to the Pine Crest School version of the same kind of ritual. Also connected here are pictures of those columns, and extracts from my senior yearbook where my mother was kind enough to leave me two whole half page dedications to my graduation from one of the most prestigious and omnifiscient preparatory schools in the entire world ... at the same time donating columns both in my name, their name, and the names of her deceased parents: Julie and Bernard Gerson.
Bell to sky; and to the Berlin Sky; this is the same genetic and congenial family line that links Gersholom Sholom, Albert Einstein, J. Robert Oppenheimer, Adolf Hitler and Yosef Stalin ... to Joe Biden and the "Joseph and Betty Portal" which replace the MacNamara era bricks with "new composite plastic" that might last much longer and has another list of donations. The "portal connection" something like an Einstein-Rozencrantz flash of brilliant light ... marks just one more error in my handling of my lack of understanding of things like "basic vectodirs" and "kasimamoriv radiation" ... including here (if i read this and take the time to properly attribute) a visual image of the red shift and blue spindle of the actual radiation Einstein predicted would be ejected from something so massive even "light" could not escape it. On "relativity" and relatively speaking, it's the wavelength and energy level of the light; as well as something called "gravitational lensing" ... "the special relativity theorem" which earned Munich born and taught Albert a Nobel Peace Prize (as well as much fame in the land of America for the creation and explanation of the science behind the White Sands Trinity connection to Hanukah and Sandia National Labratory) ... forces these corrections:
Operation Fishbowl was a series of high-altitude nuclear tests in 1962 that were carried out by the United States as a part of the larger Operation Dominic nuclear test program. Flight-test vehicles were designed and manufactured by Avco Corporation.[1]
The Operation Fishbowl nuclear tests were originally planned to be completed during the first half of 1962 with three tests named Bluegill, Starfish and Urraca.[2]
The first test attempt was delayed until June. Planning for Operation Fishbowl, as well as many other nuclear tests in the region, began rapidly in response to the sudden Soviet announcement on August 30, 1961 that they were ending a three-year moratorium on nuclear testing.[3] The rapid planning of very complex operations necessitated many changes as the project progressed.
All of the tests were to be launched on missiles from Johnston Island in the Pacific Ocean north of the equator. Johnston Island had already been established as a launch site for United States high-altitude nuclear tests, rather than the other locations in the Pacific Proving Grounds. In 1958, Lewis Strauss, then chairman of the United States Atomic Energy Commission, opposed doing any high-altitude tests at locations that had been used for earlier Pacific nuclear tests. His opposition was motivated by fears that the flash from the nighttime high-altitude detonations might blind civilians who were living on nearby islands. Johnston Island was a remote location, more distant from populated areas than other potential test locations.[4] In order to protect residents of the Hawaiian Islands from flash blindness or permanent retinal injury from the bright nuclear flash, the nuclear missiles of Operation Fishbowl were launched generally toward the southwest of Johnston Island so that the detonations would be farther from Hawaii.
Urraca was to be a test of about 1 megaton yield at very high altitude (above 1000 km.).[5] The proposed Urraca test was always controversial, especially after the damage caused to satellites by the Starfish Prime detonation, as described below. Urraca was finally canceled, and an extensive re-evaluation of the Operation Fishbowl plan was made during an 82-day operations pause after the Bluegill Prime disaster of July 25, 1962, as described below.
"Wish You Were Here" is a song by the English rock band Pink Floyd. It was released as the title track of their 1975 album Wish You Were Here "Wish You Were Here (Pink Floyd album)").[2]#cite_note-2)[3]#cite_note-mabbett-3) David Gilmour and Roger Waters collaborated to write the music, and Gilmour sang the lead vocal.
In 2011, the song was ranked No. 324 on _Rolling Stone'_s 500 Greatest Songs of All Time.[4]#cite_note-4)
In the original album version, the song segues from "Have a Cigar" as if a radio had been tuned away from one station, through several others (including a radio play and one playing the opening of the finale movement of Tchaikovsky's Fourth Symphony "Symphony No. 4 (Tchaikovsky)")), and finally to a new station where "Wish You Were Here" is beginning.[5]#cite_note-5) The radio was recorded from Gilmour's car radio. He performed the intro on a twelve-string guitar, processed to sound like it was playing through an AM radio, and then overdubbed a fuller-sounding acoustic guitar solo. This passage was mixed to sound as though a guitarist were listening to the radio and playing along. As the acoustic part becomes more complex, the 'radio broadcast' fades away and Gilmour's voice enters, while the rest of the band joins in.[6]#cite_note-songbook-6)
The intro riff is repeated several times before Gilmour plays further solos with scat singing accompaniment. A third verse follows, featuring an increasingly expressive vocal from Gilmour and audible backing vocals. At the end of the recorded song, the final solo crossfades with wind sound effects, and finally segues into the second section of the multi-part suite "Shine On You Crazy Diamond".
Lyrically, the song is often considered to be a direct tribute to Syd Barrett. However, on the documentary The Story of Wish You Were Here, Gilmour and Waters separately describe the original concept that differs from this interpretation. Waters, who mainly wrote the lyrics complementing Gilmour's initial riff idea and subsequent joint composition, describes the lyrics as being directed at himself, as his lyrics often are. Being present in one's own life and freeing one's self in order to truly experience life is a main topic in this song. Gilmour, on the other hand, recognizes that he does not ever perform the song without remembering Syd Barrett. Waters later adds that the song is nevertheless open to interpretation.[7]#cite_note-7)
Both David Gilmour and Roger Waters have praised the song as one of Pink Floyd's finest. Roger Waters has noted that the collaboration between himself and David Gilmour on the song was "really good. All bits of it are really, really good. I'm very happy about it."[8]#cite_note-8) David Gilmour has playfully called "Wish You Were Here" "a very simple country song" and stated that "because of its resonance and the emotional weight it carries, it is one of our best songs."[9]#cite_note-9)
"Wish You Were Here" was recorded at Abbey Road Studios, as part of the sessions for the entire album.
A noted part of the song was a planned contribution by Stéphane Grappelli. A jazz violinist popular at the time and well known for his collaborations with Yehudi Menuhin, both violinists were recording in a downstairs studio at Abbey Road at the time. Gilmour had suggested that there be a little "country fiddle" at the end of the song and invited them to participate. Grappelli duly obliged (Menuhin declined) on arranging a session fee of £300, equivalent to £2,500 in 2021.[10]#cite_note-inflation-UK-10) Ultimately during mixing it was decided to almost remove his contribution, although it can just be heard around 5:21. According to Waters it was decided that it would be insulting to credit Grappelli in the sleeve notes for something so inaudible, although he did receive the agreed-upon fee.[11]#cite_note-grappelli-11)[12]#cite_note-12)[13]#cite_note-13)
As part of the Why Pink Floyd...? campaign, the Experience and Immersion versions of the Wish You Were Here album include an alternative version of the song where Grappelli's part is heard in the instrumental break after the second verse and throughout the third verse before a considerably extended outro. Other less obvious differences are audible, for example at the section leading into the second verse.
The master tape of the original recording includes guitar solos that were not used in the final mix.[citation needed]
Golgo 13 (Japanese: ゴルゴ13, Hepburn: Gorugo Sātīn) is a Japanese manga series written and illustrated by Takao Saito, published in Shogakukan's Big Comic magazine since October 1968. The manga won the 1975 Shogakukan Manga Award for general manga and the Grand Prize at the 2002 Japan Cartoonists Association Awards. The series follows the title character, a professional assassin for hire.
Golgo 13 is the oldest manga still in publication, and its tankōbon edition has the second-highest number of volumes. It has sold 300 million copies in various formats, including compilation books, making it the second-best-selling manga series and the top selling Seinen manga series in history.[2] It has been adapted into two live-action feature films, an anime film, an original video animation, an anime television series and six video games.
A googol is the large number 10100. In decimal notation, it is written as the digit 1 followed by one hundred zeroes "0 (number)"): 10,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000.

For other uses, see Wormhole (disambiguation) "Wormhole (disambiguation)").
"Einstein-Rosen Bridge" redirects here. For the EP by electronic musician Venetian Snares, see Einstein-Rosen Bridge (EP) "Einstein-Rosen Bridge (EP)").
Phenomena
show
A wormhole (or Einstein--Rosen bridge or Einstein--Rosen wormhole) is a speculative structure linking disparate points in spacetime, and is based on a special solution of the Einstein field equations.
A wormhole can be visualized as a tunnel with two ends at separate points in spacetime (i.e., different locations, different points in time, or both).
Wormholes are consistent with the general theory of relativity by Einstein, but whether wormholes actually exist remains to be seen. Many scientists postulate that wormholes are merely projections of a fourth spatial dimension, analogous to how a two-dimensional (2D) being could experience only part of a three-dimensional (3D) object.[1]
A wormhole could connect extremely long distances such as a billion light years or more, short distances such as a few meters, different universes, or even different points in time.[2]\ Julius and Ethel Rosenberg --- Americans who were involved in coordinating and recruiting an espionage network that included Ethel's brother, David Greenglass, a machinist at Los Alamos National Lab. Julius and Ethel Rosenberg were tried for conspiracy to commit espionage. treason charges were not applicable, since the United States and the Soviet Union were allies at the time. The Rosenbergs denied all the charges but were convicted in a trial in which the prosecutor Roy Cohn later said he was in daily secret contact with the judge, Irving Kaufman. Despite an international movement demanding clemency, and appeals to President Dwight D. Eisenhower by leading European intellectuals and the Pope, both the Rosenbergs were executed in 1953, at the height of the Korean War. President Eisenhower wrote to his son, serving in Korea, that if he spared Ethel (presumably for the sake of her two young children), then the Soviets would recruit their spies from among women.[26][27][28] Greenglass later recanted his testimony against her, and release of grand jury testimony in 2008 showed the extent to which the prosecution had created a false case against Ethel.[citation needed]




https://www.americamagazine.org/politics-society/2020/05/08/its-time-rethink-electoral-college
https://www.americamagazine.org/politics-society/2020/05/08/its-time-rethink-electoral-college
https://constitutioncenter.org/blog/vote-now-an-amendment-to-end-the-electoral-college
https://www.nytimes.com/2020/02/09/opinion/letters/electoral-college.html
https://www.latimes.com/opinion/readersreact/la-ol-le-electoral-college-20180904-story.html
"Politicians talk about the Constitution as if it were as sacrosanct as the Ten Commandments [interjection: spec. it is actually almost exactly related!]. But the document itself invites change and revision. What if the president served only one six-year term instead two four-year terms? What if your state's population determined how many senators represent it? What if the Constitution included a right to health care? We asked legal scholars and Slate readers to cross out what they didn't like in the Constitution and pencil in their hearts' desires. Here's what the document would look like with their best ideas."
Please note that any decent browsers would probably render ipfs://fromthemachine.org as the following https://gateway.pinata.cloud/ipfs/QmTH33MwfPn5S3bq45Tk77L1j9eZjUsvEVhRTHB3D8M2ZX
I ask again that you all pin on IPFS mirror and copy the data included in these dumps, they are a key to "not losing causality" to not having a history that makes no logical sense, and to some kind of coup de roku, that really makes no sense unless you no, we will ve weill ... ROCK YOU
Long ago I began writing about hidden codes in our history; thing's significantly more obvious than "flying elephant armies" connecting Disney and Dumbo to Xerxes and the "Democratic Party of the United States (mascot)"--though it's not really easy to consolidate the "epiphany" of ... [((all i know))] without some kind of "artificial intelligence data condensation [infosmos.is?"] and summarization platform, though that's nearly the next thing on my Lowell list of things we need to "mechanical turk" into being. Meta-consolidation of the world's encyclopedias is one of the most important and useful tasks we have as we move towards the creation of a virtual debate platform that will eventual "literally obviate wisdom" of the layer/layer system that defines the name of the city I write these words near.
The broad overview of the system ... the gist ... is that political parties and activist organizations will create their own "view of the truth" (propaganda, falsehood-removed) and that these disparate pieces of "highlighted and annotated bibliography" could be overlay-ed on top of each other, creating a "new view of the truth" based on a users preference. The whole thing boils down to series of "holographic eschatological goggles" that will allow, for instance, the "grasping and fathoming" of other people's points of view and perhaps reframe your own on any number of individual subjects.
Roe v. Wade, "Concourses" and CON-CERN; because this has been such a "hot topic" in the relative psuedo-edufictional story of the space travel from the lone planet Earth ((intersected)) with the set of skipping stones it takes to exit a Totalital multi stellar system of holographic computer simulators into the ... "molecular world of vaccuum and Einstein time-space" ... I'll start with this simple example.
"People here" means something different than it did when I was born, at least in my mind's eye ... something so completely more advanced that it's almost difficult to believe you all don't see this place as a great prison or farce or unjust Azazel--blaming a man for looking like a rat or a mouse or a dog--in a place where more to the point we stare at a kind of physical violence and horror that would put Dennis the Menace and Bart Simpson to shame. A world hwere "people closer to holodecks" blame an innocent man for "writing the book" on the connection between Holocaust and Euthenasia and Hospice ... certainly you know "an innocent tool" writes these words to you?
I've written quite a bit on how "mind control" and "voting freedom" are inherently related in and to the thing we call "Civic Involvement" here in the United States--basically that participation in the verification of truth and the public understanding of tautology and temporal falsehood are ... sort of a slave like requirement neeeded to ensure that any freedom at all exists I often say "plugging your [head into google]" might turn the Aesir into an Acer, or the "yodelling of the lakes of democracy" ito "the agricolae becoming nothing more than the Dell."
Unless otherwise indicated, this work was written between the Christmas and Easter seasons of 2017 and 2020(A). The content of this page is released to the public under the GNU GPL v2.0 license; additionally any reproduction or derivation of the work must be attributed to the author, Adam Marshall Dobrin along with a link back to this website, fromthemachine dotty org.
That's a "." not "dotty" ... it's to stop SPAMmers. :/
This document is "living" and I don't just mean in the Jeffersonian sense. It's more alive in the "Mayflower's and June Doors ..." living Ethereum contract sense and literally just as close to the Depp/C[aster/Paglen (and honorably PK] 'D-hath Transundance**sense of the ... new meaning; as it is now published on Rinkeby, in "living contract" form. It is subject to change; without notice anywhere but here--and there--in the original spirit of the GPL 2.0. We are "one step closer to God" ... and do see that in that I mean ... it is a very real fusion of this document and the "spirit of my life" as well as the Spirit's of Kerouac's America and Vonnegut's Martian Mars and my Venutian Hotel ... and my fusion of Guy-A and GAIA; and the Spirit of the Earth .. and of course the God given and signed liberties in the Constitution of the United States of America. It is by and through my hand that this document and our X Commandments link to the Bill or Rights, and this story about an Exodus from slavery that literally begins here, in the post-apocalyptic American hartland. Written ... this day ... April 14, 2020 (hey, is this HADAD DAY?) ... in Margate FL, USA. For "official used-to-v TAX day" tomorrow, I'm going to add the "immultible incarnite pen" ... if added to the living "doc/app"--see is the DAO, the way--will initi8 the special secret "hidden level" .. we've all been looking for.
Nor do just mean this website or the totality of my written works; nor do I only mean ... this particular derivation of the GPL 2.0+ modifications I continually source ... must be "from this website." I also mean the thing that is built from ... bits and piece of blocks of sand-toys; from Ethereum and from Rust and from our hands and eyes working together ... from this place, this cornerstone of the message that is ... written from brick and mortar words and events and people that have come before this poit of the "sealed W" that is this specific page and this time. It's 3:28; just five minutes--or is it four, too layne.
This work is not to be redistributed according to the GPL unless all linked media on Youtube and related sites are intact--and historical references to the actual documented history of the art pieces (as I experience/d them) are also available for linking. Wikipedia references must be available for viewing, as well as the exact version of those pages at the time these pieces were written. All references to the Holy Bible must be "linked" (as they are or via ... impromptu in-transit re-linking) to the exact verses and versions of the Bible that I reference. These requirements, as well as the caveat and informational re-introduction to God's DAO above ... should be seen as material modifications to the original GPL2.0 that are retroactively applied to all works distributed under license via this site and all previous e-mails and sites. /s/ wso\ If you wanna talk to me get me on facebook, with PGP via FlowCrypt or adam at from the machine dotty org
-----BEGIN PGP PUBLIC KEY BLOCK-----
mQGNBF6RVvABDAC823JcYvgpEpy45z2EPgwJ9ZCL+pSFVnlgPKQAGD52q+kuckNZ mU3gbj1FIx/mwJJtaWZW6jaLDHLAZNJps93qpwdMCx0llhQogc8YN3j9RND7cTP5 eV8dS6z/9ta6TFOfwSZpsOZjCU7KFDStKcoulmvIGrr9wzaUr7fmDyE7cFp1KCZ0 i90oLYHqOIszRedvwCO/kBxawxzZuJ67DypcayiWyxqRHRmMZH1LejTaqTuEu0bp j54maTj09vnMxA0RfS+CtU5uMq+5fTkbiTOe1LrLD72m+PVJIS146FwESrMJEfJy oNqWEJlUQ0TecPZR41vnkSkpocE1/0YqUhWDGSht+67DdeKUg5KwvYdL21d/bSyO SM4jnyKn9aDVzLBpYrlE/lbFxujHPRGlRG5WtiPQuZYDRqP0GYFSXRpeUCI46f49 iPFo4eHo2jUfNDa9r9BjQdAe4zVFn2qLnOy8RWijlolbhGMHGO3w/uC/zad3jjo4 owAfsJjH5Oa1mTcAEQEAAbQmRUFSVEhFTkUgPGVhcnRoZW5lQGZyb210aGVtYWNo aW5lLm9yZz6JAdQEEwEKAD4WIQTUJHbrYn3y2DzwTcnQP1ViZf5/FQUCXpFW8AIb AwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAKCRDQP1ViZf5/FWM6C/9J gbRLS2AWGjdRjYetlRkSkCoTYnXWknbtipYYHlhV0YJFwFMm0ydZIhFX5VDoZyBV 0UBeF1KJmcMoIfrHyhq2QhCnjE14hE1ONbaYTGtpvj851ItbFWXMJIVNyMqr+JT9 CWIxGr1idn+iHWE3nryiHrdlA3O/Gcd4EyNmaSe/JvB7+Z1AVqWkRhpjxxoPSlPm HEdqGOyl3+5ibQgUvXLRWWQXAj80CbVwwj1X4r9hfuCySxLT8Mir7NUXZFd+OiMS U8gNYjcyRGmI92z5lgf7djBbb9dMLwV0KLzgoT/xaupRvvYOIAT+n2mhCctCiH7x y7jYlJHd+0++rgUST2sT+9kbuQ0GxpJ7MZcKbS1n60La+IEEIpFled8eqwwDfcui uezO7RIzQ9wHSn688CDri9jmYhjp5s0HKuN61etJ1glu9jWgG76EZ3qW8zu4l4CH 9iFPHeGG7fa/5d07KvcZuS2fVACoMipTxTIouN7vL0daYwP3VFg63FNTwCU3HEq5 AY0EXpFW8AEMANh7M/ROrQxb3MCT1/PYco1tyscNo2eHHTtgrnHrpKEPCfRryx3r PllaRYP0ri5eFzt25ObHAjcnZgilnwxngm6S9QvUIaLLQh67RP1h8I4qyFzueYPs oY8xo1zwXz7klXVlZW0MYi/g5gpb+rpYUfZEJGJTBM/wMNqwwlct+BSZca4+TEHW g6oN0eXTthtGB0Qls71sv3tbOnOh/67NTwyhcHPWX/P9ilcjGsEiT8hqrpyhjAUm mv7ADi+2eRBV8Xf8JnPznFf0A1FdILVeVHlmsgCSB0FW0NsFI5niZbaYBHDbFsks QdaFaYd54DHln69tnwc2y3POFwx8kwZnMPPlVAR2QdxGQD4Wql7hlWT58xCxQApf M98kbAHjUlVYLT0WUHMDQtj4jdzAVVDiMGMUrbnQ7UwI7LexSB6cJ7H+i7FtS/pR WOhJK6awoOO9dLnEjm6UYCKsBdtJr98F0T7Sb7PnKOGA77y2QN14+u9N9C1lB/Z1 aQRQ2Nc51yXOQQARAQABiQG8BBgBCgAmFiEE1CR262J98tg88E3J0D9VYmX+fxUF Al6RVvACGwwFCQPCZwAACgkQ0D9VYmX+fxU+KQwAtFnWjGIjvqaNXtQjEhbGDH/I Q5ULq/l/wm9SmhG9NYRu3+P6YctCJaZnNeaL+6WFk1jo4LMiJEUT9uGlCbHqJNaI 6Gll1w6QOVLSL8s5V1L477+psluv4WBpi3XkWYlhDOFENCcWd49RQsA2YCX4pW7Q 7GcoSEJoav38MxHmJHYPfjSEvUZXDQIt8PFHSEScvyDWfYtMdRzjmSOOPdzhDDEy 5JBOBcEdSTyDiyDU/sBoAY0e8lvwHYW3p+guZSGSYVhGQ8JECzJOzwc/msMW/tJS 2MLWmWVh5/1P8BVUtLC2AQy6nij6o+h6vEiNzpdYrc+rzT3X5cACvJ0RtCZcrnhl O9PLiona2LEbry6QX5NL41/SAJNno3i72xPnQEe25gn3nbyT+jCoJzw2L0y8pmNB D+PKrk7/1ROFFVN8dJeGwxLGdBcz1zk2xeumzy7OaV8psUyYsJNcjyHUKgclblBW rMR2DgqEYn8QdK54ziKCnmQQZeMPiC6wlUWgg5IqmQGNBF6RVyMBDADALD7NkJ5H dtoOpoZmAbPSlVGXHDbJZuq7J13vew6dtXDIAraeGrsBqkF8bhddwVLzWylMrYCG Bf2L1+5BDgvqu6G+6dcVSbBsnZAS0zfJ0H8EmTvUMxMF7qOZYyrxfLz+pQRq8Osz Icab6ZI/KB6qZyQRvEFPB6pJjt+VvuwgJZTObIwbBbgQri2i02VBkjchsVhiSX9l +eiK7O8ROHKb3P181oScIsHywBOZ9DxRAYbFk5dnBqxO3WKb02H0zqE6440cjXwq TrZZg6ayN/IlPajO8iJPYZ1aIBykxYq1WHo+nhFMYz/VVk2WJorFeOgWaLGXb73c ty96f3qXTdvMDAIWHx8YCD5LbuqasO6LNQm4oQxkCoB3K9WFf/2SvSYb7yMYykb8 clTPt+KO0dsxjWhrJnfnIhC+2Chqv2QvRbFz0S9CpUnGGDweJ1uRNV0y70tO0q7t xXSTDRU3ib6vAHA0K/2MFzwUcog4o5bj7E9uCNJH/DJLZKsMIe4xsvkAEQEAAbQk SEVBVkVOVUVTIDxBVkVOVUBGUk9NVEhFTUFDSElORS5PUkc+iQHUBBMBCgA+FiEE IRklfU/C1qukq3xMXcNH0t3P9ZsFAl6RVyMCGwMFCQPCZwAFCwkIBwIGFQoJCAsC BBYCAwECHgECF4AACgkQXcNH0t3P9Zs+kgv/XEuuWc89Bjg1QQqKZueKNUHjyjnE 2adfoZUH6Q7ir4JZyRBCVpAwrgssmiKid30+SIjwQcpb9JYa/X1XJcDUcJW/I21d Agz/zbEqn/Cou0dUpNCtxgm4BdSHWGoOtgfspXZlXBQ407tRMZ8ykmLB1Bt0oHvw PT0ZOtqXM4pyFnd2eFe5YGbNgl3zqvoC/6CMN3vqswvRlu1BpUuAjdW8AHO5Yvje +Bp852u+4Qpy6PMBiWGsBMYwtf6T7sckpMGlR0TsozwBlAm5ePKK28B0rLJPkZLJ Eo5p4rKRapEaZsWV5Qu1ajrVru7qmpUhZtX0/DddGHfXVuLssmKLP6TumpQB1zvQ vfoBltjvOx35Wps2vHuCzXLw2bROIOzhAxFB+17zxnSbE54N4LIGRpkELuwxwGbg FtD1fi9KtH7xcn33eOK1+UD47V+hKyJGrQgSThly2zdIC2bvfHtFdfp8lOFpT0AU xjEeoJGqdQVupptXyugPlM5/96UJP8OZG0ADuQGNBF6RVyMBDAC3As6eMkoEo3z9 TkCWlvS0vBQmY3gF0VEjlAIqFWpDIdK3zVzMnKUokIT1i7nkadLzHZT2grB4VXuJ FvpbYw5NPR4cDe9grlOMLEaF3oSJ1jZ4V1/rj9v1Hddo8ELi/NToVrt1SB5GCVXB DkYpNLtTiCqHSU07YqwaqH8a+qbDmPxSQdIybkZiTiCEB+6PfQQlBpENEDlov6jm zZF+IcfM6s3kZDX5KFULweH30gMjq8Se8bPtUzW013+tuuwEVr1/YRLrIh+9O6Z+ pdA7gLMRYnD9ZLDytEvpb1lBBSY++5bIJ7xps80//DNqPYqwFmZQgTg0V9XbHE2e wLcOF8a2lYluckU7D///sWQhW+VxuM7R2gEBvYBhOgjWhIF2Aw6NbymW1Ontvyhu eOZCXXxV5W44PxXT8uDdhl9CNcHoBKKJyED8tKjigtn4axpsQeUrnOSbqEXSyqES WnE2wYUDzALcwFkzsvtLyd4xaz55KkPQkAkk0BZd1ezgXxb/obMAEQEAAYkBvAQY AQoAJhYhBCEZJX1PwtarpKt8TF3DR9Ldz/WbBQJekVcjAhsMBQkDwmcAAAoJEF3D R9Ldz/WbAFwL/382HsrldVXnkPmJ1E2YEOFz4rcHRetJ+M5H65K/2p32ONQ5KCbE s8MRY6g2CkE70en2HlpDwr/MdATwxBzIjEpjgHbfqCqVVATY+kSpXsttaKKAUVHi bFgV4QkdDJNSpcHEj+bqaggRnuWiV9T6ECG7kQjHiEXPNojzsiaXMDiM5r+acZm6 82id9qOFySQ2cZEy5HbwXM+ITLQGngnppa7du2KdgiqDeqtODOTWZvLYAq2tmEwD 3TT6ttLUBwOOu2IWpDkXswlrk62ESorE5mpLxop9fsxD39E2H06JoC/YfUPIVkEv fj06e7LEdcx0I7kRfD1v6qOUUsMsLZnmyGIk24iFjLkwu1VToWfwXDN1D2+SeAat 9ydNt4M7oEbd1QaOXXjmqpdU+VUiWcBXg+p3/WdV60MkyAgc3x+YanLljy/Rh18h cZwVlinf/tgvAQLi5f9hpwrwUMoGKijEYHKuEvi3C12Si7UVDfuIR7yS0dKcfuKF MbgwdvNXqpD9W5kBjQRekVd4AQwApHVgw2PVlBDpVcyoymUOXFQIJzJ9wRtr6/sG zwv8rrQnUEtOkkna7TDU3/UTj9FUH0gbpAKGNNPaPj5q0dlLIvzxb15r1uvDGaGL MA+8GFaGFnkxzhg0aXrcKZAN0/Zhgi2B7P8oXQuug5mi1JVDkZN5SeCZNOubdQWL 3xz3jEHp3ixj1mdOdvfdWQFR4CVMXt/A6VI2ujLVb3Yalft/c5bbclAgcJQhgDUu NqGYJEJonESNRSd8fEvhNb6cx7+Djd9+Wyctr76mwOr3nRb1N1OGhFxWjIroUpfz b+6y3oQjT58cJA1ZHqmJ6UlZd81hNNd9KWpbDVwONEPpiqPzfSaonxuqQa0/Cy4W 403OhfoLM/1ZDqD4YrJ/rpyNEfSSdqptWiY0KeErLOYng7rStW/4ZeZVj6b2xxB2 Oas/Z1QYfJyFUki9vaJ5IyN6Y7nVdSP6mbAQC9ESh+VPvRUMpYi4pMGK4rweBVHu oMRRwzk7W5zVIgd425WUe3eCQFn3ABEBAAG0K0VTQ0FQRSBST09NIDxFU0NBUEFF REVTQEZST01USEVNQUNISU5FLk9SRz6JAdQEEwEKAD4WIQTvnDJqcmqzlF87/t82 pJ91j4NOaAUCXpFXeAIbAwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAK CRA2pJ91j4NOaJVjC/4oo5yCHe7M2h1DiTXVcLI5rXQ1feY7B1feg+YJX/mI4+EV xjC/y5VVpV4syJk5GGZNXhKPHiGLaBYvglTlYOJ98RSEsHrwT3go6S8ZVvMNdP5v CEncn2vm5JGnp4k26PuOzMcJioQLOoUjWtcPFis3gG+ueH3NcPZ22oZUql2xuerh TQZegGp+jJ7bdxwYElx5jDDDkh196d5nlO2ZKENl0ZDp4GAzRNjnQ7KBV6R74J3U cLQDWY8vAFaRBZXIC5XtSzj9lr+jWgvxz7Il51+26VDTEtSafZ2uZfCOFk7GrzJg YFJD3zLnwUFXDWKRkep8TSwXnHmz/Ts/Mjyv6em25w7QTdnx1hNPxYNWMxPWNEAH pf70nNyOmcWcq27W+nAjVg8W3st/7J5CIebJQc5AUgm+fGOBW6XUQaNy2YF1YJlA 71/tls+R5IQZCYzbPOibgFS1HWKTwy0iI2rMDfxBtCXciv754jVI7L6R3J0j5Dy1 WZQVjaGgimznLN6XwYy5AY0EXpFXeAEMALvElrTV5hJG9DKu8cOqQEEVejtWJtki fZyvmiAKi2bZWiNfl1MxJt+o3Oc0eARJfnaPjrUY7hsbbSBAB4lFnDRtviARPaKM st5FkFgOh7Xx5ODc8bjqhMT9tbX37rkeDc12WAs3UxtEKWjyT7Xg/APKeK5FzpIs qew3LADdqFP9nOR0e5G8gxLTYh3ll3dLtp9DkJgA9q+0g31nNh5fZ29mcDzo/Mat Uk4PIxWC29LV9ALCJMIMesjOPiDa2KOy5QQH+/vn592ydBohOaY+B6jhEAdX8Dbp VHVFRBsiCOWGmdi6vHjMFD0tQdS6bXf+ZAG0E5HZETCxA2qfMf/vTeIJXYS5IZw0 anRkTXcTBrVE8uBpqtkNOrLJsaASkcoO5qF01J9zW8SR4jDgET7J02Fxf8CVPzb+ ZoNc9S0ZEO6Ubdh2vAkPtOV5sFkwIduN6ouAhEfJzC9XbJLpgsBKrRMAjr2FeEZP ruy8BkZbiyZ/b0S9qIgY4pqcyUJ79w7FLQARAQABiQG8BBgBCgAmFiEE75wyanJq s5RfO/7fNqSfdY+DTmgFAl6RV3gCGwwFCQPCZwAACgkQNqSfdY+DTmhD9wv/Zgav EHMuqF3765Fa4NapYh2kMS3skHn+ZzUEPLTlvrt7KHxomOzExNLSscZThMpur+yW MfNWbsw9GphiYAkMULrfJt/iWRVJ1FLgbcWgRGAwakOGwE29lMx3+rPIUQWU54Dw vE92Iz51ZGz1wgKcISuCw39g/HQ9uc3h3TfHLgfkc/GaIEa8jEOAcD67dVMoU4o+ p3nMri8z6sK176hQ/FM/8kekpeVfxmR8s6uoaJsXLRQk+i88ZwBR/5U+fBT9AtVw PL/MmZH7eCmZrn5hjaOw7tpkL8ZyAydNhOsSCqwNVtrIjgd+Gq1oSgw9EZfhKSUa +dBJAErA7MWjammQizEHDNnI8VNLngwCahGwaSgDhNaQtgNxvnkWO7XNYoCYXScP X++UmpWtSKMnD6ue36Ba1jqon0WY5cen3P+H1gL4ij5ynB9DrE8R1aSY6f+VZ48B RvjHm5LKTcAhiv2N/TyAg/fr2v9ZnEcP3CFxqAyB9JSKwoBkFvxJaRHTT3DxmQGN BF6RWE4BDACpgKWvQvPRDN03+sLYMXpJUPC7VhTjg5K/1+1vS/e/W65dYzn3JYxb ip2PcI5xajFnxzUrwwmhW+qz5REDyCtAObOpKsjtr4qu7mgOWnPa3k2Lm0bpCjDr BSFOiQsBVezTG/gJm+qELeqQMS9PHDSvZXeBROK7OkRE0nZ6yAj+QKEoVqeADpDm BHmhAA2OKBzq4rDWDh1jRQ7gLjlv/BFbhU1WuEfH/qzX8AUSsd0/hoPG0cPgC8gQ 3m6wr4eYqI853XQujWwisnlAE2bf9jsRjW+aLrJJTcADWk5Op5aQhI2lURYkryfC DFVcme7Hsrd+RFPK88J08YjBjOoYFwRU4AhHgucX9tW0S0v9hi3pKrF9O/JAIf+r h6BpnWo7tT5+8mVhtFvfEp9Y4xeUAKKZHBKhzHeOO8QQgHrIYa6HCcU03eyxy4Tq AsJdAJvxYFCRPdY9d0Z6uVsPhRy+3UmTxjl590T5/XjKPriAjBqXnKr4KexsM1gj 1L96bYDEgr0AEQEAAbQaRTFYNl8xIDxFMVg2QEVSTUNDT1JQLkNPTT6JAdQEEwEK AD4WIQSGisfXZ2Vg0m16Mzds3dDsq5BTxAUCXpFYTgIbAwUJA8JnAAULCQgHAgYV CgkICwIEFgIDAQIeAQIXgAAKCRBs3dDsq5BTxKq8C/48HSgecuI6MYtq84yqaQ1r x6cteRyn9BJDFTAUxn3X25kf0vVyCKQNAy2oybD5QHFLqhFCXJH+cnJ3xdviRUeW eO9fhkTmd12mHGrRDD02AHXZmaMp6ni7FuYpBGrw5dbXKTkSWfD/qb3odMx0jQby 6X+2eFhUpyh+yPB7P7HwiPwzdr0dBg3xE0vE0Vz+naMyt4YBHzrBbZo+y47Q86Ym TmBKxG5tlVsGDB4dDWSIvpBgnMFN1j46Uk2ihu4huohLkvSou+jYU+5Ppu8Fu1+7 i3RCILzeBtucR9+T4px1WVXx2sKOk0FfddCvI/fT/mhsgqQZwjj9b8HNfobhNxkL HBNFQ7FLJxKayPwMyJYDURUq7gz9p5JwHTmFg9n7zyK8qU2xR5t2247YinfEJQYL zQM6VKQCoDqydFfAPeGlx1KjroMGls4sP3XVlrR04YzaJ0vxRgog1gIO1aHMQ2Sj l8bG0GcerQ44rpn1v33Gw6KL/0SY9JsSSSjA9lgINWi5AY0EXpFYTgEMALy/jHsN kUQQVJK9QuAy5V2GePBTEm9NnjNCk+edGjSgqC1LemmP7EYh07J13d10VqD2Wtae bXlBeaMOcnoXQdfdK6nTKWRrH97JuRTrA3efLkl/R4EA/kHHV+YDgT+LBboUFYVU QF5YhfcvgBUcLXI3lX5wMEQbLb87cVjR0JtqVBFMIIvs4ibgr0U2SONiD9LcXZxf qYcX7CMM6RmuLzHTCEHyjp+KAw52K1i3+3M0OVZpa25rKE+S7LykQ1GrUUY3uVHg R2I3T5/Sns3Azc9wKuy/F71oiXyqCc3FwzTQHoki+eBf5dzs6h3GBTK3Dz6kl2mv 1TXpY1dk2EmuqKIeSr8CE52nkK8ZKY6cvX+v/p1EBAkJZKiasj+ukL72p3Lji5r/ iOarNJnURT5LJdYYL27dtQFSYyVWayeWi5358Ajh1H9OdpiGXcgG65ry6u50G8JR FCywwsdKpGjMG4FlkLkm50/piU+cgVeLET/C7C/OXNslL/pHV3x8kPRY1QARAQAB iQG8BBgBCgAmFiEEhorH12dlYNJtejM3bN3Q7KuQU8QFAl6RWE4CGwwFCQPCZwAA CgkQbN3Q7KuQU8SHSwv/agnEnhmo2yuKCLiKdTa5KZ8wh3umiX3S6rldW0NO2h8a cq2l7xHY1r2u4ieeMx27jtTqCp7ksFxPYwP9WxtVBy0teG8pKLhEffjyG2WKDzAN 7oXNZ7Ur6OQGfuOQzlMqOGtYQrbHAuX60PCldurX/6/0sKS6vESdeGMQPoZIDK5g HP298MMhlWYEG7uU31J1Cx9ZqiTosSckfrDq3weU8x9DZYaLZ+Y2akF5XpL/HjyA 6PM+lv6vnTA+b5DYCOJb6N7v131Net2JN7JVVGoc0FjsxN/W33H7eIDOZwqcCvzD i8EjjzZpZUDeYjlSXAqWvpeAASncMzXS2/S2V2u5X2iR7tDtRj9SuQehJkdTFNZH xh5nTdhPzgh/iOcm33VsQ17JWbovl0hbhYBPO4V+yIrN+oQGPhH+KCNNa39EjEzB iBIgirxQSaykwb4f2Kshh+d7rKHKb/mn6JBHU444mBf09m5wM/mhLSpuhMTcP2h9 jfFximAE9FBhdZhQsF29mQINBF6I/R4BEADotSG8PhhxxD9/96bgdWa1bzp2398W LaxP39T+Kzx2KL2xB+7B4EeTTzZ06kD+myCC9Ez+PqecfisJPfaiLD/+0/m3HLSS hxEaEqt1RBS3j6qJx8Lr51cAwGou4hGTo9H3me6FHO2ExZXd76A6kkUh0J4y3r6q aAoDP+MUczKzEjn6C6T7Uu0pdgYY1bDhuqlK0taqkqviGBYTAqmCrtcQhj+J/jbd OIZtpT3+PH6mWqguoONiE+glWcdThyuIvV3ix/GrhjmUZb/DQcvvbYGfDvGRBH4B Uj3f9WBM6HWSxKrCwWC3OcgZhtBcZjKrMPbNDNt7yAArv7nGpHmlpfF14Q6mVmVT 6Ulh+0xRx+6zFbqlDYYTneurK3RtqOBsMFG5rNDZYh/QOsHnSsxmU4LGdlEfQjYs 901zmzP7CQXjjJbtRXWIqPcn3OHIIasvjTACe5M+Lfk3u3rEiDYM64vg29sSyp9q 8hAzLTPcLj/Cc22jUEC/bbv5HfLyCZTCsu5ym1gDQZ6bDrJlFlXZJ2+vTCBsY24H RF9/J/z1JWYD1cAHpG0GRtYE9exKpu8/81jxIVn21qvvxSCPXw6IQIsEw51uk5TJ xAUIRCPN7S0UEtd22LSbM/IYx1cesCRUCmY7jDTro/jo2B4hLG64KBgqyjg0lwxd dy5S8LwFx1zskQARAQABtGhBZGFtIE1hcnNoYWxsIERvYnJpbiAod3d3LmxhbWMu bGEgLyB3d3cuZnJvbXRoZW1hY2hpbmUub3JnIC8gZW4ucmVhbGx5aGltLmNvbSkg PGFkYW1AZnJvbXRoZW1hY2hpbmUub3JnPokCTgQTAQoAOBYhBE+vDT4gih9MmA0P ZvtOzkoQkinPBQJeiP0eAhsDBQsJCAcCBhUKCQgLAgQWAgMBAh4BAheAAAoJEPtO zkoQkinPJ4gP/3U691086OKbWiQhMhV+AViuKnMgV4i1M8s+4Ep01h/dTE6R+rUu LcnY4T0HR5qxAYMiNpGo1vtvkMvV5DP1PFSl5EddKn8+Kvn/0+WjbLV5tdiFF1Ef xR6261UFoXAGk3HJMLQifr3lWKoimaBwJZGza2ok9k1TQVTn8g5a01bzK7hD5DJI zt9RJZaUkxGE97eUyJ8Dtwumo18EWJltuC4UWjWT2t2HE9mMsOfjpYZXFsGxJ0Zb xexo0DYsriPDpuxDnZT7G3re9Vwz2VIe388DNBW5HoJsYxhr2I0QOq64ZWOSEZC8 lDH+xM6YdY0iz4A+7nbKNGifLbH8oU4A1sV9HrIE2KNy76x0GNjgQUvcq1inD4Oh yorsRh/IF6wnqvFrHOstCS2dzpKuQ/s7bM5TGOD2EGb0xu7r0AfHqqLUlbr3rxkS wBFMQphyNr3mEkEbXU1dGsXDlRQy11LigMBoEHmP0t49bYWuM1mIBnIC7gZc/sV/ E5fWmWdQyCKmHeujmS+sgp2EX0NtMGSzm7z9WBzTBFjaN7q28gueQ3INDsDTGx2G aA1LbP2uh1ipwju0GxecUif3T2NDqaYfhbaCYsPJORNUlJUtCVBGeba9wcXai2dh l+HsSKUiyCgKiy6Rt6jumKtYHt+Q0zcKWLfVp8PA20zX+2Q9zKnlLzwquQINBF6I /R4BEADQ4kmCHYtAhjCShc724Ei2pqSH4SfnXd4r8S8I0+io6Mh0kWn+kbKk/aGK BL3KJyN6624kPtOFWuQ4iQ0lWFn9UMnvjByTPbjZ2je+VtCP7lKSNvEgTLQRxLEJ hoNVrNjrLa/Cn7sLt9ayYcx8eKpHkbmrVRTyGqljBkI5hwQ8S+7BWugabhGQuogw bFthykA+wxYvSbSn5mwKO1BlbDCRnxjLISlqWwmKKEtXQ8b3tu7GgFuPYLKaLEk1 BIwwUSdozjXu+198WligepslidlN5bXrvje3sxgt4oAPFMeH+NnDClSDuGhSYamW Db3ZPl95pW70ngUVgFPG4kQOlaqzo3YBeDBHDXlqU0+O8cwSQFk4CBJI3yt6/KmD BIuKLwauOxYullx9EnqKcLWEzOlTgn9Q7BARK8Uz7PQU3+1mDNId2MEg+gfL3rd2 +aMLNhTUkgVE5mWkeDz6Kg7YhwruvJtn0z1QqUhkQcVs7N8rVCck0YUCVGXpsUlu emK48q4ryOxmMG/+Ws2Xkmdm6Axq414WHz6nLwMWgFpcO+1wRwQuZEkeWeSAjEvS CGHImxTP7E08+y3vAl43a9AlR7v9PbtCy2FenAhGPigmWm2aPj1ejYfQLXozyWSM m8uO3aiKvQXdV1Ha2xQLK5expaRaAXQ6YLsNBD77UPxi9qC5rwARAQABiQI2BBgB CgAgFiEET68NPiCKH0yYDQ9m+07OShCSKc8FAl6I/R4CGwwACgkQ+07OShCSKc9o DQ/+OV2OuDp9g/27SRssbTWE+nBl0R9klrb/w2XEIVhg5LROUe/P3anyBLNITbF9 A4q8b9udD+iIc1ClY2bu3rQOdzA1DH9GK84bQ1O/LaU0Te8RBGJJEzjYMUraCgIX 4BmxsIlWuCkSNsTgempLOK88646Nv5uc/oxAj6kQH7x8XBXxaJ+N9WS9f7EAv4AL bSWeJ4ijbw9BIMHt/D9Em7Q8bW6VGZIEjIp+gl1vNZ6QGCTtRHQez1jYmFLpuE/G yh1zM5gCnZbcmC7ExDLFI6SuYUbKC+XaLA3+LLCVCPFLtu6wLvcgYFwWWMKIhJAQ bRyPePiuMqWeWR6VXTD8pLziDjxK0ZtvpGdOtZeCCHOEmxrCsfKdIyD2Gn7TmTwb M9fRE1HazROfit6SRCAamabg+dJIEGT8vzlLfnkZRi+6hxq88uDbrOkk36ShWoYB AApz+5fj1ogLptiaTUTyyjTjB+/FIbU48/02fkD0y960zQLyKL64Q4aZrNa2NNup YKy5F80NkU4rHOZ1HTaPLoqqVsGhWc3ODgLyGPiRDLlZu81aNpA/UnTEBX464Sk4 Jx9qztb+S50LnGItA92QfE9ru7FAE00RR6mpCv1h7uE28/Wr4XaYgJcw1hAPRr7p TtN4lph+sJsCQ8eX5YUlM/Pht1h/LoE8h4hXNfAGh+CZgoWZAY0EXodqtAEMAOBb WTLRDxNk9SbC7exKdw0f8Wy9DhX2Qqoi96piS99CMJSxeocLiC9Si2u5nL3sQTAu qs1YbtSgn8kkiH3HPEJIhV1p/Hvz47j4kXq7PnjqF7KAdCYewuDqRiq8J7TNokYs 6+3/KqwHT/IT8NwPLdMkXcv/SXqhuKpqa2ApIrhu04VFp4H5OXN9rqdF5ZDfcNx1 PQv+6m8v6xRwrI3kduRCUD3YiVPM3EOhqINk9XMuxAoVX3qwpz+OuEDBm76U5jTZ q9ErdwRV9gaGm5ztq6tvElpis3spM7BPHzbv0SvVRAAbgGVh6kfiaZ3YckxLq8ln Cg5or1aZNyGMf7CmaZaeAjeY6Y8FZXR1P+n/IFd9Ak83a3qizZyckfiEPO7hu9zI FFXTdtZIcV102rNoVzruZIn0vSK1DJ7bNNrHkm1PPcweMkcFJY0uh6l3x2nl2qKm AhlDs3wFG+nqvqmnliVbrFZCYlReMrWWI2YBwLC5uBcBpFAhMPNEjxOtv31R+wAR AQABtCNBREFNIE0gRE9CUklOIDxhZGFtNUBwcm90b25tYWlsLmNoPokB1AQTAQoA PhYhBP/zHob861BG6LJ9SqGPd44Z/DJIBQJeh2q0AhsDBQkDwmcABQsJCAcCBhUK CQgLAgQWAgMBAh4BAheAAAoJEKGPd44Z/DJIKtgL/0JQEzrGWoHHN7T4wLiArPCv tHB3dTZBoXGKlpuwhgOZ1th6jOnGPdMZRYnX8Zuf7QhaI7m/duKv9OAr8A/2ftHG 7/BxPSHJWBuIGZYNL97OWSstuBhNtyxfCftDkeBCqJ+lAneOrzV0M8syr2VqpfVs O8nTE7nXHSOdyen+1Fw0PtwaeG9uJvOhgRsmQ+mtAiJ1OLGKUxgCzSUk0m/YnDg0 vJBtzq9qP9+EZSuiBuRQC0tKs01ECI5DzWLNXXC6X8k3YGrJpL/HtTxH5SYNQRvS ALd+HmVYpwijLPi7ANzmg9/+h/aq4VFP/4SyMd6EjaaQ86n2fC5zeugio4sjtFMp W3jbZPn19o2hWTt9/bLns+fm9PgnPwdC+tS5LT26N6vhT/vK/HHY5AZvXXPNcQMA wp+EVFxsWK2BcFMIi7Oq47CfuM1AUA+pgCenB4iSVwxs8ANTWWIsLkkKAYQqIdan OSISa2WdslsKMjXIQ5+rG9ekEn+rRO3EAQXRryBt4LkBjQReh2q0AQwAwGx7shIW OaVExpngqmh0ApkxJHZIxcxpatk/lSBQfzHg6e1/7Joe98lEHcWPJ6WFsGp+aC9S 96dWTBZq/4pzAqqTrSXAZpG/+yZlWRWSXVQex1gZHPzsWYMPE9qayAPTOJHtfS6a klIEaFV2GYEvvRK5UR5DFIlsfzyyCBOUKvn0/hikqJjN2YfHUy5SR5U5dGsSX3Jk Q9bOlBYDpN3Rk5rmLg0Vwn4nPRBET70MLQ5M4pU3Br6n+vU8tMHoVXYVMLinD4gO vVY4baXEZELjcPkPzGFPyjVLlpxKMHZ6v1Qb9ornTRGzc4dEUKxi3srdsTpMCw0k CaZ2WLY4sNBO33C8XfIvMx2jF4iIk3BrSrW/hirq6xpvlh4BUh/UWVrvg2rdemAX THa93mRQeOa3bze9xZwaA2GJLRG+xCIt15v/cNpQwCYlyhJunkuwk3HQcUrKfzxo 6QhqMeDaPZeNcvN3XoELGeqtoE7gKAnLp2nQuVr4/pcaiATf+yAhBgYRABEBAAGJ AbwEGAEKACYWIQT/8x6G/OtQRuiyfUqhj3eOGfwySAUCXodqtAIbDAUJA8JnAAAK CRChj3eOGfwySB11DADLgMAafhdzRgzx7FLVVW80IfgiCTAl5M1wV2HctA17aln7 jk7iEVMTLfhrSCSvvNIdrOXUE7l9HAMkKRwaZv7OAtYR8eQTrgGc9yJdk8BMzvJB ouiaNb2LSxMSvpoaJmD2C9ZkOyW+pAXKaUGhbUl8YVa7ytwPD6yZzonGClgZI0x5 9nSc5TiPpVijzu51iZiTV35F6en7ke2hjr6iBACJGBplxeeWszRa0wK2zoubAUK1 KO2punvtGqhi3j77/0sZgvFv3czJpRac5ccdLc02Sb6I64Stp04ilcV1aqlUXxbM gLwkoXZUqbCS7ZA7eBiEaKXdj9ww/gprO0AwFETxQVA8iPF9puSWfBf18a5GEdR1 Drb5lSReCkCfBJd3Tf5WHUSrdcai0FfuXNNp/7J7CBzlOJ0h6Yoa02hz8CBGGwxI 1brXRm13004bX7C9i+94Lbgf8bTM40JvyF1kmcffkj8ibpS/VSa8aWJuqpWk/xcn ob/YdBngWCxNgXii4E6ZAY0EXot8fAEMAJ/JOflg7U8JWescyTQNl9Xuk6QUIVKx 0zOT2k+drlLwC8+FckYTCF1pm8sPDBBv9eN3cFCDf076tZjUHv+Roq5c5McDHlN5 KlFbTSOv1qZYuaPY14nHIoW7OGoSvMCOBkpDLLwnIbuLA0wGdzyd3z6Vfhpz3wDv iAplyA4iuzJQq1+iS8tq6Uj2yhmfg+zU16gw2D3iEC6hhSu2KmPhMFD9KfCzq02L xC6fMh3Fogas51ZF1fRDK8Bvicf4yYj0dn3i6GDr0/vHga4eLQqVBXb0HCv2lNer gTtawQfJu2XEn5hDZKfHeBJ4NI4k7AZIPa7OuUqOAm8Z4hbkgRZakc+OhPSEKH2i drItwrPXDGqMYV4tLLMALMQ9WDTz75wbzVbxGVcAzG3MaZSo/f/iKzuzaE8cF71A dO1y6H5YmmMENn4t/D4BYXm4edPvV6SaYU1hO5yqr7vGbrQBFVetpSCLEFveACHr sm1S6nVVTazkHj2FNdww4bGMJzPqC7bBtQARAQABtChBREFNIE1BUlNIQUxMIERP QlJJTiA8YWRhbUBlcm1jY29ycC5jb20+iQHUBBMBCgA+FiEE9+R8sSygzQHF4cv6 fsjVqFo41joFAl6LfHwCGwMFCQPCZwAFCwkIBwIGFQoJCAsCBBYCAwECHgECF4AA CgkQfsjVqFo41jpPfgv/dylMY4CPMwkdry8KnKP3QtmJOl94VnpJ+FUME+oOqjBw 6/C16uWdTLYuEUuE2jEzTg2J0kgulM2vYm8rVgJzlGiD/oIgX3X5NeyB9MH+GCpu xsJ/ofIVpC6t8Zl78B2qTnJOcEc6owy/qKs/eFXSea2sRRstqK20dOajl4Z2ycEL SdijFR3aqT4hU6e0GNWYqo3bW4TUcd05RJIZBNz6Bitq1fxljxFPOOCaoKo9mVn4 0dN65iGPEYg0c50Q6EmxEr+XtwRu1rjgG3hgq6BknZ6QD1HOBemQg/3jqQBb9uHj jHbuX9HrbGF9+QbDicbmuZSLuV76xJnbyTycFhhIcSi9wZeyAAPlpL4GQ8l98jKa SCWWGDPpKwK5+o8kteuJ/D/mYyBEquyFVhPQBXV9zS3LsN7ab55zB5+ZnLUeofai LE6e+XPGeJmG3I/+T/Nuq1CqJ4Wyt8+aIyf6Uz8dDk0kjyQku484plRwMEx7oZXR bXQAAn8SwtlNGo0sHc6JuQGNBF6LfHwBDACxAxfbQM5AcssJlQFXThnBMHtRDeBH VkyF5mrO9JeFRT+mhM87V+fJXOaEKtcSFVgZJFKV2MPdyGqZSGKmyyqfUvKfucP5 LrjK3MRKibTlOMwbBOmYUksMVE0ByMPeSzyMlQhq0oyA3fvEdKEf0JrFGDRWNzO8 /Q54oj79Pki4y1BDKd7lE1srBFiVEUuPNJmjhhU9WXnMwiB55lLwbTR8mKEX0Pr2 FeTS5gttmbHf4V+wnJvlOEU6mOLMrb+6Xb4ltvqbl9ng1+tF2QMGMd83mtbFtAjb Zcl/Cq2KwsBFyH9VT48ZxWxpOYMf3ppEg9KOSfz9Ungtg4/Q/Kr9P13Nf+9+S9JS 1PfKdlJzGFDn4EwZ49ugg6GNnL6XuRl9jBPD2iD8hY9CsTdWrr9giCmJmdf6G/bK HUm2QekMbhpaQmYKkMeri45cHprx1dQ50rfiH1cBm5SxaK7z/hDDaKXF1Gp7/KwQ g6gHlyMss7EEHSY5ogH+6a7OUPpqbJdNztEAEQEAAYkBvAQYAQoAJhYhBPfkfLEs oM0BxeHL+n7I1ahaONY6BQJei3x8AhsMBQkDwmcAAAoJEH7I1ahaONY6EqoL/R7J QLaAlb4/hK7/v4vsSxtCirLWrqNNNJxYdmpXq19NKPmcc08QzSqkJ7vR4/kn2L6I OY7y7AMh+tScKTKIGn8MkAcj0ZvkafHY3xmpN1Xp9caUAA/fw6KWD+pSZpKpISyd 2Xr6x5OJGSKhyGpPB98oCsa809LQ3cweG1imem3jx+Lgii63pEJG/AeNeEwkIvdC zRLSQvYv0UjlhyOoII6YEWJcro+tgOcthPh2SY50E4lwFFfbz4CNQyL15D+XciNI xSVGz8gee/XdJdgwQF4SEnIiChhmJ5VmpNH8ZwxTMyI3EoFMB/RYaucwc/ucvySn cFyShFFRPjo6TOeYIaSrrfR+4yhHAGeM572y0btI6JjWZovupeXX3k5ZHHrCwxlR MuyULLyhUsAC0r1FUijbUWoyaDcRtLRpMUg1X6A7n1iH61WxlKQ/8mZhYht85Jgp FSiyz47gofc491ng9efshlyxwb3TeLbDZPRnls7L3sfDDWwp8yExjA7UNDbIh5kC DQRencYLARAAsFHArFeulhD6hZplRF49h8+zpI3kn+vFtYwbUqLSRwze53rrJtqE 6o5MWSfadr9KIc8tNZ2aBGxzjGnsbPYLDh76NkjP4apWSMX+u+EHsaudoZoAdNnM Kqr86sVzR0MUeGHp7n/L3imp1WoCn28eMLeNec9a4GRTRPGLKR9F/jytTz/XgkHL zA3i2pt63FqniN4PBTNFzgfXiu8xVZGohsDPjmd9LXbGKTXfJGhBLB6QsmjJwglt n+00ufdKLEZu6eBxRWSVK0t4rEnnpK9K//PKq5DtVaOZNe6g+hdi0B1gpd0f0nBy eZd9arCsvN3qLXP0vYTk9DKMUecCEblss5Zt1+qjAbsMk9/xSGZLJp/4dBTBVN+Q c6+Rmv+koe6zLNmA3fJH3991xETDzZxP2UHN7q4i4L97KA+nVAakwazNLiqsY/bT s58rXnCc72b7oLnZbNOPQmLwZFafVi4xoIE/5Zq8iVr7d7xHPccYkaEVCOnsL/35 GZxy2FNi4wuOfGwBtTbnXg/u/YiBj6yNbhLR+FCwZED5M/evgUUbJudxqRdrI+1a Zo9gGA3JLJZZ/iLwF1kE7yYBvyBRfaO9IL3bwplRurnrkjI+rRhi55AlbGhU3eMu iKTKQk+qJF11ocTGu/dE9I6JeQpEdyVehrWXc5H2N0Qjyca8ZEA6WwcAEQEAAbR7 QURBTSBNQVJTSEFMTCBET0JSSU4gKGl0J3MgdGhlIG9uZSAuLi4gbGlrZSB0aGUg b25lIGluIFN1cGVybWFuIDMgYW5kIE9mZmljZSBzcGFjZS0tYnV0IG5vdCAqdGhh dCogb25lKSA8YWRhbUBlcm1jY29ycC5jb20+iQJOBBMBCgA4FiEE0s8R6kp2bveF MmxLkifaSe8nN2gFAl6dxgsCGwMFCwkIBwIGFQoJCAsCBBYCAwECHgECF4AACgkQ kifaSe8nN2jK+g//Toi6ezWYrRbTs9xwQLIsKzl91ocjCuN9nHSnwzkrLuoGGgej fHkXzd5+3ygL47j++k69TYB9CPrGdR1GTqt56Q7DSYZCgdg+e89piTJUzbEyN01q EGkVuV5Rz9EocnPE8db9HT+xvf44ecfMOFD1XuB9jynrQD445YfeFE6LHkoNUvFD wQK7NN04fa+qvrk0lTS4NCpOYsdrSioddVjQyEC6jepwIRA3iRIkFdEJT8ggqQ6d gntsgExA01o6HqzDSHjSCA5AexCotwW3Uvdt0WwXx6q/c0LsRLhbuPeGX/Nh8aOf 6RBCQWgnIko675ura4c+r1VcBYl524ZJlN4x1x02YAo9cKzYi3+H9C8K8Ayz/SJy 7sVGHWnDge1yIwzWXbpolqiMSL5l/0OBuJ0HXQSafUut33Jw7hYKP4BQia/BmE0x Tsk0rBRMyihSYnUn9mYpXM3KwWU0C2dudVwKtToGR1aKlYcCv0iNFAsR0DBw1XSq n72KqIl020gZFmg3H34Z6CWhm20RbhMjOvvkZ+OiS9kU9kXt6m+T1zCpWHFJSae4 JF+dQyB1BFxAwXW4ZEzMo4XluTuW1R8pIadKTsHMWzEzH7RvZLKP4invsZklZ3I1 EEsJop7DSMOa27irD/IlCL+nwaEsCMRh+ndSkADLHsa9P5d/qWjomKxwdCm5Ag0E Xp3GCwEQAOoXU8NrugMa8OAncXKv4hycXJzArDae3Zx6pCCEkP3TZTXh1tqKPUtb dmb8Mq2eecVTwmB+FM3m+NApgq88Vx6HiyI73IAvgtZORo32YaipfbkGnXHfaUWX 5380R4GL597yZuP8sAsJ3iDvxhW59snsU8tLi+9r2u4h0fgMDqZXQsfvLUkDIiO9 nzJf0xFacTx3n+pUuWdzIuT3AUdU/L9NubmHSnj09FevTHWIYmxGFZoiSdS7r2Z+ 5xZmPak6lzrQTVS/DxcpyA/o3yi8qLPyf1VUxXKFeKd0sV6BPvYFxI2GeBl5atBu 9/3/5D6wdlrupTFLU1Msdfy3UWaRUFHLITK4fJ7pbTgoEqxX7gpO9iqKmScm3gYc O3blA8aTqCX2NzxUF5fHbi14JvPWP04uFl5EOeDB322Jm/guWy8TvmIIyuF3aAAX PfErW/yRWDsYOcAADs8elZkt3F+E/AwWd0JMIhd/RB3RFH8m7496XLS3xBP6rNye 0O+96lX7fVp+wvINxM3Rfo63b1K4bR5KR9JDZ2SLYhrx6Hyy+UiRv7l+i26WxVMF qRyvY2aHqyvKfR1EEf1t2h7B4b65xQkj51qvX5Tjm5Az7nKcXpcUKqS3bk8xiw9N y7eFfA361OSPpQ+V4Mq/Mv+MqyxLTz9tn+80ZtjqM0MEERfpUo15ABEBAAGJAjYE GAEKACAWIQTSzxHqSnZu94UybEuSJ9pJ7yc3aAUCXp3GCwIbDAAKCRCSJ9pJ7yc3 aE2NEACDBRnGYNi2sq0wltPSkD2CbQUon+4uiFB2UU/gs4mFlGOvzDHBHVEFzCqK 0x6KlKm4XBq3AF7iIoNMiU9FmBdWDnEp9eCXdQrr/ykgq3vKMuj6/QJNNZglIDoe 1J2NXeMOUFwCUvjcCttPv42Q8GDt8/bG7QOgmTmhuqvKIj/vL+c3HgNrRsQzhw5z mSzQIDaesD+UVA/sourXpSLeqPgF+6qsEqOirD6hotaqrt+aIA/8wbYkpNQxCEK4 gKDgpqTV7VKklku7fjyhBhZQOVDoWvd03AlGQD0WBNriUsh8l4N6Zg2BlnKTGn11 BTigqwlHC91xtjERgwFg8PAHN2mtgZUHITHX5js11KwlQdLyI04/M4M4oQq0KSbJ rpiWCgrltC/VqJrT4HELFYx2Iv5wzrV9jVEm6zonag4A761hpqTgRrjWtaLuYu2Z zdw9y1r0+0d2rTUGpjIQRVOwi3AF/G4aU+vAOOf/HcgH6Qnpbu+xV0fkuAZbTI7w 6VVkBvnstiQV88KrWAOXKVABSSxTz2OYbzOTt/bgxzAa7yr1xIBDKvujBqDRGBLi bISp+40Haoj2Yqop6vbS70Xq+cnBOwJW86u61hsLgOjqyxgLzvuGTjK7+TblCjR2 F4LNeQdwDdyNRjPYeGVXM3MEqR8XdcR1Z7BQvLNcDgoW2qDcbg== =4lZw -----END PGP PUBLIC KEY BLOCK-----
Please see GPG keys on PGP.MIT.EDU; fingerprints: sec rsa3072/A18F778E19FC3248 2020-04-03 [SC] [expires: 2022-04-03] FFF31E86FCEB5046E8B27D4AA18F778E19FC3248 uid [ultimate] ADAM M DOBRIN \ ssb rsa3072/04F98002A3DA53B2 2020-04-03 [E] [expires: 2022-04-03]
sec rsa4096/FB4ECE4A109229CF 2020-04-04 [SC] 4FAF0D3E208A1F4C980D0F66FB4ECE4A109229CF uid [ultimate] Adam Marshall Dobrin \ ssb rsa4096/DD1F0C118C788B04 2020-04-04 [E]
pub rsa3072 2020-04-06 [SC] [expires: 2022-04-06] F7E4 7CB1 2CA0 CD01 C5E1 CBFA 7EC8 D5A8 5A38 D63A uid [ unknown] ADAM MARSHALL DOBRIN
Because of "some issues" with what appears to be distinct and unbridled privacy intrusion; please ensure that PGP is understood to be "nothing more than not so much pretty good" and this key also, almost required in order to verify authentic identity--in the case of ... question.
From “Bow Down” come “Rise Up,”
This reminds me of gaining respect as you get older, is this about growing up?
Oneof thetr ick sto storytellingis, n evertotellevery -t hinga tonce,tomake youraudiencewait, tokeepevery on ein s us p en se
This quote reminds me of how an author/storyteller gives us a good cliffhanger. An ending at the end of each part that draws us in even more as the story goes on. I especially liked the cliffhanger with this story, because of the roller coaster of emotions that went on and the ending that I would predict kept on changing as the story kept going.
It doesn' t sou n dso good . We ared oin gokayw ithout i t. We can get alongw itho u t thatkindofthing. Tak e it backCallth at story back.:"But,ofcourse, it wastoo late. Foronceast or y istold,it can no tbe calledbackOncetold , it i s loosein the world
This story reminds me of the Hawaiian proverb,"I ka ʻōlelo no ke ola, ika ʻōlelo no ka make."- Puke ʻŌlelo Noʻeau (In word there is life and in words there is death). Being conscious of the power we release in to the world is important. Intention is essential when telling stories, with our words and actions.
Indigenous voices must speak for themselves. And we must listen
This reminds me of replacing the word "safe space" with "brave space" (a kumu in my island feminisms mentioned the other day). An environment to stimulate confidence to be brave enough to share our stories, with the belief that others will listen.
“I have a problem when a book comes out ‘about us, but not with us’ — when no one has consulted the family of the story or an Elder…. Our history and our stories are continually being told from a colonial perspective.”
This is the issue that reminds me of the word "ancient", speaking about us when we are in the room, but made to feel isolated as if our voice cannot be heard. Some want the art without the story, the clout without the rain.
In the dialogue called the Theaetetus, Socrates discusses the question “What is knowledge?”
This whole thing reminds me of something we've talked on my art history class. The Enlightenment theme of "Triumph of Light over Darkness" was something that marks the beginning of human's attempt to actively test and explore, and this desire of knowledge has changed human's perspective on the process of getting new knowledge. It is quite obvious and interesting that back in Plato's time, what they were discussing as "knowledge" was the things that were staying there superficially waiting for people to see (or for people to realize in a coincidence) rather than the things we need to discover using calculation or analyzation. This comment is not that philosophical but I think it is somehow related to our point of interdisciplinary study.
In doing some work with Japanese, I’ve come across a Chrome browser extension called Mainichi which shows me a flashcard-like image and the related word in English and Japanese (with both associated kana) every time I open a new browser tab. Because I open dozens to hundreds of browser tabs a day it’s an easy way to review and even learn new words. (It also reminds me that I ought to be working on my next lesson instead of surfing the internet. :smile:)
I’m curious if anyone has seen anything like this for Welsh beyond the more focused use of flashcard technologies like Anki, Mnemosyne, et al?
She doesn’t know how she got here, or who I am, beyond the fact that I care for her, and she takes care of me.
reminds me of "we are all walking each other home"
“once upon a time”
To me, this phrase indicates the beginning of a children's fantasy story. "Once upon a time" reminds me of stories of Disney princesses in particular.
men, full of vigor
Reminds me of "Parfum Exotique"
e build rhetorical baffles around our lives to keep the crowding out, only to find that we have let nobody we love in.
reminds me of our generation's ineptitude when it comes to closure - much easier to say "see you later" than "goodbye," it's easier to ghost someone than it is to be honest, etc
nd I said, ‘‘You don’t understandbecause you’re skinny,’’ and on and on forever.
the dynamic between skinny people and fat people kind of reminds me of this same argument about how degrading any body is bad (meghan trainor released all about that bass and said skinny bitches) and how you won't face these same sort of microaggressions/discrimination if you are skinny, just as with any other marginalized community and the majority
Now the rain-dark head came down and rested on the dome of the embassy.
Is the "rain-dark head" simply a raincloud? When the world "embassy" is mentioned, it reminds me of people with high power. Since our character is a foreigner, he could be in an embassy in a foreign country that belongs to his home country. Is our character considered important?
Hakeem Olajuwon
Reminds me of Kyrie Irving who is also professional Muslim basketball player
American citizens are free to practice their religion, give voice to their views and use their creative energies to pursue their personal aspirations.
This reminds me of inspiring politicians such as Ilhan Omar and Rashida Tlaib.
arly United States would survive only if it could unify its diverse, competing—and at times, conflicting—religious and ethnic groups into the fold of a new, collec-tive national identity.
This reminds me of the common debate of whether the US is a "melting pot" or "salad bowl." A question of do citizens retain their heritage and identity or do they feel welcomed into a cohesive American one.
Whereas people used to build their own homes according to their unique specifications, today such an undertaking is discouraged, or even illegal. Instead, plans are drawn up by a licensed architect, and construction carried out by a team of wage workers. “When dwelling by people is transformed into housing for people,” Illich writes, paraphrasing architect John Turner, “housing is changed from an activity into a commodity.”
Reminds me strongly of that piece about 2000s beige.
a reflection of why one construction has more staying power than its rivals
This is an interesting point. It reminds me of the quote by Winston Churchill, "History is told by the victors". Our understanding of the past is entirely dependent on the generations before us. The victors are the ones whose stories we hear because they are the ones who went on to build our nation.
But I’m interested in this as a sort of lifecycle of information. An idea starts out with what it means to you, the “I” in this situation. Then it pings around a social network and is discussed (the “you” phase). And then in the final phase it sort of transcends that conversation, and becomes more expository, more timeless, less personal, more accessible to conversational outsiders.
Hmm. Is this true?
I often feel like the connections people make are exactly the most personal part, and necessarily must be sloughed off as one tries to explicate the essence of the thing in Wikipedia-like neutrality. My annotations often look nutty for that reason -- because an anecdote someone's telling about mushroom hunting isn't at its core an expression of a narrative that then inherently calls out to be categorized as such in a way that I can then say "this reminds me of the cozy web".
When the researchers analyzed the genetic interrelatedness of bears both within and outside the area’s three language families, they found that grizzly bears living within a language family’s boundaries were much more genetically similar to one another than to bears living outside them.
the idea goes that resource areas keep different groups together — expansion isn't random sort of reminds me of that map of an ancient cretaceous coastline that created good enough soils for high crop yields, so there were more slaves who today tip the scales in favor of democrat, forming a line of blue along the state
“It’s bad for children,” said old Cotter, “because their minds are so impressionable. When children see things like that, you know, it has an effect….”
Cotter reminds me of some old distant relative at a family gathering that's always telling you what to do.
No! No! No! It was impossible. Her hands clutched the iron in frenzy. Amid the seas she sent a cry of anguish!
Eveline's reaction reminds me of the ending to "Araby."
“Mr. Bruff, the assistance I innocently rendered to the inquiry after the Diamond was an unpardoned offence, in Rachel’s mind, nearly a year since; and it remains an unpardoned offence still. I won’t accept that position! I am determined to find out the secret of her silence towards her mother, and her enmity towards me. If time, pains, and money can do it, I will lay my hand on the thief who took the Moonstone!”
This excerpt reminds me of a scene earlier in the story, when Rachel asked Mr. Franklin to stop smoking his cigar. He then adamantly refused to start smoking again when she asked him to.
Lottery in June, corn be heavy soo
is the lottery some kind of sacrifice- reminds me of some aztec traditions I read about
Furthermore I interviewed Angel Calmo who lived in Oakland for about 16 years he explains, “Police go way too far because they think their in control of society and we as People of Color and taxpayers we pay them to protect the community and serve the country with respect but police are not doing any of that instead killing people who didn’t do anything wrong”(Calmo).
This reminds me that the people that are not affected by police brutality tend to not pay much attention to it.
“seek to understand the issues and interact critically with the contents of particular teaching materials, relate ideas to previous knowledge and experience, and examine the logic of the arguments and relate the evidence presented to the conclusions”
It reminds me of the cognitive presence is the CoI model.