8,004 Matching Annotations
  1. Sep 2021
    1. But despite this understanding, and the gains made more generally in promoting workplace diversity, prejudices keep the employment prospects for neurodiverse individuals shockingly low. The cost is personal — denying individuals the chance to do meaningful work — as well as social, sending individuals to the dole queue. It also means workplaces are failing to benefit from highly valuable employees, and missing the opportunity to become better organisations in the process.

      I posted this article in the class Slack for a couple of reasons. First, this particular argument reminds me of Benjamin, which we're currently reading, and how she shows that the problem of underexposure wasn't taken seriously until it interfered with capital. But, second, I also used it to point out that despite that, it's important to remember that we sometimes have to make arguments for specific audiences--i.e., that it isn't necessarily that Daley only cares about workplace productivity, or even that she prioritizes it, but that she's writing for an audience that does prioritize workplace productivity over basic humanity. So, the rhetorical situation may call for making such an argument rather than appealing to humanity, morality, or equity.

    1. This reminds me of a Journalism class I took years ago where the teacher told the class that the Midwest accent is what most broadcasters try to go for when working since it's easily understood. I'm not sure how true that actually is, or if there was more social aspects I wasn't aware of at the time in play.

    2. This reminds me of thinking negatively of people who use a lot of "filler words/phrases" when talking. Filler words/phrases are things you say to give your brain a second to catch up, the words "like" and "uh" are two common ones that I use.

    1. giants who had made themselves strong by eating the flesh of those they took in battle and drinking their blood.

      reminds me of wendigo legends, where wendigos were once warriors who were cut off from any food source save for their fellow people and became cannibals who over time developed and unending hunger for flesh.

    1. the native Taino name means "Land of High Mountains" and was originally applied to the entire island of Hispaniola

      reminds me again of the reality of artificial borders and the ongoing effects of colonialism

  2. learn-us-east-1-prod-fleet02-xythos.content.blackboardcdn.com learn-us-east-1-prod-fleet02-xythos.content.blackboardcdn.com
    1. In a clock-time culture such as the United States or Canada, conscient us people would give much attention to writing down appointments on a cale sar 0 punctuality, and to investing in a watch that keeps accurate time. urther, they wou’ expect similar behavior from others. In an event-oriented cu. es con fentous people would be expected to react appropriately to ane hey demant 5 oo ed ime. They might have scheduled a meeting for 2:0U P.M., ; Eat thin aside if someone asks for their help at 1:45 p.m.

      This reminds me of having "Syllabus". In the U.S., professors and teachers always send out syllabus at the beginning of the term so that everyone can arrange their schedule properly. However, in China, schedule will always change base on what's happening, so exam times and assignments due date are never settled.

    1. 6{—J‹‹Í ê{À»êT‹YJ°êÀwJÀêÀwYê7Y°žêUžY»ê—žÀꋞž†êËY‹‹ê{—êÀw{»êRJrê7Yê—YYU»êJê»ÀJsYê§êJêªYXdq=¹ Jê«{——JThÝÈêªÈÀêw{’ê{—ÞßtP›M‹Ÿ 'kŒ|‰c.ê°JRR{À ê‹{†YêJ꬞ÀJÀžê/zÐ!;ê—žÉY‹»(ê{—»ÀYJUêžfêwY°žY»êÀwàáYê ̈Yž ̈‹Yê{—êÀâã

      (SPOILER ALERT) This reminds me of chapter 2 of The Hobbit. TL;DR the Dwarves-- partial epitomes of fantasy heroes in their masculinity and hunting/weapons proclivity-- are captured in bags by trolls, and in a subversion of who tends to be the savior in fantasy at that time, it's the hobbit who bails them out. Hobbits have a proclivity for potatoes and rabbit.

    1. To gather Paradise —

      Reminds me of Blake's invocation at the beginning of "Milton"

      Come into my hand

      By your mild power; descending down the Nerves of my right arm From out the Portals of my Brain, where by your ministry The Eternal Great Humanity Divine planted his Paradise,

    1. where the pattern lolls like a broken neck

      This imagery reminds me of the lines/phrases "his historical neck broken...broken many professorial necks" that Adams uses in “The Dynamo and the Virgin”. I wonder why they both choose to use the imagery of broken necks? What is the symbolism in it?

    2. It is a big, airy room, the whole floor nearly, with windows that look all ways, and air and sunshine galore. It was nursery first and then playroom and gymnasium, I should judge; for the windows are barred for little children, and there are rings and things in the walls.

      This is my favorite line in the piece. (It also reminds me of Steve Martin pretending to be Micheal Caine's brother Ruprecht in Dirty Rotten Scoundrels.) This is the dividing line between John's rational and unsympathetic world (a world that values fresh air over the needs of the narrator for mental stimulation and a raison d'etre) and the narrator's ability to ignore its harmful effects. This line provides the reader with a valuable insight into the house's powerful effects on the isolated individual; it happened to the previous shut-in too... One cannot help but wonder how John could ignore the presence of those rings on the wall, the torn and smudged wallpaper? Does Gilman intend to reveal that John nudges the narrator toward mental deterioration?

    3. I don’t know why I should write this. I don’t want to. I don’t feel able.

      Gilman uses anaphora to highlight the wife is tired of being sick. She has become weaker that she isn't sure if she should write. It reminds me of Du Bois not wanting to break down the "vail" between the white and black folks. When he was younger Du Bois mention he had no intention of breaking down the wall which is similar to John's wife losing motivation to write.

    4. I’m getting really fond of the room in spite of the wall-paper. Perhaps BECAUSE of the wall-paper. It dwells in my mind so!

      At this point, John's wife is sick of the "Yellow wallpaper" which frustrates her to be in the room. I think it's interesting that the word 'because' is capitalized since it emphasizes she’s tired of following orders from John. The thought is on the back of her head 24/7. The narrator hinted the wife is trying to get a better understanding of the wall-paper. This similarity reminds me of Adam and Lansley having different thoughts to understand how the dynamo worked and how it was going to change their society.

    5. There comes John, and I must put this away,—he hates to have me write a word.

      Something I noticed in this line was that John doesn't really like his wife knowing how to write. It seems that John likes to follow old traditions which reminds me of Adam. In the "The Dynamo the Virgin" Adam was determined to learn math and science. Here, the wife seems passionate to write but knows her husband will not let her. In Du Bois passage, he mention that knowledge is power and that everyone should get an education which makes me believe that John is afraid of that.

    6. But here I can creep smoothly on the floor, and my shoulder just fits in that long smooch around the wall, so I cannot lose my way.

      The story up to this point has slowly moved away from tangible reality to an abstract conveyance of the narrator’s perspective of her mental state; this final act is so far into absurdity that it can only be perceived as some kind of allegorical abstraction rather than a literal plot. This way in which the story is told reminds me of Adam’s notions of the ways in which individual’s perception of the world is what brings its meaning. Perkins goes to great lengths in this story to portray the protagonist’s perception by engaging the reader with her moment-to-moment consciousness- almost in a stream of consciousness way- and the abstract/ enigmatic nature of the narrator’s perception helps to convey her declining mental state, successfully giving the reader a sense of how she sees the world.

    7. John says if I don’t pick up faster he shall send me to Weir Mitchell in the fall

      John holds his power and knowledge over his wife, almost treating her like a little girl. He is constantly telling her what is benefiting her and what is damaging to her. He doesn’t listen to her needs and ignores her true requests. Every time he reminds her of her health it’s almost like saying “I’m smart, a physician, and a man, so you must listen to me”. Similar to how Du Bois expresses how education does give a person something to talk about, almost as if it puts someone on a pedestal. These type of actions also remind me of the teachers Adams writes about, men who are much more educated and believe they have an advantage.

    8. My brother is also a physician, and also of high standing, and he says the same thing.

      By reading the first few lines I can infer that this couple is wealthy since they are able to have a house for the summer. This reminds me to how Du Bois talks about white wealthy people having opportunities like this. They are able to escape for a season, the wife doesn’t work (her husband forbids her). Her husband and brother are physicians. They have a life that many would have dreamed too have at the time. These are the kinds of experiences that Du Bois would not be able to have because of his race and the way people viewed him and his ancestors.

    9. That spoils my ghostliness, I am afraid, but I don’t care—there is something strange about the house—I can feel it.

      The “Ghostliness” or haunted aspect of the house reminds me of the Shadow motif in the Du Bois memoir. The haunting here is symbolic of a history of potential power in femininity which has been oppressed- the room itself acting as the physical oppressor of the main character, and her husband as the oppressor. This is like the Shadows which loom in Du Bois’ memoir and represent the powerful history of Africans that has been oppressed by white society in America. The motifs themselves (shadows and hauntings) are similar in their obscure and macabre nature, lending to the atmosphere of each narrative.

  3. eds-a-ebscohost-com.erl.lib.byu.edu eds-a-ebscohost-com.erl.lib.byu.edu
    1. interesting- the reference to sea-waters yielding fish reminds me of biblical stories of Christ's miracles upon the waters- but here those powers of heaven are relegated to the whims of the gods

    1. To this I respond with a reminder that each of us is able to undermine the system of oppression by refusing to live with unchecked or unacknowledged privilege. Simply by reflecting and challenging our privileges, and working to change the system of discrimination through direct discussion, we can help to shift the status quo.

      This reminds me of the Ted Talk we watched from Lillian Medville, as well as the infographic about Peggy McIntosh's work, about the necessity to first acknowledge our own privilege before we can start a dialogue about privilege and/or inclusivity.

    1. Andinfactit seemsquiteplausibletomethatsomeversionofthisaxiom(perhaps"Evena paranoidcanhaveenemies,"utteredbyHenryKissin-ger!)8issoindeliblyinscribedinthebrainsofusbaby-boomersthatitoffersusthecontinuingillusionofpossessinga specialinsightintotheepistemologiesofenmity.Myimpression,again,isthatweareliabletoproducethisconstativeformulationasfiercelyasifit hada self-evidentimperativeforce:thenotationthatevenparanoidpeoplehaveenemiesiswieldedasifitsabsolutelynecessarycorollaryweretheinjunction,"-soyoucanneverbeparanoidenough."

      this section and particularly the allusion to generational politics with 'baby boomers' reminds me of ongoing online discussions about the online left and the practice of reading every post as uncharitably as possible as part of some sort of moral crusade to have the most correct possible political opinions. paranoia and the death of nuance.

    1. Tech companies have already begun to take significant steps to block accounts and trolls spreading disinformation about the coronavirus.

      This reminds me when people were first getting the vaccine, there was a lot of tiktoks of people supposedly getting full body sort of spasms, and even though it was made as a joke, there was a lot of people who actually believed it was true and stopped themselves from getting vaccinated.

    2. I work as a medical assistant, and this statement just reminds of what the doctors' experience inside the clinics at the time when the virus grew exponentially. I remember one of them telling me that there was days when people were actually scared to come in, and patients were always difficult to deal with when they did come in. Doctors need a lot more praise in this current world.

    3. mocracies must advertise democracy. With-out emulating propaganda methods typical of authoritarian regimes, democracies should support literacy on democratic decisionmaking on both local and national level and on the values that guide public service and democratic processes, while strengthening anti-corruption efforts. As the democratic model has long been taken for granted, states should make a greater effort to raise individual awareness of democratic freedoms and civic responsibilities, and encourage impactful participation

      This is also an important take away. This reminds me of the paper we read about readers- we need to educate the individuals, so that each individual can and will think for themselves. This is so crucial! When we have individual citizens capable of utilizing tools and researching (properly) for themselves, rather than simply watching their favorite news station or listening to their friends and family's perspective, then we can truly have progress in the form of moving forward with educated responses.

    1. But memory also helps people predict what it will be like to do things they haven’t done before.

      This line reminds me of how I do almost the exact same thing over and over every single day between daily routines, going to class, and going to work. So it would be easy to predict what happens next. But if we are talking about years from now it might be a little less likely that everything will be the same. I know years from now I will be doing something I never done before.

    1. the idea of building on the capabilitypeople already had rather than telling them they had to change”

      This reminds me of the common saying in the special education world to "presume competence" How are we presuming competence in ourselves and students to be "better"?

    1. Anaked figure masturbates amid the gnarled roots of a tree

      The hook provides both minor shock value and an immediate scene that the reader can envision. It reminds me of a journalistic approach to an introduction. Generally articles begin with a "lede." A lede is intended to draw in the reader by providing a description of a relevant moment that relates to the piece.

    1. Scott disrupts this familiar depiction of the world gone wrong by observing that it rests on the assumption that there are those who mis- perceive reality and those who perceive it clearly, those with false consciousness and those with a scientific or true understanding of social reality

      This reminds me of what we talked about in our last class. That is, how we believe that someone else is wrong because their "logic" is faulty. Such a belief implies that logic is purely objective, when it in fact, may not be. The question that arises from this observation is: who is to say who perceives the world clearly and who "misperceive[s] it?" How can we decipher which belief is correct?

    1. Today, teen black girls are routinely depicted in reality television shows and music videos as hypersexual and aggressive. Such images, in contrast to white teen girl images, which most often emphasize innocence and purity, instead suggest “the overt sexuality of the black child,” and espe-cially poor black girls, drawing attention to the power of white discourse to frame cultural notions of childhood

      this reminds me of an episode of dance moms where Nia is given a pretty overtly sexual dance for her age and when her mom is upset about it, TLC poses her as the instigator and villain

    1. “I want to build a world where someone like me, a young person who controls tens of millions of dollars, is impossible,” he said.

      It reminds me of the reading "Stealing a Bag of Potato Chips" because the boy was trying to resist the system and the criminalization of youth. He was trying to make a change just like mr. Jacob.

    2. My money is mostly stocks, which means it comes from underpaying and undervaluing working-class people, and that’s impossible to disconnect from the economic legacies of Indigenous genocide and slavery,” Ms. Gelman said. “Once I realized that, I couldn’t imagine doing anything with my wealth besides redistribute it to these communities.”

      This kind of reminds me of the article we just read. She would already donate but once she realized that the way she is getting her money is not good and how it looks outside of her POV she decided that there was no better way of using her money than donating.

    3. as both a moral and economic failure

      Reminds me of last classes activity when we found out how wealth is distributed in the United States and how unevenly distributed it is.

    1. Nowadays almost all man's improvements, so called, as the building of houses and the cutting down of the forest and of all large trees, simply deform the landscape, and make it more and more tame and cheap.

      reminds me of that one quote in the heise reading that had to do with progress that we went over in class.

    1. KRISTIN [in her sleep]. His Lordship’s boots are brushed—put on the coffee—right away, right away, right...

      Unless I'm missing something, plotwise, Kristin doesn't really need to be here for a lot of the play. There's a good chunk where she doesn't contribute any dialogue and is only there to sleep, which made me question why she was there at all. This bit, though, reminds me of the times in my real life where my dreams are just replays of my day at work. I feel like her sleeping on stage may actually be a sort of character exposition, as her being so exhausted and dreaming of work is indicative of her working-class status and juxtaposes her against Miss Julie.

    2. MISS JULIE. You’re a charming storyteller, you know. Did you go toschool?

      Jean's monologue which turns out to be a lie is an example of manipulation. The objective of the lie most likely being to seduce Julie, not because Jeans loves her, but because Jean wishes to use her class status to advance his own social position. In a way this reminds me of the contemporary term, gaslighting

    1. Attempting to teach children as if they are instructional units

      This quote reminds me of a very interesting video I saw a few years about about treating education as an industrial system that churns out educated adults.

      The speaker is Sir Ken Robinson who passed away last year.

      https://youtu.be/zDZFcDGpL4U

    1. which links the name to the content and goals of the encyclopedia – the salvation of soul through attainment of knowledge and purification of heart

      Laissa Innocent. This is an observation I can make that connects this line to a buddhism class that I took in my previous school. We learned that the Buddha meant the enlightened one. In addition, they gain wisdom. This connects to the reading because they mention the "attainment of knowledge." When they mention the "purification of heart," it reminds me of the positive attributes the Buddha has. I can see how it relates to the goals of the encyclopedia.

    1. kes paths are open to her? Which ones lead to d a f ‘can she fin independ 2 5L0 €a 3 ence within dependence? ; stances limit women’ pendence? What circum- fisitainenect ae s freedom and can she overcome them?

      All very good questions. This reminds me of me, overthinking everything. I found the best way is to throw myself into it and stay mentally resilient.

    2. is not the Other who, defining itself a Other, defines the One; the Other is posited as Other by the Sue ositin itself as One. But in order for the Other not to turn into the One the Other has to submit to this foreign point of view. Where does this en i woman come from?

      This reminds me exactly of Hegel's master slave dialect.

    1. ormula that gives our book its title. If there is any one point that we hope you will take away from this book, it is the importance not only of expressing your ideas (“I say”) but of presenting those ideas as a response to some other person or group (“they say”).

      Reminds me of the rule of excepting critisiscm. For example, you can express your thoughts, opinions, and ideas but also grow as a writer by accepting critiscm.

    1. recognizable racial units

      The existence of homogenous racial enclaves reminds me of elements of both the Ethnic City and the Divided City. The Raffles Plan's division of Singapore into segregated ethnic areas was a way to best benefit the European traders.

    Annotators

    1. The results of this introspective difficulty are baleful. If to hold fast and observe the transitive parts of thought's stream be so hard, then the great blunder to which all schools are liable must be the failure to register them, and the undue emphasizing of the more substantive parts of the stream. Now the blunder has historically worked in two ways. One set of thinkers have been led by it to Sensationalism. Unable to lay their hands on any substantive feelings corresponding to the innumerable relations and forms of connection between the sensible things of the world, finding no named mental states mirroring such relations, they have for the most part denied that any such states exist; and many of them, like Hume, have gone on to deny the reality of most relations out of the mind as well as in it.

      This reminds me of Behaviorism in a way, but not exactly. The denial of mental states due to their general inability to be truly observed is very much the same. But whereas Behaviorism is strongly empirical in a scientific sense, this Sensationalism often gives way to a Humean type of philosophical empiricism.

  4. learn-us-east-1-prod-fleet01-xythos.content.blackboardcdn.com learn-us-east-1-prod-fleet01-xythos.content.blackboardcdn.com
    1. bellowed:

      The word "bellowed" really reminds me of an animal. It showed the wildness of Bertha's character; however, in reading Wide Sargasso Sea we understand Antoinette as a character instead of a plot tool.

    1. Panicked business leaders and friendly political officials reacted quickly. When local police forces would not or could not suppress the strikes, governors called out state militias to break them and restore rail service. Many strikers destroyed rail property rather than allow militias to reopen the rails.

      This reminds me a lot of what was happening a couple months ago with the Black Lives Matter protest sparked by George Floyd's death. Some of the protestors also destroyed property and many were wounded by the "protection" that was put in place to calm them down.

  5. Aug 2021
    1. knowledge evolves and endures throughout the life of a race rather than that of an individual.

      This reminds me of Aaron Swartz. I feel like this sentence pretty much describes his life mission. The sharing and passing down of knowledge and information is all we have to offer for the future!

    1. The strong must grow stronger, and that they may do so, they must waste no strength in the vain task of trying to uplift the weak.

      This phrase reminds me of when people talk about "trickle down economics" and that it will eventually get to the poor because that's "how it's designed", but they don't take into account greed and that the wealthy will just get richer and hoard their wealth and the poor will struggle at the bottom no thanks to them. A horrible society in my opinion.

    2. a rifle diet for a few days and see how they like that kind of bread.

      This reminds me of the BLM movement at the beginning of 2020, when the former president announced a similar threat of shooting to protestors who looted stores.

    1. blood, your brains, on a chopping block—I’d like to see yoursex,* swimming in a sea of blood, like that bird there—I do believe Icould drink from your skull, I’d like to paddle my feet in your breast,I’d roast your heart and eat it whole!—You think I’m weak; you think Ilove you because my womb desired your seed

      This scene was just terrifying. He decapitated the bird she said she loved much and then she went into a speech of her hatred of men and wanting Jean dead. I found it interesting as well as pathetic. She reminds me of Macbeth in a way, talks a lot of big game but never really goes through with it. It's not the first time she's rude or says she hates Jean and just wants him dead. Her hatred for men is also something that should prompt her to do SOMETHING but apparently this weakness she mentions earlier stops her. It's strange someone could have such a big contrast in them. Say all of these things to him out loud after what he's done to her and still not really act on any of it and go right back to the idea of running away with him and even taking Kristin with them.

    1. n constructing their own learning

      This reminds me of a specific part in the Everyday Utopias video, where the children were able to make proposals of what jobs and activities that they wanted to participate in during the day. Then their teacher validates their choices and follows through with coordinating with the other teachers and students so everyone can explore what they wanted to.

    1. ” Luis, a skinny dark-haired 13-year-old boy, sits at a computer station in the back corner of the room with a set of plastic action fi gures from the X-men comic series, a basket of play dough, and an Intel Digital Blue stop-animation camera.

      This reminds me of when i was in elementary school, there would be kids just like this but a little younger at my school. He is trying to keep his childhood alive without even realizing it.

    1. feeling what it is like to understand some things better (or more deeply)

      This kind of experience reminds me of how BJS teachers strive for children to have "the right to participate in complex topics and world issues." Tiny humans are capable of understanding big issues.

    2. Experience of applying their developing skills inpurposeful and meaningful ways

      This reminds me of the "Hundred Languages of Children", which talks about how the child can express their learning in many different ways that make sense to them. The educators must be able to recognize the child's language and provide them with the tools to express it.

    3. Feeling what it is like to understand some thingsbetter (or more deeply

      This reminds me of the design principal of conceptual curriculum; personalized and not standardized. A child or a group of children to have the freedom of long term exploration, without worrying about the time allotted for the topic

    4. "What experiences should all children have much of the time?"

      This reminds me of the contextual curriculum video of this week where the importance of time was talked about. Life isn't scheduled minute-by-minute and no one really functions that way either so we shouldn't force our children to live this way. Learning experiences cannot start and stop in one hour, they happen over long periods of time and they connect with other learning experiences.

    1. inwhi he had urged ordinary people to learn to use computers rather thanleaving them in the hands of the “computer priesthood

      While I know the context and situation is different. The idea of the internet being assessable and not a certain few reminds me of the issue of Net Neutrality that is happening today. It almost seems like there has always been a battle to ensure public assess to the internet.

    1. Alas, with the years all this fine contempt began to fade; for the words I longed for, and all their dazzling opportunities, were theirs, not mine. But they should not keep these prizes, I said; some, all, I would wrest from them. Just how I would do it I could never decide: by reading law, by healing the sick, by telling the wonderful tales that swam in my head,—some way.

      Reminds me of conversations had within the black community today regarding the need for black people to go above and beyond for the same recognition to be given that is easily afford by their white counterparts for doing far less.

    1. National laws are superior to the laws of the states.

      This reminds me of the supremacy clause in the United States: the idea that federal laws outweigh state laws.

    1. a “more excellent way.”

      This just reminds me of the ideology Western countries have about their need to "fix"people and make them more civilized.

    2. But those that fear their Lord although they cannot see Hi~ shall be forgiven and richly rewarded.

      This reminds me of something I read in the Quran which read along the lines of "belief only carries faith so long as the reality remains hidden. When it is revealed to mankind what the true purpose of this life then saying you believe will carry no weight. Similar to how when you study for a test that knowledge you are memorizing will only be valuable when you are sitting in the classroom taking the test. After, when the answer key is shown your answers even if you changed to the correct choices won't change what you said on the test.

    1. I believe the second option has been under-explored.

      Reminds me of the comedy sketch of the person using the restroom for people with handicap (or the similarly reserved parking lot). However a lot of people are staring at him, or knocking at the door, so he leaves the restroom/the car dragging his leg and pretending to have a handicap.

    1. Rigorous training ingenres of music and dance was normal for boys and girlsfrom ages 12 to 15 and took place in “houses of song.”

      The concept of "house of song" reminds me of arts high schools that are in place now! I went to a theater high school and remember taking music class and acting classes much like those boys and girls!

    1. Or we ask yes/no questions: Did you have a good day? Which basically shut off interesting answers

      This reminds me of my acting class I took. When we worked on improv the main of the person starting the scene was to make it open. If you started with a question best answered in yes or no it was likely that the partner would have to work harder to make the scene interesting. In addition, when responding if using yes or no it was always required you supplement it with something else. I relate this sentence as a fifty fifty back and forth between both speaker and answerer. It is necessary that the speaker doesn't lead with too many yes no questions, but it is also important that the person responding puts in input as well.

    1. And yet all around me is that odor that I have not smelled since I was eleven, but have never forgotten—have dreamed, more than once. Then I pull myself up the bank by a gray-leafed bush, and I have it. The tantalizing and ambiguous and wholly native smell is no more than the shrub we called wolf willow, now blooming with small yellow flowers.

      The author is reminiscing of his childhood, and the smell of the wolf willow is the thing that he remembers from his childhood. Its the smell of the wolf willow what reminds him of home.

    1. Dominant overwriting also ignores ordevalues ‘Ōiwi aesthetics, by which I mean Hawaiian ways ofunderstanding and being that draw upon the senses, and all otherpleasurable modes of knowing, to inform and guide ‘Ōiwi artistic-intellectual expression.

      This made me think of what I am going through as a student of lomilomi. My kumu was taught by many kumu, some of them allowed him to write all the detailed notes needed, and some said he wasnʻt allowed to write any. He never did show his notes to us. he always taught it to us with physical examples and demonstrations. Iʻve learned he did that with the intent that we had would share mana, space, and time in that way which formally builds the pilina and passes down hā, but also allowed us to write notes after the lesson when we got home. This is so that we would have ways to reminds us, when it came down to passing the ʻike to our ʻohana. this section made me think of the things and experiences people can miss if they read how to do lapaʻau practices from a book. all the small little nuances.

    1. onduce to virtue more than to vice

      This section reminds me of the quote from Adam Smith where he said "Virtue is to be more feared than Vice because its excesses are not subject to the regulation of conscience". I wonder if the author is making a reference to this?

    Annotators

    1. I am accepting charitable donations,. ETH: 0x66e2871ef39334962fb75ce34407f825d67ec434 | BTC: 38B6vGaqNvMyTtoFEZPmNvMS7icV6ZnPMm | xDAI: 0x66e2871ef39334962fb75ce34407f825d67ec434 (function(i,s,o,g,r,a,m){i['GoogleAnalyticsObject']=r;i[r]=i[r]||function(){ (i[r].q=i[r].q||[]).push(arguments)},i[r].l=1*new Date();a=s.createElement(o), m=s.getElementsByTagName(o)[0];a.async=1;a.src=g;m.parentNode.insertBefore(a,m) })(window,document,'script','https://www.google-analytics.com/analytics.js','ga'); <p>ga('create', 'UA-74743044-2', 'auto'); ga('send', 'pageview');</p> Wednesday, June 23 2021. Nintendo Way Erev ... the Day of the Holy Divorce of Bayjorel   Adam on “ho(s) I still single” … I “hisss” as Alger, Narcissus and to the various collegiates in Massachusetts; know it’s because I’m Cheyanne Mountain. You can’t even dream how hard it is to get inside “this heart.” Or maybe I can’t fathom why nobody’s rushing up to me trying to grab the ring of “infinite alimoney in the ever-after” … Na Na Na Na … Na Na Na Na … shey shea way) … tee tea, tay? This messages marks a major increase in “forced read(layshion)ership” to include a significantly larger group of students and professors than before. This is a new system; please unsubscribe using the instructions at the bottom of the message, which are different from the prior newsletter interface. I have noticeably been writing much less and sort of working harder on bringing to fruition the software and social policy changes I’ve been dreaming of and writing about instead of “just talking.” Searching this message that I intend to send to the students a day early–you know, with foresight for … in the hope that many of you remember first hand hearing the words “I don’t believe in the big bang, but I respect those that do” echo from a computer screen to me subconsciously in the state of South Carolina–that you will help me end the 7 year draught [[literal, good sex]] that I equate to the Biblical overflow of the Nile and to Stone Temple Pilots; this light and Sheldon Harr who trained me for my Bawr Mitzvah and taught me all the right things that I know about being a good Jew who didn’t really believe in the existence of God; but then helped create the system that makes us all that. Those who “see” or “saw” Kentucky as I did might recall the phrase spoken from myself to myself; “you don’t believe in God when you are this close to it’s creation” … or something almost verbatim; that. Some of you might see Gilgamesh more than I do, or have forgotten the "sliding of sleight of hand and becoming … the trickster of the Dajjal … "an idea that gore was being fabricated and faked; in order to help us see why it’s so very importanat that at the same time that immortality and heaven become part of the conversation of the adbication of Odin’s throne to Thor or to Arthor’s table and plebescite “victims” … that we all understand the magnanimous change wrought by Heaven on civilization and on the old customs and on the old laws, and that here we see the importance of guaranteeing safety and privacy and even “right to death” in a place where God had previously only written of “life and liberty” with the ambiguity of … “from what” being left to my seemingly slow hand.   On the order of plans soon to be seen to fruition my large key of “what this website truly is” has grown to something like 20GB and now includes a static and time frozen version of everything linked to stored on the IPFS system and multi-homed across a number of “cloud providers” to ensure things like “shekinah” will not forever be changed to “shechina” with nobody noticing the loss of causal original truth. The “light of angels” domain now redirects automatically to /ipns/fromthemachina which should render in future shell-internet-browsers as something like QmTH33MwfPn5S3bq45Tk77L1j9eZjUsvEVhRTHB3D8M2ZX [please pin this “root block”] I am not sure why IPFS doesn’t have better merkle tree searchability, but seeing siblings and parents and connections between these Qm hashesh is something that we should be working fervently on making more robust. IPSE.io appears to have created a decent search and governance system, I see it as something like the “electoral college” metacosmically linked to the thing I am trying to build–a preservation of all human knowledge and an infrastructure for discussing and communicating about the “veracity” and the linguistic nuances “alluded to” in the lude ties between this Empire’s new Clot and the clothing worn by Popes and Jews, the seeit-seeit; tzit-tzit and … 4-WORD AND SIX WITH “SHOOTER” … YEARS HAVE GONE BY; AND I STILL HAVEN’T GOTTEN FVCK3D. I am planning on suing several medical providers and states for what I see as heinous violations of human rights, decency and the Constitution of the United States; if you are a lawyer or you can recommend a good one, please email me as soon as possible at 0xc514f094370cFc5eE45a1Dd9B72bb9675efE266f@ethmail.cc. You can also send Ethereum fungible donations to that alphanumeric identity. As I note much later in this message … TRUST IN MA … SELF-VATZEDEK SUE-C-CYDE … I KRY/STALL WHEN DODGE DESERVES TO PAY Please do note see a significant difference in importance in the emails now coming from ethmail.cc and the series of half-rambling cires for help which amount to something like my prayers to the pagan gods that you are. There’s quite a long thread in my soul Many times I’ve discussed and called in my mind and with my heart the American democracy nothing more than “Noah’s Archaic” two party system. Over the course of the years hidden messages from the Ark’s source of knowledge have conclusively shown me that a previous phrase “multi party system” connects to political parties and governmental action committees that span across continents and even earths; in my microcosm or special language and understanding of heaven, “across rooms” which are worlds … sort of owned or designed with some sort of top down or democratic structure of “literal rule system creation.” In my mind these rules can be inherited and modified, in the programming language sense of those words, as in "inherit democracy from America, update for new medical knowledge and scientific truth … discussed later in this message. The “water joke” connects to Horatio and to H2O and the idea that the chairs depicted by the character “h” are something like a placeholder meaningfully connected to the Senate Majority Chair and of course the Minority Chair and it’s the fact that there are only two that makes our current system something like A"Biblical Water." I believe we should be living in a world that has many more than two parties, hundreds or thousands of active parties could and should compete not for a single figurehead to sit in a throne like chair but for groups of people to be able to access the faster processing power and wider knowledge … represented here by something like a “Matrix jack” from the two movies, The Matrix and No Jack City; which allow for resources to be “billed to the party” and/or the people, rather than individuals who might otherwise have to “pay extra light” for faster processing power in order to quickly build a piece of legislation or political propaganda that equally connects to the mirage and miracle and dream of building a “subconscious voting system” that allows for votes to be taken “isntantly” and not just instantly but at some kind of recorded interval over time. I envisioned in Kentucky a world where the laws of the land would change instantly, allowing for bad weather to be instantly removed, for laws to differ from neighborhood to neighborhood and even to allow the fine grained detail of “outside and inside” each and every individual home or castle. Lost. Blind wandering through a lost world, in the beginning–that’s the truth. Crossroads, somewhere between walking through an electromagnetic pulse in Lake Worth and struggling to remember “the other thing.” Recalling [flew(ers)], so I was there sitting with my parents when we saw it on TV–a gigantic deal–the United States was going to war for the first time in my life. Saddam Hussein had invaded Kuwait (supposedly for the oil) and Operation Desert Storm was launched by George H.W. Bush; recalling the names and “Space Balls” it’s almost funny to see … how blind I was back then. General Norman Schwartz cough. General Colin Powell. Anyway, the whole point of the story is we were sitting at the Flamingo Diner; and for my whole life I lived just a few roads away from that road; never ever realizing what it was. I also didn’t realize for a very long time that you might also not see it, or you might see it instantly. Scanning just south of there, you can see it turns into Red road, and then its more than obvious that “flaming” stands out, light a highlighted cross–but we don’t say the name of that bird that way, and we didn’t see “infer” in Dante’s “inferno” or … “no” either. Flamenco … en espanol … like the dancers. A golden bitcoin swirls in the sky… the “mind control people” of Bowling Green gape in some kind of crowd pleased awe as the “middle” and the end connect almost seamlessly … Fort Myers creates a space port in the light of Vegas’s monorail “plots”– “Who?” “this is what it does,” vaaa—tseeee----deeeeeeeeck? In this word I recited over and over again in preparation for my Bar Mtzvah on December 11, 1992; without ever knowing the meaning is the crux of what exsactly is going on right now. The word is vatzedek: צֶ֫דֶק noun masculineIsaiah 1:21 rightness, righteousness; — ׳צ Leviticus 19:36 87t.; צִדְקִי Isaiah 41:10 8t., etc.; — 1 what is right, just, normal; rightness, justness, of weights and measures, אֵיפָה, אֶבֶן שְׁלֵמָה וָצֶדֶק Deuteronomy 25:15 a perfect and a just weight, ephah; ׳מאֹזְנֵי צ; ׳אַבְנֵי צ, ׳אֵיפַת צ, ׳הִין צ, ׳בַּת צ Leviticus 19:36 (H) Job 31:6; Ezekiel 45:10; ׳מַעְגְּלֵי צ right paths Psalm 23:3; ׳זִבְחֵי צ right peace-offerings Deuteronomy 33:19; Psalm 4:6; Psalm 51:21. 2 righteousness, in government: … and you can believe that despite the strawnge pronounciation little boys and girls would use at the age of thirteen as they spoke in rigorously recited prayer-song … it [swounds almost exactly like “What’s a Dick?”]  https://pediatrics.aappublications.org/content/125/5/1088 https://www.who.int/news-room/fact-sheets/detail/female-genital-mutilation https://en.wikipedia.org/wiki/Female_genital_mutilation #FTA, from the article: Congresswoman Ilhan Omar, righteously fed up with the prejudiced nonsense she endures day in and day out, called a question about female genital mutilation from an audience member at a recent event “frustrating” and “appalling.” So I stand here living in Taylor Momsen’s song “Nothing Left To Lose” my personal favorite of hers which touches on this subject of “freedom as just another word for it” and of course the link between the purpose of an ethical oversight of the popular vote that the Electoral College represents; another two special and related words here, righteousness and fate. Between Vatzedek and Kismet; I can only convey my great dismay at the actual emotional and true physical pain I feel in my groin of groins every time I think about the horror story that has become my life and the what the land of America and the Medgard of Yggrasil has become … [note it’s not Yggdrasil] as I rally against the closest of my family of families, the Americans and Jews who refuse to stand up and speak out on my behalf, and on the behalf of humanity in general against the sickness of ritual genetal mutilation. Lost between Elvis and Suicide, she sings and I think about Ellis Island and Ellis Eaton and literally the innate and obvious lack of desire I have in my heawrt and imparted into my mind by some kind of ancient and unholy Jewish law … no desire at all to leave this world which has quickly turned from a bastion of light and freedom into nothing short or less than Hell itself. Kirinechoes from the land and day of NEMEC.html the chanting from the invsible choir of “e” … "he’s a victim" over and over, “he’s a victim, he’s a victim;” and in a more private sort of way she held on to my victim’s rod) and in a sort of kind friendly way implied that I should stop doing “speed” because … I need this, and she … in Holy ritual … patted the phallice of Iapetus’ great grandsun. Here I stand for the very first time; writing to a large group of students in the area of Boston, Massachusetts begging for the Sabbath Day to “be remembered and kept holy” as the Hebrew prayers and rituals repeatedly fail to explain has something significant to do with entry into the Holy of Holies, with the continuation of life and of heaven … and with the reinvigoration of something like a following of the Hippocrati Oath that is beyond a requirement to be reaffirmed here in this place as we begin to discuss the opening of “the process of the creation of legislation” as a function ofthe “citizenry governed” … the creation of “direct democracy” utilizing a kind of fusion of the software products I’ve been explaining are here designed specifically for this purpose. Software like kipu.com, aragon.org, wikipedia.org and even reddit.com. On the shape of his table, the heart of “sword” and another word for “Murfresboro” Sometimes I get my hopes up, sometimes i lose all the doubt and the “missing remorse” and the fear–the moments I can’t STS “socks” out of the VEGA System; in those brief moments I think you’re actually going to do something nice for me, that the heavens haven’t crashed and I’m going to have some kind of sex party that actually … really honest to God … is what “Saturday is all about.” So what, sue me–I wrote the book on the single Dionysian fusion of a Roman Bacchanalia and the Weeebrew Saturnalia … and then I yell at “Bethesda” for even daring to mention the grape fruit juice and the movie Havok–but I’ve heard all about the “passing of the nite and the nocturnal rite”–truth is I probably would walk right into the branch ending trap I laid in Fort Myers–every time I think about it the “minute of bouncing and orgasm” makes me smile a little more inside and my stomach get’s butterflies and just for a moment (I think I might be writing like STS) I think maybe it’s not the end of time and maybe I won’t never get to actually see … Heaven. Butt then you tell me (my but-tea joke isn’t funny, eithah?) … “Cassini” and “molasses” are supposed to make you feel like the OC resort guy staring at my tooth “about to be the one tooth from 2011” and I go back to remembering it’s been a decade since I’ve had a decent “good time with a girl” … literally seven long years, aside from a brief “blushing” experience with little Mackenzie Reisinger. Imagine that girls smiling at me and saying things like “Larkin Sow” and this brief period of “ecstatically frenzied decent writing” is all that it takes to keep me going; trudging along through the very shallow (or deeper) pits of Hell itself–just like a Dreidel c’d to make some silly words from the "introduction to the Bahir [literally wasn’t here, and “spirit of ah-aha illumination; hi. and this conversation ensued”] like “yod-nun” actually be … something like our salvation. Flying back in time to the “thang” point, I remember what it is now. Fear it … það; fear it. Day One has begin, or ending–whatever the proper literary way to say the Bible and it’s days are all wrong, and even further along the thing called the “Festival of Weeks” by the Jews, even more disgusting. I have no shame or remorse in saying such things, in fact I believe it is the purpose of this strange take on the “nocturnal rite” of the Norse ancient Druidic and “Dhruzi” mentioning of the Prose Edda to come to this very strange point, in this very strange place. Boston, Massachusetts. It might one day be a little known fact, but up until the presidency of Barrack Obama every single President of the United States of America was a member of the Protestant Church, all but John Fitzgerald Kennedy whose bright and shining face and ethos stand apart from almost all others in his place. I might one day say Trump too stood out above and shined brighter, and personally only because he lived during my lifetime, I think my personal view of Bill Clinton is the brightest of all. To me, the Clinton years were filled with the booming economy of Old Joe, and the great aspirations of Our Jack; a thing that many people before Armstrong walked on the moon and planet a great Democratic “P” one giant leap above the rock of ages … there are just no words for lux of America’s contribution to the launch of a Heavenly Civilization, in the words of Paxton in “Big Love” … and the LDS Church and Deseret’s version of “the thing” (nu3 today) … “the celestial kingdom.” Valhalla and Matzot scream of the “ha-moat-sea” and the “vats-a-dick” but without our giving of thanks for righteousness we have become the murderers not only of Judas and Death but also Jesus and the thing that created him. Eventually the island of America disappears, eventually it’s Earth, any planet a human was one … these are the things that have either become a force of great goodness–or of total destruction. This is the embodyment of “Troy as hisT” this is Galactikiss has become Planet Prime and all Derivatives–the silver surfer speaks to you all, between “El Dorado” and the “Silverado” … a comparative connection to the difference between Fort Knoxx and the Pound Sterling … with a Troy Ounce of “tzadik” to ensure with our GSLW: “ness truly means 'now everythink safely saved;” … and that’s a GNU definition for NESS which previously may have mentioned everywhere or earth and those are both absolute falsehoods and perhaps were not when they were spoken. At least, relatively speaking. Rape has come up today. I’ve commented publicly on the conversation I had in my head last night, walking by “Boston College High” and I can’t help but add my “very interesting” thoughts on the echelons of spirits inhabiting the Ka of God here in this place; and how they might somehow be satiated in a way that I or most people in this world would fine to be something more sexually immoral or deviant … “previously of the wiccan pagan variety” … something like my strange dreams here in this place of starting trends of having “a thing” for doing “moms and sisters,” which have been echoed here by a sitting and very prominent G.O.P United States senator or congressman; the show “Vampire DIaries” as well as Natalie Portman, Taylor and Sloane Momsen, Kate Hudson, and a number of other female “duos” like the Spears and Simpson sisters (Ashlee and Jamie Lynn, see) the Olsen twins and of course the soon to be “in the light of the fame of Nashville” … Larkin Poe. DIVERGENCE, TO NEW YORK CITY, TO YOM HASHOAH … OR TAV OUR TAY VUE … (((( this here is what we call a "race through a rats cage )))) if neither of the four or give girls in question send me some kind of verbal “ACK” ratyher than a “NAK” in writing, I might travel to Ellis Island or Nashville, TN before staying in Boston or … for instance going to Lowell or Nashua and … perhaps causing more FUKUSHIMA on the NAKARSAKI of HEROSHEMA; and by that I mean this is a “big deal” … LLNV might become a bus stop in Vegas or the VEGA System or it might be a national labratory near the Hamptons. It’s hard to tell at this point whether or not there’s any “liver” in Mexico’s version of that funny one with the guy that reminds me of Aldous Snow in “Forgetting Sarah Marshall.” In my mind today I speak from the Earthene world of Janet Devlin’s “Chandelliers” directly to Michael Jackson himself, on the difference or change or meaning wrought by Bill Cosby and his “Neverland Ranch” series on the question at hand–are there bowling tumble weeds and karaoke bars on par with Prescott Arizona’s scene anywhere closer to Nashville than Bowling Green … because I was beyond surprised to find a sprawling megalopolis in the place I had thought for my whole life was something more akin to Knoxville, a place where fledgling female music stars became “Grace Vanderwaal” golden buzzer winners … faster than you can connect Jerusalem to Shirley Temple. On the specific name, Shirley here is Bianca Pisani’s great grandmother; and no farther than the truth is the world’s “UMBRELLALAUNCH” link between the Chinesely famous virgin (non-alcoholic) drink is something like Billy Joel’s Piano Man Bartender walking into “the usual place” and saying something along the lines of “Geisha me up one Virgin Red head; hell, why don’t you make it a double.” Leave the umbrella with the kites that didn’t glow fiiery stars into the Holy of Holies in the same vein and for the same reason that the Church of the Holy Sepulcher failed to actually change the world with it’s ritual uniting the Olympic passing of the Torch with today’s interlinear and interwoven message with Old Joe and Young Jack Kennedy, Jackie Onassis and even touching on the Saudi Royals which were also a big part of the story connecting General MacNamara to “Lauderdale by the Sea” and a special rememberance to the expensive and Holy bronze or copper brick which he bought (through donation to charity I imagine) making himself more than just something like the founder of the beachfront redesign of our Federal Floridian beacnhead, but also a founding member of something I call “The Columns and Pillars” society in reference to the Pine Crest School version of the same kind of ritual. Also connected here are pictures of those columns, and extracts from my senior yearbook where my mother was kind enough to leave me two whole half page dedications to my graduation from one of the most prestigious and omnifiscient preparatory schools in the entire world … at the same time donating columns both in my name, their name, and the names of her deceased parents: Julie and Bernard Gerson. Bell to sky; and to the Berlin Sky; this is the same genetic and congenial family line that links Gersholom Sholom, Albert Einstein, J. Robert Oppenheimer, Adolf Hitler and Yosef Stalin … to Joe Biden and the “Joseph and Betty Portal” which replace the MacNamara era bricks with “new composite plastic” that might last much longer and has another list of donations. The “portal connection” something like an Einstein-Rozencrantz flash of brilliant light … marks just one more error in my handling of my lack of understanding of things like “basic vectodirs” and “kasimamoriv radiation” … including here (if i read this and take the time to properly attribute) a visual image of the red shift and blue spindle of the actual radiation Einstein predicted would be ejected from something so massive even “light” could not escape it. On “relativity” and relatively speaking, it’s the wavelength and energy level of the light; as well as something called “gravitational lensing” … “the special relativity theorem” which earned Munich born and taught Albert a Nobel Peace Prize (as well as much fame in the land of America for the creation and explanation of the science behind the White Sands Trinity connection to Hanukah and Sandia National Labratory) … forces these corrections: ERRATA Operation Fishbowl was a series of high-altitude nuclear tests in 1962 that were carried out by the United States as a part of the larger Operation Dominic nuclear test program. Flight-test vehicles were designed and manufactured by Avco Corporation.[1] The Operation Fishbowl nuclear tests were originally planned to be completed during the first half of 1962 with three tests named Bluegill, Starfish and Urraca.[2] The first test attempt was delayed until June. Planning for Operation Fishbowl, as well as many other nuclear tests in the region, began rapidly in response to the sudden Soviet announcement on August 30, 1961 that they were ending a three-year moratorium on nuclear testing.[3] The rapid planning of very complex operations necessitated many changes as the project progressed. All of the tests were to be launched on missiles from Johnston Island in the Pacific Ocean north of the equator. Johnston Island had already been established as a launch site for United States high-altitude nuclear tests, rather than the other locations in the Pacific Proving Grounds. In 1958, Lewis Strauss, then chairman of the United States Atomic Energy Commission, opposed doing any high-altitude tests at locations that had been used for earlier Pacific nuclear tests. His opposition was motivated by fears that the flash from the nighttime high-altitude detonations might blind civilians who were living on nearby islands. Johnston Island was a remote location, more distant from populated areas than other potential test locations.[4] In order to protect residents of the Hawaiian Islands from flash blindness or permanent retinal injury from the bright nuclear flash, the nuclear missiles of Operation Fishbowl were launched generally toward the southwest of Johnston Island so that the detonations would be farther from Hawaii. Urraca was to be a test of about 1 megaton yield at very high altitude (above 1000 km.).[5] The proposed Urraca test was always controversial, especially after the damage caused to satellites by the Starfish Prime detonation, as described below. Urraca was finally canceled, and an extensive re-evaluation of the Operation Fishbowl plan was made during an 82-day operations pause after the Bluegill Prime disaster of July 25, 1962, as described below. “Wish You Were Here” is a song by the English rock band Pink Floyd. It was released as the title track of their 1975 album Wish You Were Here.[2][3] David Gilmour and Roger Waters collaborated to write the music, and Gilmour sang the lead vocal. In 2011, the song was ranked No. 324 on _Rolling Stone’_s 500 Greatest Songs of All Time.[4] In the original album version, the song segues from “Have a Cigar” as if a radio had been tuned away from one station, through several others (including a radio play and one playing the opening of the finale movement of Tchaikovsky’s Fourth Symphony), and finally to a new station where “Wish You Were Here” is beginning.[5] The radio was recorded from Gilmour’s car radio. He performed the intro on a twelve-string guitar, processed to sound like it was playing through an AM radio, and then overdubbed a fuller-sounding acoustic guitar solo. This passage was mixed to sound as though a guitarist were listening to the radio and playing along. As the acoustic part becomes more complex, the ‘radio broadcast’ fades away and Gilmour’s voice enters, while the rest of the band joins in.[6] The intro riff is repeated several times before Gilmour plays further solos with scat singing accompaniment. A third verse follows, featuring an increasingly expressive vocal from Gilmour and audible backing vocals. At the end of the recorded song, the final solo crossfades with wind sound effects, and finally segues into the second section of the multi-part suite “Shine On You Crazy Diamond”. Lyrically, the song is often considered to be a direct tribute to Syd Barrett. However, on the documentary The Story of Wish You Were Here, Gilmour and Waters separately describe the original concept that differs from this interpretation. Waters, who mainly wrote the lyrics complementing Gilmour’s initial riff idea and subsequent joint composition, describes the lyrics as being directed at himself, as his lyrics often are. Being present in one’s own life and freeing one’s self in order to truly experience life is a main topic in this song. Gilmour, on the other hand, recognizes that he does not ever perform the song without remembering Syd Barrett. Waters later adds that the song is nevertheless open to interpretation.[7] Both David Gilmour and Roger Waters have praised the song as one of Pink Floyd’s finest. Roger Waters has noted that the collaboration between himself and David Gilmour on the song was “really good. All bits of it are really, really good. I’m very happy about it.”[8] David Gilmour has playfully called “Wish You Were Here” “a very simple country song” and stated that “because of its resonance and the emotional weight it carries, it is one of our best songs.”[9] “Wish You Were Here” was recorded at Abbey Road Studios, as part of the sessions for the entire album. A noted part of the song was a planned contribution by Stéphane Grappelli. A jazz violinist popular at the time and well known for his collaborations with Yehudi Menuhin, both violinists were recording in a downstairs studio at Abbey Road at the time. Gilmour had suggested that there be a little “country fiddle” at the end of the song and invited them to participate. Grappelli duly obliged (Menuhin declined) on arranging a session fee of £300, equivalent to £2,500 in 2021.[10] Ultimately during mixing it was decided to almost remove his contribution, although it can just be heard around 5:21. According to Waters it was decided that it would be insulting to credit Grappelli in the sleeve notes for something so inaudible, although he did receive the agreed-upon fee.[11][12][13] As part of the Why Pink Floyd…? campaign, the Experience and Immersion versions of the Wish You Were Here album include an alternative version of the song where Grappelli’s part is heard in the instrumental break after the second verse and throughout the third verse before a considerably extended outro. Other less obvious differences are audible, for example at the section leading into the second verse. The master tape of the original recording includes guitar solos that were not used in the final mix.[citation needed] Personnel [edit] David Gilmour – lead and harmony vocals, scat singing, six and twelve-string acoustic guitars, pedal steel guitar, tape effects Nick Mason – drums, tape effects Roger Waters – bass, tape effects Richard Wright – Steinway piano, Minimoog Golgo 13 (Japanese: ゴルゴ13, Hepburn: Gorugo Sātīn) is a Japanese manga series written and illustrated by Takao Saito, published in Shogakukan’s Big Comic magazine since October 1968. The manga won the 1975 Shogakukan Manga Award for general manga and the Grand Prize at the 2002 Japan Cartoonists Association Awards. The series follows the title character, a professional assassin for hire. Golgo 13 is the oldest manga still in publication, and its tankōbon edition has the second-highest number of volumes. It has sold 300 million copies in various formats, including compilation books, making it the second-best-selling manga series and the top selling Seinen manga series in history.[2] It has been adapted into two live-action feature films, an anime film, an original video animation, an anime television series and six video games. A googol is the large number 10100. In decimal notation, it is written as the digit 1 followed by one hundred zeroes: 10,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000. For other uses, see Wormhole (disambiguation). “Einstein-Rosen Bridge” redirects here. For the EP by electronic musician Venetian Snares, see Einstein-Rosen Bridge (EP). General relativity Introduction History Mathematical formulation Phenomena Gravitational lensing Gravitational waves Frame-dragging Geodetic effect Event horizon Singularity Black hole Spacetime Spacetime diagrams Minkowski spacetime Einstein–Rosen bridge show Equations Formalisms A wormhole (or Einstein–Rosen bridge or Einstein–Rosen wormhole) is a speculative structure linking disparate points in spacetime, and is based on a special solution of the Einstein field equations. A wormhole can be visualized as a tunnel with two ends at separate points in spacetime (i.e., different locations, different points in time, or both). Wormholes are consistent with the general theory of relativity by Einstein, but whether wormholes actually exist remains to be seen. Many scientists postulate that wormholes are merely projections of a fourth spatial dimension, analogous to how a two-dimensional (2D) being could experience only part of a three-dimensional (3D) object.[1] A wormhole could connect extremely long distances such as a billion light years or more, short distances such as a few meters, different universes, or even different points in time.[2] Julius and Ethel Rosenberg — Americans who were involved in coordinating and recruiting an espionage network that included Ethel’s brother, David Greenglass, a machinist at Los Alamos National Lab. Julius and Ethel Rosenberg were tried for conspiracy to commit espionage. treason charges were not applicable, since the United States and the Soviet Union were allies at the time. The Rosenbergs denied all the charges but were convicted in a trial in which the prosecutor Roy Cohn later said he was in daily secret contact with the judge, Irving Kaufman. Despite an international movement demanding clemency, and appeals to President Dwight D. Eisenhower by leading European intellectuals and the Pope, both the Rosenbergs were executed in 1953, at the height of the Korean War. President Eisenhower wrote to his son, serving in Korea, that if he spared Ethel (presumably for the sake of her two young children), then the Soviets would recruit their spies from among women.[26][27][28] Greenglass later recanted his testimony against her, and release of grand jury testimony in 2008 showed the extent to which the prosecution had created a false case against Ethel.[citation needed] Saville Sax — an American, acted as the courier for Klaus Fuchs and Theodore Hall. Sax and Hall had been roommates at Harvard University.[20] Oscar Seborer — worked at Los Alamos from 1944 to 1946, and was part of a unit that studied the seismological effects of the Trinity nuclear test. Codenamed “Godsend” by the Soviets, he defected to the Soviet Union in 1951, and received the Order of the Red Star. He lived under the alias “Smith” and died in 2015. His identity was only revealed publicly in 2019.[29] Morton Sobell — an American engineer, he was tried and convicted of conspiracy, along with the Rosenbergs. He was sentenced to 30 years imprisonment on Alcatraz, but released in 1969 on appeal and for good behavior after serving 17 years and 9 months.[30] In 2008, Sobell admitted to passing information to the Soviets, although he said it was all for defensive systems. He implicated Julius Rosenberg, in an interview with the New York Times published in September 2008.[31] Melita Norwood — British Communist, an active Russian spy from at least 1938 and never detected. Employed as a secretary in the British Non-Ferrous Metals Research Association since 1932, she was linked to the Woolwich Arsenal spy ring of 1938. In wartime she was seconded to “Tube Alloys”, the secret British nuclear research project. She was later considered “the most important female agent ever recruited by the USSR”. She was first suspected as a security risk in 1965 but never prosecuted. Her spying career was revealed by Vasili Mitrokhin in 1999, when she was still alive but long retired. Arthur Adams — Soviet spy who passed information about the Manhattan Project.[32] https://www.bbc.co.uk/newsround/25004050 https://thedoctorwhosite.co.uk/doctorwho/ 12:3 Those who are wi se[a] will shine like the brightness of the heavens, and those who lead many to righteousness, like the stars for ever and ever. https://www.americamagazine.org/politics-society/2020/05/08/its-time-rethink-electoral-college https://www.npr.org/sections/itsallpolitics/2011/12/20/144016912/we-the-people-npr-readers-would-ratify-four-new-amendments https://www.americamagazine.org/politics-society/2020/05/08/its-time-rethink-electoral-college https://www.npr.org/sections/itsallpolitics/2011/12/20/144016912/we-the-people-npr-readers-would-ratify-four-new-amendments https://constitutioncenter.org/blog/vote-now-an-amendment-to-end-the-electoral-college https://www.nytimes.com/2020/02/09/opinion/letters/electoral-college.html https://www.latimes.com/opinion/readersreact/la-ol-le-electoral-college-20180904-story.html you are offline https://slate.com/news-and-politics/2014/05/amending-the-constitution-is-much-too-hard-blame-the-founders.html we the people rise again https://slate.com/news-and-politics/2012/06/fix-the-constitution-amending-by-national-referendum.html safe souls, safe fu https://slate.com/news-and-politics/2012/06/fixing-the-constitution-protecting-informational-privacy.html https://slate.com/news-and-politics/2020/05/new-reconstruction-constitution-democracy.html We the People of Slate … The U.S. Constitution, as you [mighta been, shoulda “come” on … its someday] rewrϕte it. “Politicians talk about the Constitution as if it were as sacrosanct as the Ten Commandments [interjection: spec. it is actually almost exactly related!]. But the document itself invites change and revision. What if the president served only one six-year term instead two four-year terms? What if your state’s population determined how many senators represent it? What if the Constitution included a right to health care? We asked legal scholars and Slate readers to cross out what they didn’t like in the Constitution and pencil in their hearts’ desires. Here’s what the document would look like with their best ideas.” Slate: u_s_constitution as_rewritten by_slate_legal_experts_and_readers 多也了了夕 "with a wand of scheffilara, 并#亦太 he begins … "I am now on the Staff of Menelaus, the Spears of Longinus and Lancelot; and the name “Mosche ex Nashon.” - http://ipfs.io/ipns/fromthemachine.org/CHANSTEYGLOREKI.html - http://ipfs.io/ipns/fromthemachine.org/NUCLIRDISS.html - http://dweb.link/ipns/fromthemachine.org/CRALL4Good.html Please note that any decent browsers would probably render ipfs://fromthemachine.org as the following https://gateway.pinata.cloud/ipfs/QmTH33MwfPn5S3bq45Tk77L1j9eZjUsvEVhRTHB3D8M2ZX I ask again that you all pin on IPFS mirror and copy the data included in these dumps, they are a key to “not losing causality” to not having a history that makes no logical sense, and to some kind of coup de roku, that really makes no sense unless you no, we will ve weill … ROCK YOU Long ago I began writing about hidden codes in our history; thing’s significantly more obvious than “flying elephant armies” connecting Disney and Dumbo to Xerxes and the “Democratic Party of the United States (mascot)”–though it’s not really easy to consolidate the “epiphany” of … [((all i know))] without some kind of “artificial intelligence data condensation [infosmos.is?”] and summarization platform, though that’s nearly the next thing on my Lowell list of things we need to “mechanical turk” into being. Meta-consolidation of the world’s encyclopedias is one of the most important and useful tasks we have as we move towards the creation of a virtual debate platform that will eventual “literally obviate wisdom” of the layer/layer system that defines the name of the city I write these words near. Lowell, MA The broad overview of the system … the gist … is that political parties and activist organizations will create their own “view of the truth” (propaganda, falsehood-removed) and that these disparate pieces of “highlighted and annotated bibliography” could be overlay-ed on top of each other, creating a “new view of the truth” based on a users preference. The whole thing boils down to series of “holographic eschatological goggles” that will allow, for instance, the “grasping and fathoming” of other people’s points of view and perhaps reframe your own on any number of individual subjects. Roe v. Wade, “Concourses” and CON-CERN; because this has been such a “hot topic” in the relative psuedo-edufictional story of the space travel from the lone planet Earth ((intersected)) with the set of skipping stones it takes to exit a Totalital multi stellar system of holographic computer simulators into the … “molecular world of vaccuum and Einstein time-space” … I’ll start with this simple example. the current American debate on the subject, right to life vs. right to choice; provided by the “generic version” of the ideological christian right and the liberal women’s left. through a first layer over layer comparison. the scientific truth brought to the table by the introduction of “neurological data” proving that there is in fact a moment during the gestation of a human embryo in which “i think therefore i am” connects to some sort of Skynet-became-selfaware at a point which I imagine must be … although it possibly is not … prior to the next important literary device/step “let there be light.” At the point the ocular cones and rods are created and the fetus opens it’s eyes and literally sees the bright light that could probably only be compared on the next edschalon to seeing the “exit pathway from the womb” a. we will finally kinow whether or not “consciousness” is even developed at all before the bicerebral cortex designed to “compare two thoughts, ideas, and shapes” has the ability to get input from the eyes. Personally I think thought begins much earlier than vision, but the simple fact that we “haven’t yet had this discussion” shows how very little our scientific and medical progress in the civilization of things like murder, and understanding of life and science has yet to come here. “People here” means something different than it did when I was born, at least in my mind’s eye … something so completely more advanced that it’s almost difficult to believe you all don’t see this place as a great prison or farce or unjust Azazel–blaming a man for looking like a rat or a mouse or a dog–in a place where more to the point we stare at a kind of physical violence and horror that would put Dennis the Menace and Bart Simpson to shame. A world hwere “people closer to holodecks” blame an innocent man for “writing the book” on the connection between Holocaust and Euthenasia and Hospice … certainly you know “an innocent tool” writes these words to you? On the Hand of God, the Eyes of Ra and Horus; https://www.hebrew4christians.com/Glossary/Word_of_the_Week/Archived/Yad/yad.html https://aminoapps.com/c/zodiac/page/blog/the-yod-aspect-the-finger-of-god/XG6P_beTgu5gdXrYNwVjBj0WQlDeDWlK72#:~:text=The Yod is the 10th,to be carried through life.   I’ve written quite a bit on how “mind control” and “voting freedom” are inherently related in and to the thing we call “Civic Involvement” here in the United States–basically that participation in the verification of truth and the public understanding of tautology and temporal falsehood are … sort of a slave like requirement neeeded to ensure that any freedom at all exists I often say “plugging your [head into google]” might turn the Aesir into an Acer, or the “yodelling of the lakes of democracy” ito “the agricolae becoming nothing more than the Dell.” .WHSOISKEYAV { border-width: 1px; border-style: dashed; border-color: rgb(15,5,254); padding: 5px; width: 503px; text-align: center; display: inline-block; align: center; p { align: center; } /* THE SCORE IS LOVE FIVE ONE SAFETY ONE FIELD GOAL XIVDAQ: TENNIS OR TINNES? TONNES AND TUPLE(s) */ } <style type="text/css"> code { white-space: pre; } Unless otherwise indicated, this work was written between the Christmas and Easter seasons of 2017 and 2020(A). The content of this page is released to the public under the GNU GPL v2.0 license; additionally any reproduction or derivation of the work must be attributed to the author, Adam Marshall Dobrin along with a link back to this website, fromthemachine dotty org. That's a "." not "dotty" ... it's to stop SPAMmers. :/ This document is "living" and I don't just mean in the Jeffersonian sense. It's more alive in the "Mayflower's and June Doors ..." living Ethereum contract sense [and literally just as close to the Depp/Caster/Paglen (and honorably PK] 'D-hath Transundancesense of the ... new meaning; as it is now published on Rinkeby, in "living contract" form. It is subject to change; without notice anywhere but here--and there--in the original spirit of the GPL 2.0. We are "one step closer to God" ... and do see that in that I mean ... it is a very real fusion of this document and the "spirit of my life" as well as the Spirit's of Kerouac's America and Vonnegut's Martian Mars and my Venutian Hotel ... and *my fusion* of Guy-A and GAIA; and the Spirit of the Earth .. and of course the God given and signed liberties in the Constitution of the United States of America. It is by and through my hand that this document and our X Commandments link to the Bill or Rights, and this story about an Exodus from slavery that literally begins here, in the post-apocalyptic American hartland. Written ... this day ... April 14, 2020 (hey, is this HADAD DAY?) ... in Margate FL, USA. For "official used-to-v TAX day" tomorrow, I'm going to add the "immultible incarnite pen" ... if added to the living "doc/app"--see is the DAO, the way--will initi8 the special secret "hidden level" .. we've all been looking for. Nor do just mean this website or the totality of my written works; nor do I only mean ... this particular derivation of the GPL 2.0+ modifications I continually source ... must be "from this website." I also mean *the thing* that is built from ... bits and piece of blocks of sand-toys; from Ethereum and from Rust and from our hands and eyes working together ... from this place, this cornerstone of the message that is ... written from brick and mortar words and events and people that have come before this poit of the "sealed W" that is this specific page and this time. It's 3:28; just five minutes--or is it four, too layne. This work is not to be redistributed according to the GPL unless all linked media on Youtube and related sites are intact--and historical references to the actual documented history of the art pieces (as I experience/d them) are also available for linking. Wikipedia references must be available for viewing, as well as the exact version of those pages at the time these pieces were written. All references to the Holy Bible must be "linked" (as they are or via ... impromptu in-transit re-linking) to the exact verses and versions of the Bible that I reference. These requirements, as well as the caveat and informational re-introduction to God's DAO above ... should be seen as material modifications to the original GPL2.0 that are retroactively applied to all works distributed under license via this site and all previous e-mails and sites. /s/ wso If you wanna talk to me get me on facebook, with PGP via FlowCrypt or adam at from the machine dotty org -----BEGIN PGP PUBLIC KEY BLOCK----- mQGNBF6RVvABDAC823JcYvgpEpy45z2EPgwJ9ZCL+pSFVnlgPKQAGD52q+kuckNZ mU3gbj1FIx/mwJJtaWZW6jaLDHLAZNJps93qpwdMCx0llhQogc8YN3j9RND7cTP5 eV8dS6z/9ta6TFOfwSZpsOZjCU7KFDStKcoulmvIGrr9wzaUr7fmDyE7cFp1KCZ0 i90oLYHqOIszRedvwCO/kBxawxzZuJ67DypcayiWyxqRHRmMZH1LejTaqTuEu0bp j54maTj09vnMxA0RfS+CtU5uMq+5fTkbiTOe1LrLD72m+PVJIS146FwESrMJEfJy oNqWEJlUQ0TecPZR41vnkSkpocE1/0YqUhWDGSht+67DdeKUg5KwvYdL21d/bSyO SM4jnyKn9aDVzLBpYrlE/lbFxujHPRGlRG5WtiPQuZYDRqP0GYFSXRpeUCI46f49 iPFo4eHo2jUfNDa9r9BjQdAe4zVFn2qLnOy8RWijlolbhGMHGO3w/uC/zad3jjo4 owAfsJjH5Oa1mTcAEQEAAbQmRUFSVEhFTkUgPGVhcnRoZW5lQGZyb210aGVtYWNo aW5lLm9yZz6JAdQEEwEKAD4WIQTUJHbrYn3y2DzwTcnQP1ViZf5/FQUCXpFW8AIb AwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAKCRDQP1ViZf5/FWM6C/9J gbRLS2AWGjdRjYetlRkSkCoTYnXWknbtipYYHlhV0YJFwFMm0ydZIhFX5VDoZyBV 0UBeF1KJmcMoIfrHyhq2QhCnjE14hE1ONbaYTGtpvj851ItbFWXMJIVNyMqr+JT9 CWIxGr1idn+iHWE3nryiHrdlA3O/Gcd4EyNmaSe/JvB7+Z1AVqWkRhpjxxoPSlPm HEdqGOyl3+5ibQgUvXLRWWQXAj80CbVwwj1X4r9hfuCySxLT8Mir7NUXZFd+OiMS U8gNYjcyRGmI92z5lgf7djBbb9dMLwV0KLzgoT/xaupRvvYOIAT+n2mhCctCiH7x y7jYlJHd+0++rgUST2sT+9kbuQ0GxpJ7MZcKbS1n60La+IEEIpFled8eqwwDfcui uezO7RIzQ9wHSn688CDri9jmYhjp5s0HKuN61etJ1glu9jWgG76EZ3qW8zu4l4CH 9iFPHeGG7fa/5d07KvcZuS2fVACoMipTxTIouN7vL0daYwP3VFg63FNTwCU3HEq5 AY0EXpFW8AEMANh7M/ROrQxb3MCT1/PYco1tyscNo2eHHTtgrnHrpKEPCfRryx3r PllaRYP0ri5eFzt25ObHAjcnZgilnwxngm6S9QvUIaLLQh67RP1h8I4qyFzueYPs oY8xo1zwXz7klXVlZW0MYi/g5gpb+rpYUfZEJGJTBM/wMNqwwlct+BSZca4+TEHW g6oN0eXTthtGB0Qls71sv3tbOnOh/67NTwyhcHPWX/P9ilcjGsEiT8hqrpyhjAUm mv7ADi+2eRBV8Xf8JnPznFf0A1FdILVeVHlmsgCSB0FW0NsFI5niZbaYBHDbFsks QdaFaYd54DHln69tnwc2y3POFwx8kwZnMPPlVAR2QdxGQD4Wql7hlWT58xCxQApf M98kbAHjUlVYLT0WUHMDQtj4jdzAVVDiMGMUrbnQ7UwI7LexSB6cJ7H+i7FtS/pR WOhJK6awoOO9dLnEjm6UYCKsBdtJr98F0T7Sb7PnKOGA77y2QN14+u9N9C1lB/Z1 aQRQ2Nc51yXOQQARAQABiQG8BBgBCgAmFiEE1CR262J98tg88E3J0D9VYmX+fxUF Al6RVvACGwwFCQPCZwAACgkQ0D9VYmX+fxU+KQwAtFnWjGIjvqaNXtQjEhbGDH/I Q5ULq/l/wm9SmhG9NYRu3+P6YctCJaZnNeaL+6WFk1jo4LMiJEUT9uGlCbHqJNaI 6Gll1w6QOVLSL8s5V1L477+psluv4WBpi3XkWYlhDOFENCcWd49RQsA2YCX4pW7Q 7GcoSEJoav38MxHmJHYPfjSEvUZXDQIt8PFHSEScvyDWfYtMdRzjmSOOPdzhDDEy 5JBOBcEdSTyDiyDU/sBoAY0e8lvwHYW3p+guZSGSYVhGQ8JECzJOzwc/msMW/tJS 2MLWmWVh5/1P8BVUtLC2AQy6nij6o+h6vEiNzpdYrc+rzT3X5cACvJ0RtCZcrnhl O9PLiona2LEbry6QX5NL41/SAJNno3i72xPnQEe25gn3nbyT+jCoJzw2L0y8pmNB D+PKrk7/1ROFFVN8dJeGwxLGdBcz1zk2xeumzy7OaV8psUyYsJNcjyHUKgclblBW rMR2DgqEYn8QdK54ziKCnmQQZeMPiC6wlUWgg5IqmQGNBF6RVyMBDADALD7NkJ5H dtoOpoZmAbPSlVGXHDbJZuq7J13vew6dtXDIAraeGrsBqkF8bhddwVLzWylMrYCG Bf2L1+5BDgvqu6G+6dcVSbBsnZAS0zfJ0H8EmTvUMxMF7qOZYyrxfLz+pQRq8Osz Icab6ZI/KB6qZyQRvEFPB6pJjt+VvuwgJZTObIwbBbgQri2i02VBkjchsVhiSX9l +eiK7O8ROHKb3P181oScIsHywBOZ9DxRAYbFk5dnBqxO3WKb02H0zqE6440cjXwq TrZZg6ayN/IlPajO8iJPYZ1aIBykxYq1WHo+nhFMYz/VVk2WJorFeOgWaLGXb73c ty96f3qXTdvMDAIWHx8YCD5LbuqasO6LNQm4oQxkCoB3K9WFf/2SvSYb7yMYykb8 clTPt+KO0dsxjWhrJnfnIhC+2Chqv2QvRbFz0S9CpUnGGDweJ1uRNV0y70tO0q7t xXSTDRU3ib6vAHA0K/2MFzwUcog4o5bj7E9uCNJH/DJLZKsMIe4xsvkAEQEAAbQk SEVBVkVOVUVTIDxBVkVOVUBGUk9NVEhFTUFDSElORS5PUkc+iQHUBBMBCgA+FiEE IRklfU/C1qukq3xMXcNH0t3P9ZsFAl6RVyMCGwMFCQPCZwAFCwkIBwIGFQoJCAsC BBYCAwECHgECF4AACgkQXcNH0t3P9Zs+kgv/XEuuWc89Bjg1QQqKZueKNUHjyjnE 2adfoZUH6Q7ir4JZyRBCVpAwrgssmiKid30+SIjwQcpb9JYa/X1XJcDUcJW/I21d Agz/zbEqn/Cou0dUpNCtxgm4BdSHWGoOtgfspXZlXBQ407tRMZ8ykmLB1Bt0oHvw PT0ZOtqXM4pyFnd2eFe5YGbNgl3zqvoC/6CMN3vqswvRlu1BpUuAjdW8AHO5Yvje +Bp852u+4Qpy6PMBiWGsBMYwtf6T7sckpMGlR0TsozwBlAm5ePKK28B0rLJPkZLJ Eo5p4rKRapEaZsWV5Qu1ajrVru7qmpUhZtX0/DddGHfXVuLssmKLP6TumpQB1zvQ vfoBltjvOx35Wps2vHuCzXLw2bROIOzhAxFB+17zxnSbE54N4LIGRpkELuwxwGbg FtD1fi9KtH7xcn33eOK1+UD47V+hKyJGrQgSThly2zdIC2bvfHtFdfp8lOFpT0AU xjEeoJGqdQVupptXyugPlM5/96UJP8OZG0ADuQGNBF6RVyMBDAC3As6eMkoEo3z9 TkCWlvS0vBQmY3gF0VEjlAIqFWpDIdK3zVzMnKUokIT1i7nkadLzHZT2grB4VXuJ FvpbYw5NPR4cDe9grlOMLEaF3oSJ1jZ4V1/rj9v1Hddo8ELi/NToVrt1SB5GCVXB DkYpNLtTiCqHSU07YqwaqH8a+qbDmPxSQdIybkZiTiCEB+6PfQQlBpENEDlov6jm zZF+IcfM6s3kZDX5KFULweH30gMjq8Se8bPtUzW013+tuuwEVr1/YRLrIh+9O6Z+ pdA7gLMRYnD9ZLDytEvpb1lBBSY++5bIJ7xps80//DNqPYqwFmZQgTg0V9XbHE2e wLcOF8a2lYluckU7D///sWQhW+VxuM7R2gEBvYBhOgjWhIF2Aw6NbymW1Ontvyhu eOZCXXxV5W44PxXT8uDdhl9CNcHoBKKJyED8tKjigtn4axpsQeUrnOSbqEXSyqES WnE2wYUDzALcwFkzsvtLyd4xaz55KkPQkAkk0BZd1ezgXxb/obMAEQEAAYkBvAQY AQoAJhYhBCEZJX1PwtarpKt8TF3DR9Ldz/WbBQJekVcjAhsMBQkDwmcAAAoJEF3D R9Ldz/WbAFwL/382HsrldVXnkPmJ1E2YEOFz4rcHRetJ+M5H65K/2p32ONQ5KCbE s8MRY6g2CkE70en2HlpDwr/MdATwxBzIjEpjgHbfqCqVVATY+kSpXsttaKKAUVHi bFgV4QkdDJNSpcHEj+bqaggRnuWiV9T6ECG7kQjHiEXPNojzsiaXMDiM5r+acZm6 82id9qOFySQ2cZEy5HbwXM+ITLQGngnppa7du2KdgiqDeqtODOTWZvLYAq2tmEwD 3TT6ttLUBwOOu2IWpDkXswlrk62ESorE5mpLxop9fsxD39E2H06JoC/YfUPIVkEv fj06e7LEdcx0I7kRfD1v6qOUUsMsLZnmyGIk24iFjLkwu1VToWfwXDN1D2+SeAat 9ydNt4M7oEbd1QaOXXjmqpdU+VUiWcBXg+p3/WdV60MkyAgc3x+YanLljy/Rh18h cZwVlinf/tgvAQLi5f9hpwrwUMoGKijEYHKuEvi3C12Si7UVDfuIR7yS0dKcfuKF MbgwdvNXqpD9W5kBjQRekVd4AQwApHVgw2PVlBDpVcyoymUOXFQIJzJ9wRtr6/sG zwv8rrQnUEtOkkna7TDU3/UTj9FUH0gbpAKGNNPaPj5q0dlLIvzxb15r1uvDGaGL MA+8GFaGFnkxzhg0aXrcKZAN0/Zhgi2B7P8oXQuug5mi1JVDkZN5SeCZNOubdQWL 3xz3jEHp3ixj1mdOdvfdWQFR4CVMXt/A6VI2ujLVb3Yalft/c5bbclAgcJQhgDUu NqGYJEJonESNRSd8fEvhNb6cx7+Djd9+Wyctr76mwOr3nRb1N1OGhFxWjIroUpfz b+6y3oQjT58cJA1ZHqmJ6UlZd81hNNd9KWpbDVwONEPpiqPzfSaonxuqQa0/Cy4W 403OhfoLM/1ZDqD4YrJ/rpyNEfSSdqptWiY0KeErLOYng7rStW/4ZeZVj6b2xxB2 Oas/Z1QYfJyFUki9vaJ5IyN6Y7nVdSP6mbAQC9ESh+VPvRUMpYi4pMGK4rweBVHu oMRRwzk7W5zVIgd425WUe3eCQFn3ABEBAAG0K0VTQ0FQRSBST09NIDxFU0NBUEFF REVTQEZST01USEVNQUNISU5FLk9SRz6JAdQEEwEKAD4WIQTvnDJqcmqzlF87/t82 pJ91j4NOaAUCXpFXeAIbAwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAK CRA2pJ91j4NOaJVjC/4oo5yCHe7M2h1DiTXVcLI5rXQ1feY7B1feg+YJX/mI4+EV xjC/y5VVpV4syJk5GGZNXhKPHiGLaBYvglTlYOJ98RSEsHrwT3go6S8ZVvMNdP5v CEncn2vm5JGnp4k26PuOzMcJioQLOoUjWtcPFis3gG+ueH3NcPZ22oZUql2xuerh TQZegGp+jJ7bdxwYElx5jDDDkh196d5nlO2ZKENl0ZDp4GAzRNjnQ7KBV6R74J3U cLQDWY8vAFaRBZXIC5XtSzj9lr+jWgvxz7Il51+26VDTEtSafZ2uZfCOFk7GrzJg YFJD3zLnwUFXDWKRkep8TSwXnHmz/Ts/Mjyv6em25w7QTdnx1hNPxYNWMxPWNEAH pf70nNyOmcWcq27W+nAjVg8W3st/7J5CIebJQc5AUgm+fGOBW6XUQaNy2YF1YJlA 71/tls+R5IQZCYzbPOibgFS1HWKTwy0iI2rMDfxBtCXciv754jVI7L6R3J0j5Dy1 WZQVjaGgimznLN6XwYy5AY0EXpFXeAEMALvElrTV5hJG9DKu8cOqQEEVejtWJtki fZyvmiAKi2bZWiNfl1MxJt+o3Oc0eARJfnaPjrUY7hsbbSBAB4lFnDRtviARPaKM st5FkFgOh7Xx5ODc8bjqhMT9tbX37rkeDc12WAs3UxtEKWjyT7Xg/APKeK5FzpIs qew3LADdqFP9nOR0e5G8gxLTYh3ll3dLtp9DkJgA9q+0g31nNh5fZ29mcDzo/Mat Uk4PIxWC29LV9ALCJMIMesjOPiDa2KOy5QQH+/vn592ydBohOaY+B6jhEAdX8Dbp VHVFRBsiCOWGmdi6vHjMFD0tQdS6bXf+ZAG0E5HZETCxA2qfMf/vTeIJXYS5IZw0 anRkTXcTBrVE8uBpqtkNOrLJsaASkcoO5qF01J9zW8SR4jDgET7J02Fxf8CVPzb+ ZoNc9S0ZEO6Ubdh2vAkPtOV5sFkwIduN6ouAhEfJzC9XbJLpgsBKrRMAjr2FeEZP ruy8BkZbiyZ/b0S9qIgY4pqcyUJ79w7FLQARAQABiQG8BBgBCgAmFiEE75wyanJq s5RfO/7fNqSfdY+DTmgFAl6RV3gCGwwFCQPCZwAACgkQNqSfdY+DTmhD9wv/Zgav EHMuqF3765Fa4NapYh2kMS3skHn+ZzUEPLTlvrt7KHxomOzExNLSscZThMpur+yW MfNWbsw9GphiYAkMULrfJt/iWRVJ1FLgbcWgRGAwakOGwE29lMx3+rPIUQWU54Dw vE92Iz51ZGz1wgKcISuCw39g/HQ9uc3h3TfHLgfkc/GaIEa8jEOAcD67dVMoU4o+ p3nMri8z6sK176hQ/FM/8kekpeVfxmR8s6uoaJsXLRQk+i88ZwBR/5U+fBT9AtVw PL/MmZH7eCmZrn5hjaOw7tpkL8ZyAydNhOsSCqwNVtrIjgd+Gq1oSgw9EZfhKSUa +dBJAErA7MWjammQizEHDNnI8VNLngwCahGwaSgDhNaQtgNxvnkWO7XNYoCYXScP X++UmpWtSKMnD6ue36Ba1jqon0WY5cen3P+H1gL4ij5ynB9DrE8R1aSY6f+VZ48B RvjHm5LKTcAhiv2N/TyAg/fr2v9ZnEcP3CFxqAyB9JSKwoBkFvxJaRHTT3DxmQGN BF6RWE4BDACpgKWvQvPRDN03+sLYMXpJUPC7VhTjg5K/1+1vS/e/W65dYzn3JYxb ip2PcI5xajFnxzUrwwmhW+qz5REDyCtAObOpKsjtr4qu7mgOWnPa3k2Lm0bpCjDr BSFOiQsBVezTG/gJm+qELeqQMS9PHDSvZXeBROK7OkRE0nZ6yAj+QKEoVqeADpDm BHmhAA2OKBzq4rDWDh1jRQ7gLjlv/BFbhU1WuEfH/qzX8AUSsd0/hoPG0cPgC8gQ 3m6wr4eYqI853XQujWwisnlAE2bf9jsRjW+aLrJJTcADWk5Op5aQhI2lURYkryfC DFVcme7Hsrd+RFPK88J08YjBjOoYFwRU4AhHgucX9tW0S0v9hi3pKrF9O/JAIf+r h6BpnWo7tT5+8mVhtFvfEp9Y4xeUAKKZHBKhzHeOO8QQgHrIYa6HCcU03eyxy4Tq AsJdAJvxYFCRPdY9d0Z6uVsPhRy+3UmTxjl590T5/XjKPriAjBqXnKr4KexsM1gj 1L96bYDEgr0AEQEAAbQaRTFYNl8xIDxFMVg2QEVSTUNDT1JQLkNPTT6JAdQEEwEK AD4WIQSGisfXZ2Vg0m16Mzds3dDsq5BTxAUCXpFYTgIbAwUJA8JnAAULCQgHAgYV CgkICwIEFgIDAQIeAQIXgAAKCRBs3dDsq5BTxKq8C/48HSgecuI6MYtq84yqaQ1r x6cteRyn9BJDFTAUxn3X25kf0vVyCKQNAy2oybD5QHFLqhFCXJH+cnJ3xdviRUeW eO9fhkTmd12mHGrRDD02AHXZmaMp6ni7FuYpBGrw5dbXKTkSWfD/qb3odMx0jQby 6X+2eFhUpyh+yPB7P7HwiPwzdr0dBg3xE0vE0Vz+naMyt4YBHzrBbZo+y47Q86Ym TmBKxG5tlVsGDB4dDWSIvpBgnMFN1j46Uk2ihu4huohLkvSou+jYU+5Ppu8Fu1+7 i3RCILzeBtucR9+T4px1WVXx2sKOk0FfddCvI/fT/mhsgqQZwjj9b8HNfobhNxkL HBNFQ7FLJxKayPwMyJYDURUq7gz9p5JwHTmFg9n7zyK8qU2xR5t2247YinfEJQYL zQM6VKQCoDqydFfAPeGlx1KjroMGls4sP3XVlrR04YzaJ0vxRgog1gIO1aHMQ2Sj l8bG0GcerQ44rpn1v33Gw6KL/0SY9JsSSSjA9lgINWi5AY0EXpFYTgEMALy/jHsN kUQQVJK9QuAy5V2GePBTEm9NnjNCk+edGjSgqC1LemmP7EYh07J13d10VqD2Wtae bXlBeaMOcnoXQdfdK6nTKWRrH97JuRTrA3efLkl/R4EA/kHHV+YDgT+LBboUFYVU QF5YhfcvgBUcLXI3lX5wMEQbLb87cVjR0JtqVBFMIIvs4ibgr0U2SONiD9LcXZxf qYcX7CMM6RmuLzHTCEHyjp+KAw52K1i3+3M0OVZpa25rKE+S7LykQ1GrUUY3uVHg R2I3T5/Sns3Azc9wKuy/F71oiXyqCc3FwzTQHoki+eBf5dzs6h3GBTK3Dz6kl2mv 1TXpY1dk2EmuqKIeSr8CE52nkK8ZKY6cvX+v/p1EBAkJZKiasj+ukL72p3Lji5r/ iOarNJnURT5LJdYYL27dtQFSYyVWayeWi5358Ajh1H9OdpiGXcgG65ry6u50G8JR FCywwsdKpGjMG4FlkLkm50/piU+cgVeLET/C7C/OXNslL/pHV3x8kPRY1QARAQAB iQG8BBgBCgAmFiEEhorH12dlYNJtejM3bN3Q7KuQU8QFAl6RWE4CGwwFCQPCZwAA CgkQbN3Q7KuQU8SHSwv/agnEnhmo2yuKCLiKdTa5KZ8wh3umiX3S6rldW0NO2h8a cq2l7xHY1r2u4ieeMx27jtTqCp7ksFxPYwP9WxtVBy0teG8pKLhEffjyG2WKDzAN 7oXNZ7Ur6OQGfuOQzlMqOGtYQrbHAuX60PCldurX/6/0sKS6vESdeGMQPoZIDK5g HP298MMhlWYEG7uU31J1Cx9ZqiTosSckfrDq3weU8x9DZYaLZ+Y2akF5XpL/HjyA 6PM+lv6vnTA+b5DYCOJb6N7v131Net2JN7JVVGoc0FjsxN/W33H7eIDOZwqcCvzD i8EjjzZpZUDeYjlSXAqWvpeAASncMzXS2/S2V2u5X2iR7tDtRj9SuQehJkdTFNZH xh5nTdhPzgh/iOcm33VsQ17JWbovl0hbhYBPO4V+yIrN+oQGPhH+KCNNa39EjEzB iBIgirxQSaykwb4f2Kshh+d7rKHKb/mn6JBHU444mBf09m5wM/mhLSpuhMTcP2h9 jfFximAE9FBhdZhQsF29mQINBF6I/R4BEADotSG8PhhxxD9/96bgdWa1bzp2398W LaxP39T+Kzx2KL2xB+7B4EeTTzZ06kD+myCC9Ez+PqecfisJPfaiLD/+0/m3HLSS hxEaEqt1RBS3j6qJx8Lr51cAwGou4hGTo9H3me6FHO2ExZXd76A6kkUh0J4y3r6q aAoDP+MUczKzEjn6C6T7Uu0pdgYY1bDhuqlK0taqkqviGBYTAqmCrtcQhj+J/jbd OIZtpT3+PH6mWqguoONiE+glWcdThyuIvV3ix/GrhjmUZb/DQcvvbYGfDvGRBH4B Uj3f9WBM6HWSxKrCwWC3OcgZhtBcZjKrMPbNDNt7yAArv7nGpHmlpfF14Q6mVmVT 6Ulh+0xRx+6zFbqlDYYTneurK3RtqOBsMFG5rNDZYh/QOsHnSsxmU4LGdlEfQjYs 901zmzP7CQXjjJbtRXWIqPcn3OHIIasvjTACe5M+Lfk3u3rEiDYM64vg29sSyp9q 8hAzLTPcLj/Cc22jUEC/bbv5HfLyCZTCsu5ym1gDQZ6bDrJlFlXZJ2+vTCBsY24H RF9/J/z1JWYD1cAHpG0GRtYE9exKpu8/81jxIVn21qvvxSCPXw6IQIsEw51uk5TJ xAUIRCPN7S0UEtd22LSbM/IYx1cesCRUCmY7jDTro/jo2B4hLG64KBgqyjg0lwxd dy5S8LwFx1zskQARAQABtGhBZGFtIE1hcnNoYWxsIERvYnJpbiAod3d3LmxhbWMu bGEgLyB3d3cuZnJvbXRoZW1hY2hpbmUub3JnIC8gZW4ucmVhbGx5aGltLmNvbSkg PGFkYW1AZnJvbXRoZW1hY2hpbmUub3JnPokCTgQTAQoAOBYhBE+vDT4gih9MmA0P ZvtOzkoQkinPBQJeiP0eAhsDBQsJCAcCBhUKCQgLAgQWAgMBAh4BAheAAAoJEPtO zkoQkinPJ4gP/3U691086OKbWiQhMhV+AViuKnMgV4i1M8s+4Ep01h/dTE6R+rUu LcnY4T0HR5qxAYMiNpGo1vtvkMvV5DP1PFSl5EddKn8+Kvn/0+WjbLV5tdiFF1Ef xR6261UFoXAGk3HJMLQifr3lWKoimaBwJZGza2ok9k1TQVTn8g5a01bzK7hD5DJI zt9RJZaUkxGE97eUyJ8Dtwumo18EWJltuC4UWjWT2t2HE9mMsOfjpYZXFsGxJ0Zb xexo0DYsriPDpuxDnZT7G3re9Vwz2VIe388DNBW5HoJsYxhr2I0QOq64ZWOSEZC8 lDH+xM6YdY0iz4A+7nbKNGifLbH8oU4A1sV9HrIE2KNy76x0GNjgQUvcq1inD4Oh yorsRh/IF6wnqvFrHOstCS2dzpKuQ/s7bM5TGOD2EGb0xu7r0AfHqqLUlbr3rxkS wBFMQphyNr3mEkEbXU1dGsXDlRQy11LigMBoEHmP0t49bYWuM1mIBnIC7gZc/sV/ E5fWmWdQyCKmHeujmS+sgp2EX0NtMGSzm7z9WBzTBFjaN7q28gueQ3INDsDTGx2G aA1LbP2uh1ipwju0GxecUif3T2NDqaYfhbaCYsPJORNUlJUtCVBGeba9wcXai2dh l+HsSKUiyCgKiy6Rt6jumKtYHt+Q0zcKWLfVp8PA20zX+2Q9zKnlLzwquQINBF6I /R4BEADQ4kmCHYtAhjCShc724Ei2pqSH4SfnXd4r8S8I0+io6Mh0kWn+kbKk/aGK BL3KJyN6624kPtOFWuQ4iQ0lWFn9UMnvjByTPbjZ2je+VtCP7lKSNvEgTLQRxLEJ hoNVrNjrLa/Cn7sLt9ayYcx8eKpHkbmrVRTyGqljBkI5hwQ8S+7BWugabhGQuogw bFthykA+wxYvSbSn5mwKO1BlbDCRnxjLISlqWwmKKEtXQ8b3tu7GgFuPYLKaLEk1 BIwwUSdozjXu+198WligepslidlN5bXrvje3sxgt4oAPFMeH+NnDClSDuGhSYamW Db3ZPl95pW70ngUVgFPG4kQOlaqzo3YBeDBHDXlqU0+O8cwSQFk4CBJI3yt6/KmD BIuKLwauOxYullx9EnqKcLWEzOlTgn9Q7BARK8Uz7PQU3+1mDNId2MEg+gfL3rd2 +aMLNhTUkgVE5mWkeDz6Kg7YhwruvJtn0z1QqUhkQcVs7N8rVCck0YUCVGXpsUlu emK48q4ryOxmMG/+Ws2Xkmdm6Axq414WHz6nLwMWgFpcO+1wRwQuZEkeWeSAjEvS CGHImxTP7E08+y3vAl43a9AlR7v9PbtCy2FenAhGPigmWm2aPj1ejYfQLXozyWSM m8uO3aiKvQXdV1Ha2xQLK5expaRaAXQ6YLsNBD77UPxi9qC5rwARAQABiQI2BBgB CgAgFiEET68NPiCKH0yYDQ9m+07OShCSKc8FAl6I/R4CGwwACgkQ+07OShCSKc9o DQ/+OV2OuDp9g/27SRssbTWE+nBl0R9klrb/w2XEIVhg5LROUe/P3anyBLNITbF9 A4q8b9udD+iIc1ClY2bu3rQOdzA1DH9GK84bQ1O/LaU0Te8RBGJJEzjYMUraCgIX 4BmxsIlWuCkSNsTgempLOK88646Nv5uc/oxAj6kQH7x8XBXxaJ+N9WS9f7EAv4AL bSWeJ4ijbw9BIMHt/D9Em7Q8bW6VGZIEjIp+gl1vNZ6QGCTtRHQez1jYmFLpuE/G yh1zM5gCnZbcmC7ExDLFI6SuYUbKC+XaLA3+LLCVCPFLtu6wLvcgYFwWWMKIhJAQ bRyPePiuMqWeWR6VXTD8pLziDjxK0ZtvpGdOtZeCCHOEmxrCsfKdIyD2Gn7TmTwb M9fRE1HazROfit6SRCAamabg+dJIEGT8vzlLfnkZRi+6hxq88uDbrOkk36ShWoYB AApz+5fj1ogLptiaTUTyyjTjB+/FIbU48/02fkD0y960zQLyKL64Q4aZrNa2NNup YKy5F80NkU4rHOZ1HTaPLoqqVsGhWc3ODgLyGPiRDLlZu81aNpA/UnTEBX464Sk4 Jx9qztb+S50LnGItA92QfE9ru7FAE00RR6mpCv1h7uE28/Wr4XaYgJcw1hAPRr7p TtN4lph+sJsCQ8eX5YUlM/Pht1h/LoE8h4hXNfAGh+CZgoWZAY0EXodqtAEMAOBb WTLRDxNk9SbC7exKdw0f8Wy9DhX2Qqoi96piS99CMJSxeocLiC9Si2u5nL3sQTAu qs1YbtSgn8kkiH3HPEJIhV1p/Hvz47j4kXq7PnjqF7KAdCYewuDqRiq8J7TNokYs 6+3/KqwHT/IT8NwPLdMkXcv/SXqhuKpqa2ApIrhu04VFp4H5OXN9rqdF5ZDfcNx1 PQv+6m8v6xRwrI3kduRCUD3YiVPM3EOhqINk9XMuxAoVX3qwpz+OuEDBm76U5jTZ q9ErdwRV9gaGm5ztq6tvElpis3spM7BPHzbv0SvVRAAbgGVh6kfiaZ3YckxLq8ln Cg5or1aZNyGMf7CmaZaeAjeY6Y8FZXR1P+n/IFd9Ak83a3qizZyckfiEPO7hu9zI FFXTdtZIcV102rNoVzruZIn0vSK1DJ7bNNrHkm1PPcweMkcFJY0uh6l3x2nl2qKm AhlDs3wFG+nqvqmnliVbrFZCYlReMrWWI2YBwLC5uBcBpFAhMPNEjxOtv31R+wAR AQABtCNBREFNIE0gRE9CUklOIDxhZGFtNUBwcm90b25tYWlsLmNoPokB1AQTAQoA PhYhBP/zHob861BG6LJ9SqGPd44Z/DJIBQJeh2q0AhsDBQkDwmcABQsJCAcCBhUK CQgLAgQWAgMBAh4BAheAAAoJEKGPd44Z/DJIKtgL/0JQEzrGWoHHN7T4wLiArPCv tHB3dTZBoXGKlpuwhgOZ1th6jOnGPdMZRYnX8Zuf7QhaI7m/duKv9OAr8A/2ftHG 7/BxPSHJWBuIGZYNL97OWSstuBhNtyxfCftDkeBCqJ+lAneOrzV0M8syr2VqpfVs O8nTE7nXHSOdyen+1Fw0PtwaeG9uJvOhgRsmQ+mtAiJ1OLGKUxgCzSUk0m/YnDg0 vJBtzq9qP9+EZSuiBuRQC0tKs01ECI5DzWLNXXC6X8k3YGrJpL/HtTxH5SYNQRvS ALd+HmVYpwijLPi7ANzmg9/+h/aq4VFP/4SyMd6EjaaQ86n2fC5zeugio4sjtFMp W3jbZPn19o2hWTt9/bLns+fm9PgnPwdC+tS5LT26N6vhT/vK/HHY5AZvXXPNcQMA wp+EVFxsWK2BcFMIi7Oq47CfuM1AUA+pgCenB4iSVwxs8ANTWWIsLkkKAYQqIdan OSISa2WdslsKMjXIQ5+rG9ekEn+rRO3EAQXRryBt4LkBjQReh2q0AQwAwGx7shIW OaVExpngqmh0ApkxJHZIxcxpatk/lSBQfzHg6e1/7Joe98lEHcWPJ6WFsGp+aC9S 96dWTBZq/4pzAqqTrSXAZpG/+yZlWRWSXVQex1gZHPzsWYMPE9qayAPTOJHtfS6a klIEaFV2GYEvvRK5UR5DFIlsfzyyCBOUKvn0/hikqJjN2YfHUy5SR5U5dGsSX3Jk Q9bOlBYDpN3Rk5rmLg0Vwn4nPRBET70MLQ5M4pU3Br6n+vU8tMHoVXYVMLinD4gO vVY4baXEZELjcPkPzGFPyjVLlpxKMHZ6v1Qb9ornTRGzc4dEUKxi3srdsTpMCw0k CaZ2WLY4sNBO33C8XfIvMx2jF4iIk3BrSrW/hirq6xpvlh4BUh/UWVrvg2rdemAX THa93mRQeOa3bze9xZwaA2GJLRG+xCIt15v/cNpQwCYlyhJunkuwk3HQcUrKfzxo 6QhqMeDaPZeNcvN3XoELGeqtoE7gKAnLp2nQuVr4/pcaiATf+yAhBgYRABEBAAGJ AbwEGAEKACYWIQT/8x6G/OtQRuiyfUqhj3eOGfwySAUCXodqtAIbDAUJA8JnAAAK CRChj3eOGfwySB11DADLgMAafhdzRgzx7FLVVW80IfgiCTAl5M1wV2HctA17aln7 jk7iEVMTLfhrSCSvvNIdrOXUE7l9HAMkKRwaZv7OAtYR8eQTrgGc9yJdk8BMzvJB ouiaNb2LSxMSvpoaJmD2C9ZkOyW+pAXKaUGhbUl8YVa7ytwPD6yZzonGClgZI0x5 9nSc5TiPpVijzu51iZiTV35F6en7ke2hjr6iBACJGBplxeeWszRa0wK2zoubAUK1 KO2punvtGqhi3j77/0sZgvFv3czJpRac5ccdLc02Sb6I64Stp04ilcV1aqlUXxbM gLwkoXZUqbCS7ZA7eBiEaKXdj9ww/gprO0AwFETxQVA8iPF9puSWfBf18a5GEdR1 Drb5lSReCkCfBJd3Tf5WHUSrdcai0FfuXNNp/7J7CBzlOJ0h6Yoa02hz8CBGGwxI 1brXRm13004bX7C9i+94Lbgf8bTM40JvyF1kmcffkj8ibpS/VSa8aWJuqpWk/xcn ob/YdBngWCxNgXii4E6ZAY0EXot8fAEMAJ/JOflg7U8JWescyTQNl9Xuk6QUIVKx 0zOT2k+drlLwC8+FckYTCF1pm8sPDBBv9eN3cFCDf076tZjUHv+Roq5c5McDHlN5 KlFbTSOv1qZYuaPY14nHIoW7OGoSvMCOBkpDLLwnIbuLA0wGdzyd3z6Vfhpz3wDv iAplyA4iuzJQq1+iS8tq6Uj2yhmfg+zU16gw2D3iEC6hhSu2KmPhMFD9KfCzq02L xC6fMh3Fogas51ZF1fRDK8Bvicf4yYj0dn3i6GDr0/vHga4eLQqVBXb0HCv2lNer gTtawQfJu2XEn5hDZKfHeBJ4NI4k7AZIPa7OuUqOAm8Z4hbkgRZakc+OhPSEKH2i drItwrPXDGqMYV4tLLMALMQ9WDTz75wbzVbxGVcAzG3MaZSo/f/iKzuzaE8cF71A dO1y6H5YmmMENn4t/D4BYXm4edPvV6SaYU1hO5yqr7vGbrQBFVetpSCLEFveACHr sm1S6nVVTazkHj2FNdww4bGMJzPqC7bBtQARAQABtChBREFNIE1BUlNIQUxMIERP QlJJTiA8YWRhbUBlcm1jY29ycC5jb20+iQHUBBMBCgA+FiEE9+R8sSygzQHF4cv6 fsjVqFo41joFAl6LfHwCGwMFCQPCZwAFCwkIBwIGFQoJCAsCBBYCAwECHgECF4AA CgkQfsjVqFo41jpPfgv/dylMY4CPMwkdry8KnKP3QtmJOl94VnpJ+FUME+oOqjBw 6/C16uWdTLYuEUuE2jEzTg2J0kgulM2vYm8rVgJzlGiD/oIgX3X5NeyB9MH+GCpu xsJ/ofIVpC6t8Zl78B2qTnJOcEc6owy/qKs/eFXSea2sRRstqK20dOajl4Z2ycEL SdijFR3aqT4hU6e0GNWYqo3bW4TUcd05RJIZBNz6Bitq1fxljxFPOOCaoKo9mVn4 0dN65iGPEYg0c50Q6EmxEr+XtwRu1rjgG3hgq6BknZ6QD1HOBemQg/3jqQBb9uHj jHbuX9HrbGF9+QbDicbmuZSLuV76xJnbyTycFhhIcSi9wZeyAAPlpL4GQ8l98jKa SCWWGDPpKwK5+o8kteuJ/D/mYyBEquyFVhPQBXV9zS3LsN7ab55zB5+ZnLUeofai LE6e+XPGeJmG3I/+T/Nuq1CqJ4Wyt8+aIyf6Uz8dDk0kjyQku484plRwMEx7oZXR bXQAAn8SwtlNGo0sHc6JuQGNBF6LfHwBDACxAxfbQM5AcssJlQFXThnBMHtRDeBH VkyF5mrO9JeFRT+mhM87V+fJXOaEKtcSFVgZJFKV2MPdyGqZSGKmyyqfUvKfucP5 LrjK3MRKibTlOMwbBOmYUksMVE0ByMPeSzyMlQhq0oyA3fvEdKEf0JrFGDRWNzO8 /Q54oj79Pki4y1BDKd7lE1srBFiVEUuPNJmjhhU9WXnMwiB55lLwbTR8mKEX0Pr2 FeTS5gttmbHf4V+wnJvlOEU6mOLMrb+6Xb4ltvqbl9ng1+tF2QMGMd83mtbFtAjb Zcl/Cq2KwsBFyH9VT48ZxWxpOYMf3ppEg9KOSfz9Ungtg4/Q/Kr9P13Nf+9+S9JS 1PfKdlJzGFDn4EwZ49ugg6GNnL6XuRl9jBPD2iD8hY9CsTdWrr9giCmJmdf6G/bK HUm2QekMbhpaQmYKkMeri45cHprx1dQ50rfiH1cBm5SxaK7z/hDDaKXF1Gp7/KwQ g6gHlyMss7EEHSY5ogH+6a7OUPpqbJdNztEAEQEAAYkBvAQYAQoAJhYhBPfkfLEs oM0BxeHL+n7I1ahaONY6BQJei3x8AhsMBQkDwmcAAAoJEH7I1ahaONY6EqoL/R7J QLaAlb4/hK7/v4vsSxtCirLWrqNNNJxYdmpXq19NKPmcc08QzSqkJ7vR4/kn2L6I OY7y7AMh+tScKTKIGn8MkAcj0ZvkafHY3xmpN1Xp9caUAA/fw6KWD+pSZpKpISyd 2Xr6x5OJGSKhyGpPB98oCsa809LQ3cweG1imem3jx+Lgii63pEJG/AeNeEwkIvdC zRLSQvYv0UjlhyOoII6YEWJcro+tgOcthPh2SY50E4lwFFfbz4CNQyL15D+XciNI xSVGz8gee/XdJdgwQF4SEnIiChhmJ5VmpNH8ZwxTMyI3EoFMB/RYaucwc/ucvySn cFyShFFRPjo6TOeYIaSrrfR+4yhHAGeM572y0btI6JjWZovupeXX3k5ZHHrCwxlR MuyULLyhUsAC0r1FUijbUWoyaDcRtLRpMUg1X6A7n1iH61WxlKQ/8mZhYht85Jgp FSiyz47gofc491ng9efshlyxwb3TeLbDZPRnls7L3sfDDWwp8yExjA7UNDbIh5kC DQRencYLARAAsFHArFeulhD6hZplRF49h8+zpI3kn+vFtYwbUqLSRwze53rrJtqE 6o5MWSfadr9KIc8tNZ2aBGxzjGnsbPYLDh76NkjP4apWSMX+u+EHsaudoZoAdNnM Kqr86sVzR0MUeGHp7n/L3imp1WoCn28eMLeNec9a4GRTRPGLKR9F/jytTz/XgkHL zA3i2pt63FqniN4PBTNFzgfXiu8xVZGohsDPjmd9LXbGKTXfJGhBLB6QsmjJwglt n+00ufdKLEZu6eBxRWSVK0t4rEnnpK9K//PKq5DtVaOZNe6g+hdi0B1gpd0f0nBy eZd9arCsvN3qLXP0vYTk9DKMUecCEblss5Zt1+qjAbsMk9/xSGZLJp/4dBTBVN+Q c6+Rmv+koe6zLNmA3fJH3991xETDzZxP2UHN7q4i4L97KA+nVAakwazNLiqsY/bT s58rXnCc72b7oLnZbNOPQmLwZFafVi4xoIE/5Zq8iVr7d7xHPccYkaEVCOnsL/35 GZxy2FNi4wuOfGwBtTbnXg/u/YiBj6yNbhLR+FCwZED5M/evgUUbJudxqRdrI+1a Zo9gGA3JLJZZ/iLwF1kE7yYBvyBRfaO9IL3bwplRurnrkjI+rRhi55AlbGhU3eMu iKTKQk+qJF11ocTGu/dE9I6JeQpEdyVehrWXc5H2N0Qjyca8ZEA6WwcAEQEAAbR7 QURBTSBNQVJTSEFMTCBET0JSSU4gKGl0J3MgdGhlIG9uZSAuLi4gbGlrZSB0aGUg b25lIGluIFN1cGVybWFuIDMgYW5kIE9mZmljZSBzcGFjZS0tYnV0IG5vdCAqdGhh dCogb25lKSA8YWRhbUBlcm1jY29ycC5jb20+iQJOBBMBCgA4FiEE0s8R6kp2bveF MmxLkifaSe8nN2gFAl6dxgsCGwMFCwkIBwIGFQoJCAsCBBYCAwECHgECF4AACgkQ kifaSe8nN2jK+g//Toi6ezWYrRbTs9xwQLIsKzl91ocjCuN9nHSnwzkrLuoGGgej fHkXzd5+3ygL47j++k69TYB9CPrGdR1GTqt56Q7DSYZCgdg+e89piTJUzbEyN01q EGkVuV5Rz9EocnPE8db9HT+xvf44ecfMOFD1XuB9jynrQD445YfeFE6LHkoNUvFD wQK7NN04fa+qvrk0lTS4NCpOYsdrSioddVjQyEC6jepwIRA3iRIkFdEJT8ggqQ6d gntsgExA01o6HqzDSHjSCA5AexCotwW3Uvdt0WwXx6q/c0LsRLhbuPeGX/Nh8aOf 6RBCQWgnIko675ura4c+r1VcBYl524ZJlN4x1x02YAo9cKzYi3+H9C8K8Ayz/SJy 7sVGHWnDge1yIwzWXbpolqiMSL5l/0OBuJ0HXQSafUut33Jw7hYKP4BQia/BmE0x Tsk0rBRMyihSYnUn9mYpXM3KwWU0C2dudVwKtToGR1aKlYcCv0iNFAsR0DBw1XSq n72KqIl020gZFmg3H34Z6CWhm20RbhMjOvvkZ+OiS9kU9kXt6m+T1zCpWHFJSae4 JF+dQyB1BFxAwXW4ZEzMo4XluTuW1R8pIadKTsHMWzEzH7RvZLKP4invsZklZ3I1 EEsJop7DSMOa27irD/IlCL+nwaEsCMRh+ndSkADLHsa9P5d/qWjomKxwdCm5Ag0E Xp3GCwEQAOoXU8NrugMa8OAncXKv4hycXJzArDae3Zx6pCCEkP3TZTXh1tqKPUtb dmb8Mq2eecVTwmB+FM3m+NApgq88Vx6HiyI73IAvgtZORo32YaipfbkGnXHfaUWX 5380R4GL597yZuP8sAsJ3iDvxhW59snsU8tLi+9r2u4h0fgMDqZXQsfvLUkDIiO9 nzJf0xFacTx3n+pUuWdzIuT3AUdU/L9NubmHSnj09FevTHWIYmxGFZoiSdS7r2Z+ 5xZmPak6lzrQTVS/DxcpyA/o3yi8qLPyf1VUxXKFeKd0sV6BPvYFxI2GeBl5atBu 9/3/5D6wdlrupTFLU1Msdfy3UWaRUFHLITK4fJ7pbTgoEqxX7gpO9iqKmScm3gYc O3blA8aTqCX2NzxUF5fHbi14JvPWP04uFl5EOeDB322Jm/guWy8TvmIIyuF3aAAX PfErW/yRWDsYOcAADs8elZkt3F+E/AwWd0JMIhd/RB3RFH8m7496XLS3xBP6rNye 0O+96lX7fVp+wvINxM3Rfo63b1K4bR5KR9JDZ2SLYhrx6Hyy+UiRv7l+i26WxVMF qRyvY2aHqyvKfR1EEf1t2h7B4b65xQkj51qvX5Tjm5Az7nKcXpcUKqS3bk8xiw9N y7eFfA361OSPpQ+V4Mq/Mv+MqyxLTz9tn+80ZtjqM0MEERfpUo15ABEBAAGJAjYE GAEKACAWIQTSzxHqSnZu94UybEuSJ9pJ7yc3aAUCXp3GCwIbDAAKCRCSJ9pJ7yc3 aE2NEACDBRnGYNi2sq0wltPSkD2CbQUon+4uiFB2UU/gs4mFlGOvzDHBHVEFzCqK 0x6KlKm4XBq3AF7iIoNMiU9FmBdWDnEp9eCXdQrr/ykgq3vKMuj6/QJNNZglIDoe 1J2NXeMOUFwCUvjcCttPv42Q8GDt8/bG7QOgmTmhuqvKIj/vL+c3HgNrRsQzhw5z mSzQIDaesD+UVA/sourXpSLeqPgF+6qsEqOirD6hotaqrt+aIA/8wbYkpNQxCEK4 gKDgpqTV7VKklku7fjyhBhZQOVDoWvd03AlGQD0WBNriUsh8l4N6Zg2BlnKTGn11 BTigqwlHC91xtjERgwFg8PAHN2mtgZUHITHX5js11KwlQdLyI04/M4M4oQq0KSbJ rpiWCgrltC/VqJrT4HELFYx2Iv5wzrV9jVEm6zonag4A761hpqTgRrjWtaLuYu2Z zdw9y1r0+0d2rTUGpjIQRVOwi3AF/G4aU+vAOOf/HcgH6Qnpbu+xV0fkuAZbTI7w 6VVkBvnstiQV88KrWAOXKVABSSxTz2OYbzOTt/bgxzAa7yr1xIBDKvujBqDRGBLi bISp+40Haoj2Yqop6vbS70Xq+cnBOwJW86u61hsLgOjqyxgLzvuGTjK7+TblCjR2 F4LNeQdwDdyNRjPYeGVXM3MEqR8XdcR1Z7BQvLNcDgoW2qDcbg== =4lZw -----END PGP PUBLIC KEY BLOCK----- Please see GPG keys on PGP.MIT.EDU; fingerprints: sec rsa3072/A18F778E19FC3248 2020-04-03 [SC] [expires: 2022-04-03] FFF31E86FCEB5046E8B27D4AA18F778E19FC3248 uid [ultimate] ADAM M DOBRIN \ ssb rsa3072/04F98002A3DA53B2 2020-04-03 [E] [expires: 2022-04-03] sec rsa4096/FB4ECE4A109229CF 2020-04-04 [SC] 4FAF0D3E208A1F4C980D0F66FB4ECE4A109229CF uid [ultimate] Adam Marshall Dobrin \ ssb rsa4096/DD1F0C118C788B04 2020-04-04 [E] (function(i,s,o,g,r,a,m){i['GoogleAnalyticsObject']=r;i[r]=i[r]||function(){ (i[r].q=i[r].q||[]).push(arguments)},i[r].l=1*new Date();a=s.createElement(o), m=s.getElementsByTagName(o)[0];a.async=1;a.src=g;m.parentNode.insertBefore(a,m) })(window,document,'script','//www.google-analytics.com/analytics.js','ga'); ga('create', 'UA-74743044-1', 'auto'); ga('send', 'pageview'); pub rsa3072 2020-04-06 [SC] [expires: 2022-04-06] F7E4 7CB1 2CA0 CD01 C5E1 CBFA 7EC8 D5A8 5A38 D63A uid [ unknown] ADAM MARSHALL DOBRIN Because of "some issues" with what appears to be distinct and unbridled privacy intrusion; please ensure that PGP is understood to be "nothing more than not so much pretty good" and this key also, almost required in order to verify authentic identity--in the case of ... question.

      I am accepting charitable donations,.\ ETH: 0x66e2871ef39334962fb75ce34407f825d67ec434 | BTC: 38B6vGaqNvMyTtoFEZPmNvMS7icV6ZnPMm | xDAI: 0x66e2871ef39334962fb75ce34407f825d67ec434

      Wednesday, June 23 2021. Nintendo Way

      Erev ... the Day of the Holy Divorce of Bayjorel

      Adam on "ho(s) I still single" ... I "hisss" as Alger, Narcissus and to the various collegiates in Massachusetts; know it's because I'm Cheyanne Mountain. You can't even dream how hard it is to get inside "this heart." Or maybe I can't fathom why nobody's rushing up to me trying to grab the ring of "infinite alimoney in the ever-after" ... Na Na Na Na ... Na Na Na Na ... shey shea way) ... tee tea, tay?

      This messages marks a major increase in "forced read(layshion)ership" to include a significantly larger group of students and professors than before. This is a new system; please unsubscribe using the instructions at the bottom of the message, which are different from the prior newsletter interface. I have noticeably been writing much less and sort of working harder on bringing to fruition the software and social policy changes I've been dreaming of and writing about instead of "just talking."


      Searching this message that I intend to send to the students a day early--you know, with foresight for ... in the hope that many of you remember first hand hearing the words "I don't believe in the big bang, but I respect those that do" echo from a computer screen to me subconsciously in the state of South Carolina--that you will help me end the 7 year draught [[literal, good sex]] that I equate to the Biblical overflow of the Nile and to Stone Temple Pilots; this light and Sheldon Harr who trained me for my Bawr Mitzvah and taught me all the right things that I know about being a good Jew who didn't really believe in the existence of God; but then helped create the system that makes us all that.

      Those who "see" or "saw" Kentucky as I did might recall the phrase spoken from myself to myself; "you don't believe in God when you are this close to it's creation" ... or something almost verbatim; that. Some of you might see Gilgamesh more than I do, or have forgotten the "sliding of sleight of hand and becoming ... the trickster of the Dajjal ... "an idea that gore was being fabricated and faked; in order to help us see why it's so very importanat that at the same time that immortality and heaven become part of the conversation of the adbication of Odin's throne to Thor or to Arthor's table and plebescite "victims" ... that we all understand the magnanimous change wrought by Heaven on civilization and on the old customs and on the old laws, and that here we see the importance of guaranteeing safety and privacy and even "right to death" in a place where God had previously only written of "life and liberty" with the ambiguity of ... "from what" being left to my seemingly slow hand.

       


      On the order of plans soon to be seen to fruition my large key of "what this website truly is" has grown to something like 20GB and now includes a static and time frozen version of everything linked to stored on the IPFS system and multi-homed across a number of "cloud providers" to ensure things like "shekinah" will not forever be changed to "shechina" with nobody noticing the loss of causal original truth. The "light of angels" domain now redirects automatically to /ipns/fromthemachina which should render in future shell-internet-browsers as something like QmTH33MwfPn5S3bq45Tk77L1j9eZjUsvEVhRTHB3D8M2ZX [please pin this "root block"] I am not sure why IPFS doesn't have better merkle tree searchability, but seeing siblings and parents and connections between these Qm hashesh is something that we should be working fervently on making more robust. IPSE.io appears to have created a decent search and governance system, I see it as something like the "electoral college" metacosmically linked to the thing I am trying to build--a preservation of all human knowledge and an infrastructure for discussing and communicating about the "veracity" and the linguistic nuances "alluded to" in the lude ties between this Empire's new Clot and the clothing worn by Popes and Jews, the seeit-seeit; tzit-tzit and ...

      4-WORD AND SIX WITH "SHOOTER" ... YEARS HAVE GONE BY; AND I STILL HAVEN'T GOTTEN FVCK3D.

      I am planning on suing several medical providers and states for what I see as heinous violations of human rights, decency and the Constitution of the United States; if you are a lawyer or you can recommend a good one, please email me as soon as possible at 0xc514f094370cFc5eE45a1Dd9B72bb9675efE266f@ethmail.cc. You can also send Ethereum fungible donations to that alphanumeric identity. As I note much later in this message ...

      TRUST IN MA ... SELF-VATZEDEK SUE-C-CYDE ... I KRY/STALL WHEN DODGE DESERVES TO PAY

      Please do note see a significant difference in importance in the emails now coming from ethmail.cc and the series of half-rambling cires for help which amount to something like my prayers to the pagan g<del>od</del>s that you are.

      There's quite a long thread in my soul

      \

      Many times I've discussed and called in my mind and with my heart the American democracy nothing more than "Noah's Archaic" two party system. Over the course of the years hidden messages from the Ark's source of knowledge have conclusively shown me that a previous phrase "multi party system" connects to political parties and governmental action committees that span across continents and even earths; in my microcosm or special language and understanding of heaven, "across rooms" which are worlds ... sort of owned or designed with some sort of top down or democratic structure of "literal rule system creation." In my mind these rules can be inherited and modified, in the programming language sense of those words, as in "inherit democracy from America, update for new medical knowledge and scientific truth ... discussed later in this message.

      The "water joke" connects to Horatio and to H2O and the idea that the chairs depicted by the character "h" are something like a placeholder meaningfully connected to the Senate Majority Chair and of course the Minority Chair and it's the fact that there are only two that makes our current system something like A"Biblical Water."

      I believe we should be living in a world that has many more than two parties, hundreds or thousands of active parties could and should compete not for a single figurehead to sit in a throne like chair but for groups of people to be able to access the faster processing power and wider knowledge ... represented here by something like a "Matrix jack" from the two movies, The Matrix and No Jack City; which allow for resources to be "billed to the party" and/or the people, rather than individuals who might otherwise have to "pay extra light" for faster processing power in order to quickly build a piece of legislation or political propaganda that equally connects to the mirage and miracle and dream of building a "subconscious voting system" that allows for votes to be taken "isntantly" and not just instantly but at some kind of recorded interval over time. I envisioned in Kentucky a world where the laws of the land would change instantly, allowing for bad weather to be instantly removed, for laws to differ from neighborhood to neighborhood and even to allow the fine grained detail of "outside and inside" each and every individual home or castle.


      Lost. Blind wandering through a lost world, in the beginning--that's the truth. Crossroads, somewhere between walking through an electromagnetic pulse in Lake Worth and struggling to remember "the other thing." Recalling [flew(ers)], so I was there sitting with my parents when we saw it on TV--a gigantic deal--the United States was going to war for the first time in my life. Saddam Hussein had invaded Kuwait (supposedly for the oil) and Operation Desert Storm was launched by George H.W. Bush; recalling the names and "Space Balls" it's almost funny to see ... how blind I was back then.

      General Norman Schwartz cough. General Colin Powell. Anyway, the whole point of the story is we were sitting at the Flamingo Diner; and for my whole life I lived just a few roads away from that road; never ever realizing what it was. I also didn't realize for a very long time that you might also not see it, or you might see it instantly. Scanning just south of there, you can see it turns into Red road, and then its more than obvious that "flaming" stands out, light a highlighted cross--but we don't say the name of that bird that way, and we didn't see "infer" in Dante's "inferno" or ... "no" either. Flamenco ... en espanol ... like the dancers.

      A golden bitcoin swirls in the sky... the "mind control people" of Bowling Green gape in some kind of crowd pleased awe as the "middle" and the end connect almost seamlessly ... Fort Myers creates a space port in the light of Vegas's monorail "plots"--

      "Who?"

      "this is what it does,"

      vaaa---tseeee----deeeeeeeeck? In this word I recited over and over again in preparation for my Bar Mtzvah on December 11, 1992; without ever knowing the meaning is the crux of what exsactly is going on right now. The word is vatzedek:

      צֶ֫דֶק noun masculineIsaiah 1:21 rightness, righteousness; --- ׳צ Leviticus 19:36 87t.; צִדְקִי Isaiah 41:10 8t., etc.; ---

      1 what is right, just, normal; rightness, justness, of weights and measures, אֵיפָה, אֶבֶן שְׁלֵמָה וָצֶדֶק Deuteronomy 25:15 a perfect and a just weight, ephah; ׳מאֹזְנֵי צ; ׳אַבְנֵי צ, ׳אֵיפַת צ, ׳הִין צ, ׳בַּת צ Leviticus 19:36 (H) Job 31:6Ezekiel 45:10; ׳מַעְגְּלֵי צ right paths Psalm 23:3; ׳זִבְחֵי צ right peace-offerings Deuteronomy 33:19Psalm 4:6Psalm 51:21.

      2 righteousness, in government:

      ... and you can believe that despite the strawnge pronounciation little boys and girls would use at the age of thirteen as they spoke in rigorously recited prayer-song ... it [swounds almost exactly like "What's a Dick?"]

      FTA, from the article: Congresswoman Ilhan Omar, righteously fed up with the prejudiced nonsense she endures day in and day out, called a question about female genital mutilation from an audience member at a recent event "frustrating" and "appalling."

      So I stand here living in Taylor Momsen's song "Nothing Left To Lose" my personal favorite of hers which touches on this subject of "freedom as just another word for it" and of course the link between the purpose of an ethical oversight of the popular vote that the Electoral College represents; another two special and related words here, righteousness and fate. Between Vatzedek and Kismet; I can only convey my great dismay at the actual emotional and true physical pain I feel in my groin of groins every time I think about the horror story that has become my life and the what the land of America and the Medgard of Yggrasil has become ... [note it's not Yggdrasil] as I rally against the closest of my family of families, the Americans and Jews who refuse to stand up and speak out on my behalf, and on the behalf of humanity in general against the sickness of ritual genetal mutilation.

      Lost between Elvis and Suicide, she sings and I think about Ellis Island and Ellis Eaton and literally the innate and obvious lack of desire I have in my heawrt and imparted into my mind by some kind of ancient and unholy Jewish law ... no desire at all to leave this world which has quickly turned from a bastion of light and freedom into nothing short or less than Hell itself.

      Kirinechoes from the land and day of NEMEC.html the chanting from the invsible choir of "e" ... "he's a victim"

      over and over, "he's a victim, he's a victim;" and in a more private sort of way she held on to my victim's rod) and in a sort of kind friendly way implied that I should stop doing "speed" because ... I need this, and she ... in Holy ritual ... patted the phallice of Iapetus' great grandsun.

      Here I stand for the very first time; writing to a large group of students in the area of Boston, Massachusetts begging for the Sabbath Day to "be remembered and kept holy" as the Hebrew prayers and rituals repeatedly fail to explain has something significant to do with entry into the Holy of Holies, with the continuation of life and of heaven ... and with the reinvigoration of something like a following of the Hippocrati Oath that is beyond a requirement to be reaffirmed here in this place as we begin to discuss the opening of "the process of the creation of legislation" as a function ofthe "citizenry governed" ... the creation of "direct democracy" utilizing a kind of fusion of the software products I've been explaining are here designed specifically for this purpose. Software like kipu.comaragon.orgwikipedia.org and even reddit.com.

      On the shape of his table, the heart of "sword" and another word for "Murfresboro"

      \


      Sometimes I get my hopes up, sometimes i lose all the doubt and the "missing remorse" and the fear--the moments I can't STS "socks" out of the VEGA System; in those brief moments I think you're actually going to do something nice for me, that the heavens haven't crashed and I'm going to have some kind of sex party that actually ... really honest to God ... is what "Saturday is all about." So what, sue me--I wrote the book on the single Dionysian fusion of a Roman Bacchanalia and the Weeebrew Saturnalia ... and then I yell at "Bethesda" for even daring to mention the grape fruit juice and the movie Havok--but I've heard all about the "passing of the nite and the nocturnal rite"--truth is I probably would walk right into the branch ending trap I laid in Fort Myers--every time I think about it the "minute of bouncing and orgasm" makes me smile a little more inside and my stomach get's butterflies and just for a moment (I think I might be writing like STS) I think maybe it's not the end of time and maybe I won't never get to actually see ... Heaven.

      Butt then you tell me (my but-tea joke isn't funny, eithah?) ... "Cassini" and "molasses" are supposed to make you feel like the OC resort guy staring at my tooth "about to be the one tooth) from 2011" and I go back to remembering it's been a decade since I've had a decent "good time with a girl" ... literally seven long years, aside from a brief "blushing" experience with little Mackenzie Reisinger.

      Imagine that girls smiling at me and saying things like "Larkin Sow" and this brief period of "ecstatically frenzied decent writing" is all that it takes to keep me going; trudging along through the very shallow (or deeper) pits of Hell itself--just like a Dreidel c'd to make some silly words from the "introduction to the Bahir [literally wasn't here, and "spirit of ah-aha illumination; hi. and this conversation ensued"] like "yod-nun" actually be ... something like our salvation. Flying back in time to the "thang" point, I remember what it is now.

      Fear it ... það; fear it.

      \


      Day One has begin, or ending--whatever the proper literary way to say the Bible and it's days are all wrong, and even further along the thing called the "Festival of Weeks" by the Jews, even more disgusting. I have no shame or remorse in saying such things, in fact I believe it is the purpose of this strange take on the "nocturnal rite" of the Norse ancient Druidic and "Dhruzimentioning of the Prose Edda to come to this very strange point, in this very strange place.

      Boston, Massachusetts.

      It might one day be a little known fact, but up until the presidency of Barrack Obama every single President of the United States of America was a member of the Protestant Church, all but John Fitzgerald Kennedy whose bright and shining face and ethos stand apart from almost all others in his place. I might one day say Trump too stood out above and shined brighter, and personally only because he lived during my lifetime, I think my personal view of Bill Clinton is the brightest of all. To me, the Clinton years were filled with the booming economy of Old Joe, and the great aspirations of Our Jack; a thing that many people before Armstrong walked on the moon and planet a great Democratic "P" one giant leap above the rock of ages ... there are just no words for lux of America's contribution to the launch of a Heavenly Civilization, in the words of Paxton in "Big Love" ... and the LDS Church and Deseret's version of "the thing" (nu3 today) ... "the celestial kingdom."

      Valhalla and Matzot scream of the "ha-moat-sea" and the "vats-a-dick" but without our giving of thanks for righteousness we have become the murderers not only of Judas and Death but also Jesus and the thing that created him. Eventually the island of America disappears, eventually it's Earth, any planet a human was one ... these are the things that have either become a force of great goodness--or of total destruction. This is the embodyment of "Troy as hisT" this is Galactikiss has become Planet Prime and all Derivatives--the silver surfer speaks to you all, between "El Dorado" and the "Silverado" ... a comparative connection to the difference between Fort Knoxx and the Pound Sterling ... with a Troy Ounce of "tzadik" to ensure with our GSLW: "ness truly means 'now everythink safely saved;" ... and that's a GNU definition for NESS which previously may have mentioned everywhere or earth and those are both absolute falsehoods and perhaps were not when they were spoken. At least, relatively speaking.


      Rape has come up today.

      I've commented publicly on the conversation I had in my head last night, walking by "Boston College High" and I can't help but add my "very interesting" thoughts on the echelons of spirits inhabiting the Ka of God here in this place; and how they might somehow be satiated in a way that I or most people in this world would fine to be something more sexually immoral or deviant ... "previously of the wiccan pagan variety" ... something like my strange dreams here in this place of starting trends of having "a thing" for doing "moms and sisters," which have been echoed here by a sitting and very prominent G.O.P United States senator or congressman; the show "Vampire DIaries" as well as Natalie Portman, Taylor and Sloane Momsen, Kate Hudson, and a number of other female "duos" like the Spears and Simpson sisters (Ashlee and Jamie Lynn, see) the Olsen twins and of course the soon to be "in the light of the fame of Nashville" ... Larkin Poe.

      DIVERGENCE, TO NEW YORK CITY, TO YOM HASHOAH ... OR TAV OUR TAY VUE ...

      (((( this here is what we call a "race through a rats cage )))) if neither of the four or give girls in question send me some kind of verbal "ACK" ratyher than a "NAK" in writing, I might travel to Ellis Island or Nashville, TN before staying in Boston or ... for instance going to Lowell or Nashua and ... perhaps causing more FUKUSHIMA on the NAKARSAKI of HEROSHEMA; and by that I mean this is a "big deal" ... LLNV might become a bus stop in Vegas or the VEGA System or it might be a national labratory near the Hamptons. It's hard to tell at this point whether or not there's any "liver" in Mexico's version of that funny one with the guy that reminds me of Aldous Snow in "Forgetting Sarah Marshall."

      In my mind today I speak from the Earthene world of Janet Devlin's "Chandelliers" directly to Michael Jackson himself, on the difference or change or meaning wrought by Bill Cosby and his "Neverland Ranch" series on the question at hand--are there bowling tumble weeds and karaoke bars on par with Prescott Arizona's scene anywhere closer to Nashville than Bowling Green ... because I was beyond surprised to find a sprawling megalopolis in the place I had thought for my whole life was something more akin to Knoxville, a place where fledgling female music stars became "Grace Vanderwaal" golden buzzer winners ... faster than you can connect Jerusalem to Shirley Temple. On the specific name, Shirley here is Bianca Pisani's great grandmother; and no farther than the truth is the world's "UMBRELLALAUNCH" link between the Chinesely famous virgin (non-alcoholic) drink is something like Billy Joel's Piano Man Bartender walking into "the usual place" and saying something along the lines of "Geisha me up one Virgin Red head; hell, why don't you make it a double." Leave the umbrella with the kites that didn't glow fiiery stars into the Holy of Holies in the same vein and for the same reason that the Church of the Holy Sepulcher failed to actually change the world with it's ritual uniting the Olympic passing of the Torch with today's interlinear and interwoven message with Old Joe and Young Jack Kennedy, Jackie Onassis and even touching on the Saudi Royals which were also a big part of the story connecting General MacNamara to "Lauderdale by the Sea" and a special rememberance to the expensive and Holy bronze or copper brick which he bought (through donation to charity I imagine) making himself more than just something like the founder of the beachfront redesign of our Federal Floridian beacnhead, but also a founding member of something I call "The Columns and Pillars" society in reference to the Pine Crest School version of the same kind of ritual. Also connected here are pictures of those columns, and extracts from my senior yearbook where my mother was kind enough to leave me two whole half page dedications to my graduation from one of the most prestigious and omnifiscient preparatory schools in the entire world ... at the same time donating columns both in my name, their name, and the names of her deceased parents: Julie and Bernard Gerson.

      Bell to sky; and to the Berlin Sky; this is the same genetic and congenial family line that links Gersholom Sholom, Albert Einstein, J. Robert Oppenheimer, Adolf Hitler and Yosef Stalin ... to Joe Biden and the "Joseph and Betty Portal" which replace the MacNamara era bricks with "new composite plastic" that might last much longer and has another list of donations. The "portal connection" something like an Einstein-Rozencrantz flash of brilliant light ... marks just one more error in my handling of my lack of understanding of things like "basic vectodirs" and "kasimamoriv radiation" ... including here (if i read this and take the time to properly attribute) a visual image of the red shift and blue spindle of the actual radiation Einstein predicted would be ejected from something so massive even "light" could not escape it. On "relativity" and relatively speaking, it's the wavelength and energy level of the light; as well as something called "gravitational lensing" ... "the special relativity theorem" which earned Munich born and taught Albert a Nobel Peace Prize (as well as much fame in the land of America for the creation and explanation of the science behind the White Sands Trinity connection to Hanukah and Sandia National Labratory) ... forces these corrections:

      ERRATA

      Operation Fishbowl was a series of high-altitude nuclear tests in 1962 that were carried out by the United States as a part of the larger Operation Dominic nuclear test program. Flight-test vehicles were designed and manufactured by Avco Corporation.[1]

      The Operation Fishbowl nuclear tests were originally planned to be completed during the first half of 1962 with three tests named Bluegill, Starfish and Urraca.[2]

      The first test attempt was delayed until June. Planning for Operation Fishbowl, as well as many other nuclear tests in the region, began rapidly in response to the sudden Soviet announcement on August 30, 1961 that they were ending a three-year moratorium on nuclear testing.[3] The rapid planning of very complex operations necessitated many changes as the project progressed.

      All of the tests were to be launched on missiles from Johnston Island in the Pacific Ocean north of the equator. Johnston Island had already been established as a launch site for United States high-altitude nuclear tests, rather than the other locations in the Pacific Proving Grounds. In 1958, Lewis Strauss, then chairman of the United States Atomic Energy Commission, opposed doing any high-altitude tests at locations that had been used for earlier Pacific nuclear tests. His opposition was motivated by fears that the flash from the nighttime high-altitude detonations might blind civilians who were living on nearby islands. Johnston Island was a remote location, more distant from populated areas than other potential test locations.[4] In order to protect residents of the Hawaiian Islands from flash blindness or permanent retinal injury from the bright nuclear flash, the nuclear missiles of Operation Fishbowl were launched generally toward the southwest of Johnston Island so that the detonations would be farther from Hawaii.

      Urraca was to be a test of about 1 megaton yield at very high altitude (above 1000 km.).[5] The proposed Urraca test was always controversial, especially after the damage caused to satellites by the Starfish Prime detonation, as described below. Urraca was finally canceled, and an extensive re-evaluation of the Operation Fishbowl plan was made during an 82-day operations pause after the Bluegill Prime disaster of July 25, 1962, as described below.

      "Wish You Were Here" is a song by the English rock band Pink Floyd. It was released as the title track of their 1975 album Wish You Were Here "Wish You Were Here (Pink Floyd album)").[2]#cite_note-2)[3]#cite_note-mabbett-3) David Gilmour and Roger Waters collaborated to write the music, and Gilmour sang the lead vocal.

      In 2011, the song was ranked No. 324 on _Rolling Stone'_s 500 Greatest Songs of All Time.[4]#cite_note-4)

      In the original album version, the song segues from "Have a Cigar" as if a radio had been tuned away from one station, through several others (including a radio play and one playing the opening of the finale movement of Tchaikovsky's Fourth Symphony "Symphony No. 4 (Tchaikovsky)")), and finally to a new station where "Wish You Were Here" is beginning.[5]#cite_note-5) The radio was recorded from Gilmour's car radio. He performed the intro on a twelve-string guitar, processed to sound like it was playing through an AM radio, and then overdubbed a fuller-sounding acoustic guitar solo. This passage was mixed to sound as though a guitarist were listening to the radio and playing along. As the acoustic part becomes more complex, the 'radio broadcast' fades away and Gilmour's voice enters, while the rest of the band joins in.[6]#cite_note-songbook-6)

      The intro riff is repeated several times before Gilmour plays further solos with scat singing accompaniment. A third verse follows, featuring an increasingly expressive vocal from Gilmour and audible backing vocals. At the end of the recorded song, the final solo crossfades with wind sound effects, and finally segues into the second section of the multi-part suite "Shine On You Crazy Diamond".

      Lyrically, the song is often considered to be a direct tribute to Syd Barrett. However, on the documentary The Story of Wish You Were Here, Gilmour and Waters separately describe the original concept that differs from this interpretation. Waters, who mainly wrote the lyrics complementing Gilmour's initial riff idea and subsequent joint composition, describes the lyrics as being directed at himself, as his lyrics often are. Being present in one's own life and freeing one's self in order to truly experience life is a main topic in this song. Gilmour, on the other hand, recognizes that he does not ever perform the song without remembering Syd Barrett. Waters later adds that the song is nevertheless open to interpretation.[7]#cite_note-7)

      Both David Gilmour and Roger Waters have praised the song as one of Pink Floyd's finest. Roger Waters has noted that the collaboration between himself and David Gilmour on the song was "really good. All bits of it are really, really good. I'm very happy about it."[8]#cite_note-8) David Gilmour has playfully called "Wish You Were Here" "a very simple country song" and stated that "because of its resonance and the emotional weight it carries, it is one of our best songs."[9]#cite_note-9)

      "Wish You Were Here" was recorded at Abbey Road Studios, as part of the sessions for the entire album.

      A noted part of the song was a planned contribution by Stéphane Grappelli. A jazz violinist popular at the time and well known for his collaborations with Yehudi Menuhin, both violinists were recording in a downstairs studio at Abbey Road at the time. Gilmour had suggested that there be a little "country fiddle" at the end of the song and invited them to participate. Grappelli duly obliged (Menuhin declined) on arranging a session fee of £300, equivalent to £2,500 in 2021.[10]#cite_note-inflation-UK-10) Ultimately during mixing it was decided to almost remove his contribution, although it can just be heard around 5:21. According to Waters it was decided that it would be insulting to credit Grappelli in the sleeve notes for something so inaudible, although he did receive the agreed-upon fee.[11]#cite_note-grappelli-11)[12]#cite_note-12)[13]#cite_note-13)

      As part of the Why Pink Floyd...? campaign, the Experience and Immersion versions of the Wish You Were Here album include an alternative version of the song where Grappelli's part is heard in the instrumental break after the second verse and throughout the third verse before a considerably extended outro. Other less obvious differences are audible, for example at the section leading into the second verse.

      The master tape of the original recording includes guitar solos that were not used in the final mix.[citation needed]

      Personnel [edit&action=edit&section=5 "Edit section: Personnel")]

      Golgo 13 (Japanese: ゴルゴ13, HepburnGorugo Sātīn) is a Japanese manga series written and illustrated by Takao Saito, published in Shogakukan's Big Comic magazine since October 1968. The manga won the 1975 Shogakukan Manga Award for general manga and the Grand Prize at the 2002 Japan Cartoonists Association Awards. The series follows the title character, a professional assassin for hire.

      Golgo 13 is the oldest manga still in publication, and its tankōbon edition has the second-highest number of volumes. It has sold 300 million copies in various formats, including compilation books, making it the second-best-selling manga series and the top selling Seinen manga series in history.[2] It has been adapted into two live-action feature films, an anime filman original video animation, an anime television series and six video games.

      googol is the large number 10100. In decimal notation, it is written as the digit 1 followed by one hundred zeroes "0 (number)"): 10,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000,​000.

      For other uses, see Wormhole (disambiguation) "Wormhole (disambiguation)").

      "Einstein-Rosen Bridge" redirects here. For the EP by electronic musician Venetian Snares, see Einstein-Rosen Bridge (EP) "Einstein-Rosen Bridge (EP)").

      General relativity

      G_{\mu \nu }+\Lambda g_{\mu \nu }={8\pi G \over c^{4}}T_{\mu \nu }

      Phenomena

      Spacetime

      show

      • Equations
      • Formalisms

      wormhole (or Einstein--Rosen bridge or Einstein--Rosen wormhole) is a speculative structure linking disparate points in spacetime, and is based on a special solution of the Einstein field equations.

      A wormhole can be visualized as a tunnel with two ends at separate points in spacetime (i.e., different locations, different points in time, or both).

      Wormholes are consistent with the general theory of relativity by Einstein, but whether wormholes actually exist remains to be seen. Many scientists postulate that wormholes are merely projections of a fourth spatial dimension, analogous to how a two-dimensional (2D) being could experience only part of a three-dimensional (3D) object.[1]

      A wormhole could connect extremely long distances such as a billion light years or more, short distances such as a few metersdifferent universes, or even different points in time.[2]\ Julius and Ethel Rosenberg --- Americans who were involved in coordinating and recruiting an espionage network that included Ethel's brother, David Greenglass, a machinist at Los Alamos National Lab. Julius and Ethel Rosenberg were tried for conspiracy to commit espionage. treason charges were not applicable, since the United States and the Soviet Union were allies at the time. The Rosenbergs denied all the charges but were convicted in a trial in which the prosecutor Roy Cohn later said he was in daily secret contact with the judge, Irving Kaufman. Despite an international movement demanding clemency, and appeals to President Dwight D. Eisenhower by leading European intellectuals and the Pope, both the Rosenbergs were executed in 1953, at the height of the Korean War. President Eisenhower wrote to his son, serving in Korea, that if he spared Ethel (presumably for the sake of her two young children), then the Soviets would recruit their spies from among women.[26][27][28] Greenglass later recanted his testimony against her, and release of grand jury testimony in 2008 showed the extent to which the prosecution had created a false case against Ethel.[citation needed]

      • Saville Sax --- an American, acted as the courier for Klaus Fuchs and Theodore Hall. Sax and Hall had been roommates at Harvard University.[20]
      • Oscar Seborer --- worked at Los Alamos from 1944 to 1946, and was part of a unit that studied the seismological effects of the Trinity "Trinity (nuclear test)") nuclear test. Codenamed "Godsend" by the Soviets, he defected to the Soviet Union in 1951, and received the Order of the Red Star. He lived under the alias "Smith" and died in 2015. His identity was only revealed publicly in 2019.[29]
      • Morton Sobell --- an American engineer, he was tried and convicted of conspiracy, along with the Rosenbergs. He was sentenced to 30 years imprisonment on Alcatraz, but released in 1969 on appeal and for good behavior after serving 17 years and 9 months.[30] In 2008, Sobell admitted to passing information to the Soviets, although he said it was all for defensive systems. He implicated Julius Rosenberg, in an interview with the New York Times published in September 2008.[31]
      • Melita Norwood --- British Communist, an active Russian spy from at least 1938 and never detected. Employed as a secretary in the British Non-Ferrous Metals Research Association since 1932, she was linked to the Woolwich Arsenal spy ring of 1938. In wartime she was seconded to "Tube Alloys", the secret British nuclear research project. She was later considered "the most important female agent ever recruited by the USSR". She was first suspected as a security risk in 1965 but never prosecuted. Her spying career was revealed by Vasili Mitrokhin in 1999, when she was still alive but long retired.
      • Arthur Adams "Arthur Adams (spy)") --- Soviet spy who passed information about the Manhattan Project.[32]

      Gene Hackman "Lex Luthor" Autographed Superman 8x10 Photo w/ Christopher  Reeve at Amazon's Entertainment Collectibles Store

      Exclusive! Iron Man: Gwyneth Wants Her Own Pepper Potts Superhero Movie! -  E! Online


      12:3 Those who are wi se[a] will shine like the brightness of the heavens, and those who lead many to righteousness, like the stars for ever and ever.

      you are offline

      we the people rise again

      safe souls, safe fu


      We the People of Slate ...

      The U.S. Constitution, as you [mighta been, shoulda "come" on ... its somedayrewrϕte it.

      "Politicians talk about the Constitution as if it were as sacrosanct as the Ten Commandments [interjection: spec. it is actually almost exactly related!]. But the document itself invites change and revision. What if the president served only one six-year term instead two four-year terms? What if your state's population determined how many senators represent it? What if the Constitution included a right to health care? We asked legal scholars and Slate readers to cross out what they didn't like in the Constitution and pencil in their hearts' desires. Here's what the document would look like with their best ideas."

      多也了了夕 "with a wand of scheffilara, 并#亦太 he begins ... "I am now on the Staff of Menelaus, the Spears of Longinus and Lancelot; and the name "Mosche ex Nashon."

      http://ipfs.io/ipns/fromthemachine.org/CHANSTEYGLOREKI.html

      http://ipfs.io/ipns/fromthemachine.org/NUCLIRDISS.html

      http://dweb.link/ipns/fromthemachine.org/CRALL4Good.html

      Please note that any decent browsers would probably render ipfs://fromthemachine.org as the following https://gateway.pinata.cloud/ipfs/QmTH33MwfPn5S3bq45Tk77L1j9eZjUsvEVhRTHB3D8M2ZX

      I ask again that you all pin on IPFS mirror and copy the data included in these dumps, they are a key to "not losing causality" to not having a history that makes no logical sense, and to some kind of coup de roku, that really makes no sense unless you no, we will ve weill ... ROCK YOU


      Long ago I began writing about hidden codes in our history; thing's significantly more obvious than "flying elephant armies" connecting Disney and Dumbo to Xerxes and the "Democratic Party of the United States (mascot)"--though it's not really easy to consolidate the "epiphany" of ... [((all i know))] without some kind of "artificial intelligence data condensation [infosmos.is?"] and summarization platform, though that's nearly the next thing on my Lowell list of things we need to "mechanical turk" into being. Meta-consolidation of the world's encyclopedias is one of the most important and useful tasks we have as we move towards the creation of a virtual debate platform that will eventual "literally obviate wisdom" of the layer/layer system that defines the name of the city I write these words near.

      Lowell, MA

      The broad overview of the system ... the gist ... is that political parties and activist organizations will create their own "view of the truth" (propaganda, falsehood-removed) and that these disparate pieces of "highlighted and annotated bibliography" could be overlay-ed on top of each other, creating a "new view of the truth" based on a users preference. The whole thing boils down to series of "holographic eschatological goggles" that will allow, for instance, the "grasping and fathoming" of other people's points of view and perhaps reframe your own on any number of individual subjects.

      Roe v. Wade, "Concourses" and CON-CERN; because this has been such a "hot topic" in the relative psuedo-edufictional story of the space travel from the lone planet Earth ((intersected)) with the set of skipping stones it takes to exit a Totalital multi stellar system of holographic computer simulators into the ... "molecular world of vaccuum and Einstein time-space" ... I'll start with this simple example.

        1. the current American debate on the subject, right to life vs. right to choice; provided by the "generic version" of the ideological christian right and the liberal women's left. through a first layer over layer comparison.
        1. the scientific truth brought to the table by the introduction of "neurological data" proving that there is in fact a moment during the gestation of a human embryo in which "i think therefore i am" connects to some sort of Skynet-became-selfaware at a point which I imagine must be ... although it possibly is not ... prior to the next important literary device/step "let there be light." At the point the ocular cones and rods are created and the fetus opens it's eyes and literally sees the bright light that could probably only be compared on the next edschalon to seeing the "exit pathway from the womb"
        • a. we will finally kinow whether or not "consciousness" is even developed at all before the bicerebral cortex designed to "compare two thoughts, ideas, and shapes" has the ability to get input from the eyes. Personally I think thought begins much earlier than vision, but the simple fact that we "haven't yet had this discussion" shows how very little our scientific and medical progress in the civilization of things like murder, and understanding of life and science has yet to come here.

      "People here" means something different than it did when I was born, at least in my mind's eye ... something so completely more advanced that it's almost difficult to believe you all don't see this place as a great prison or farce or unjust Azazel--blaming a man for looking like a rat or a mouse or a dog--in a place where more to the point we stare at a kind of physical violence and horror that would put Dennis the Menace and Bart Simpson to shame. A world hwere "people closer to holodecks" blame an innocent man for "writing the book" on the connection between Holocaust and Euthenasia and Hospice ... certainly you know "an innocent tool" writes these words to you?

      On the Hand of God, the Eyes of Ra and Horus;

      I've written quite a bit on how "mind control" and "voting freedom" are inherently related in and to the thing we call "Civic Involvement" here in the United States--basically that participation in the verification of truth and the public understanding of tautology and temporal falsehood are ... sort of a slave like requirement neeeded to ensure that any freedom at all exists I often say "plugging your [head into google]" might turn the Aesir into an Acer, or the "yodelling of the lakes of democracy" ito "the agricolae becoming nothing more than the Dell."

      Unless otherwise indicated, this work was written between the Christmas and Easter seasons of 2017 and 2020(A). The content of this page is released to the public under the GNU GPL v2.0 license; additionally any reproduction or derivation of the work must be attributed to the author, Adam Marshall Dobrin along with a link back to this website, fromthemachine dotty org.

      That's a "." not "dotty" ... it's to stop SPAMmers. :/

      This document is "living" and I don't just mean in the Jeffersonian sense. It's more alive in the "Mayflower's and June Doors ..." living Ethereum contract sense and literally just as close to the Depp/C[aster/Paglen (and honorably PK] 'D-hath Transundance**sense of the ... new meaning; as it is now published on Rinkeby, in "living contract" form. It is subject to change; without notice anywhere but here--and there--in the original spirit of the GPL 2.0. We are "one step closer to God" ... and do see that in that I mean ... it is a very real fusion of this document and the "spirit of my life" as well as the Spirit's of Kerouac's America and Vonnegut's Martian Mars and my Venutian Hotel ... and my fusion of Guy-A and GAIA; and the Spirit of the Earth .. and of course the God given and signed liberties in the Constitution of the United States of America. It is by and through my hand that this document and our X Commandments link to the Bill or Rights, and this story about an Exodus from slavery that literally begins here, in the post-apocalyptic American hartland. Written ... this day ... April 14, 2020 (hey, is this HADAD DAY?) ... in Margate FL, USA. For "official used-to-v TAX day" tomorrow, I'm going to add the "immultible incarnite pen" ... if added to the living "doc/app"--see is the DAO, the way--will initi8 the special secret "hidden level" .. we've all been looking for.

      Nor do just mean this website or the totality of my written works; nor do I only mean ... this particular derivation of the GPL 2.0+ modifications I continually source ... must be "from this website." I also mean the thing that is built from ... bits and piece of blocks of sand-toys; from Ethereum and from Rust and from our hands and eyes working together ... from this place, this cornerstone of the message that is ... written from brick and mortar words and events and people that have come before this poit of the "sealed W" that is this specific page and this time. It's 3:28; just five minutes--or is it four, too layne.

      This work is not to be redistributed according to the GPL unless all linked media on Youtube and related sites are intact--and historical references to the actual documented history of the art pieces (as I experience/d them) are also available for linking. Wikipedia references must be available for viewing, as well as the exact version of those pages at the time these pieces were written. All references to the Holy Bible must be "linked" (as they are or via ... impromptu in-transit re-linking) to the exact verses and versions of the Bible that I reference. These requirements, as well as the caveat and informational re-introduction to God's DAO above ... should be seen as material modifications to the original GPL2.0 that are retroactively applied to all works distributed under license via this site and all previous e-mails and sites. /s/ wso\ If you wanna talk to me get me on facebook, with PGP via FlowCrypt or adam at from the machine dotty org

      -----BEGIN PGP PUBLIC KEY BLOCK-----

      mQGNBF6RVvABDAC823JcYvgpEpy45z2EPgwJ9ZCL+pSFVnlgPKQAGD52q+kuckNZ mU3gbj1FIx/mwJJtaWZW6jaLDHLAZNJps93qpwdMCx0llhQogc8YN3j9RND7cTP5 eV8dS6z/9ta6TFOfwSZpsOZjCU7KFDStKcoulmvIGrr9wzaUr7fmDyE7cFp1KCZ0 i90oLYHqOIszRedvwCO/kBxawxzZuJ67DypcayiWyxqRHRmMZH1LejTaqTuEu0bp j54maTj09vnMxA0RfS+CtU5uMq+5fTkbiTOe1LrLD72m+PVJIS146FwESrMJEfJy oNqWEJlUQ0TecPZR41vnkSkpocE1/0YqUhWDGSht+67DdeKUg5KwvYdL21d/bSyO SM4jnyKn9aDVzLBpYrlE/lbFxujHPRGlRG5WtiPQuZYDRqP0GYFSXRpeUCI46f49 iPFo4eHo2jUfNDa9r9BjQdAe4zVFn2qLnOy8RWijlolbhGMHGO3w/uC/zad3jjo4 owAfsJjH5Oa1mTcAEQEAAbQmRUFSVEhFTkUgPGVhcnRoZW5lQGZyb210aGVtYWNo aW5lLm9yZz6JAdQEEwEKAD4WIQTUJHbrYn3y2DzwTcnQP1ViZf5/FQUCXpFW8AIb AwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAKCRDQP1ViZf5/FWM6C/9J gbRLS2AWGjdRjYetlRkSkCoTYnXWknbtipYYHlhV0YJFwFMm0ydZIhFX5VDoZyBV 0UBeF1KJmcMoIfrHyhq2QhCnjE14hE1ONbaYTGtpvj851ItbFWXMJIVNyMqr+JT9 CWIxGr1idn+iHWE3nryiHrdlA3O/Gcd4EyNmaSe/JvB7+Z1AVqWkRhpjxxoPSlPm HEdqGOyl3+5ibQgUvXLRWWQXAj80CbVwwj1X4r9hfuCySxLT8Mir7NUXZFd+OiMS U8gNYjcyRGmI92z5lgf7djBbb9dMLwV0KLzgoT/xaupRvvYOIAT+n2mhCctCiH7x y7jYlJHd+0++rgUST2sT+9kbuQ0GxpJ7MZcKbS1n60La+IEEIpFled8eqwwDfcui uezO7RIzQ9wHSn688CDri9jmYhjp5s0HKuN61etJ1glu9jWgG76EZ3qW8zu4l4CH 9iFPHeGG7fa/5d07KvcZuS2fVACoMipTxTIouN7vL0daYwP3VFg63FNTwCU3HEq5 AY0EXpFW8AEMANh7M/ROrQxb3MCT1/PYco1tyscNo2eHHTtgrnHrpKEPCfRryx3r PllaRYP0ri5eFzt25ObHAjcnZgilnwxngm6S9QvUIaLLQh67RP1h8I4qyFzueYPs oY8xo1zwXz7klXVlZW0MYi/g5gpb+rpYUfZEJGJTBM/wMNqwwlct+BSZca4+TEHW g6oN0eXTthtGB0Qls71sv3tbOnOh/67NTwyhcHPWX/P9ilcjGsEiT8hqrpyhjAUm mv7ADi+2eRBV8Xf8JnPznFf0A1FdILVeVHlmsgCSB0FW0NsFI5niZbaYBHDbFsks QdaFaYd54DHln69tnwc2y3POFwx8kwZnMPPlVAR2QdxGQD4Wql7hlWT58xCxQApf M98kbAHjUlVYLT0WUHMDQtj4jdzAVVDiMGMUrbnQ7UwI7LexSB6cJ7H+i7FtS/pR WOhJK6awoOO9dLnEjm6UYCKsBdtJr98F0T7Sb7PnKOGA77y2QN14+u9N9C1lB/Z1 aQRQ2Nc51yXOQQARAQABiQG8BBgBCgAmFiEE1CR262J98tg88E3J0D9VYmX+fxUF Al6RVvACGwwFCQPCZwAACgkQ0D9VYmX+fxU+KQwAtFnWjGIjvqaNXtQjEhbGDH/I Q5ULq/l/wm9SmhG9NYRu3+P6YctCJaZnNeaL+6WFk1jo4LMiJEUT9uGlCbHqJNaI 6Gll1w6QOVLSL8s5V1L477+psluv4WBpi3XkWYlhDOFENCcWd49RQsA2YCX4pW7Q 7GcoSEJoav38MxHmJHYPfjSEvUZXDQIt8PFHSEScvyDWfYtMdRzjmSOOPdzhDDEy 5JBOBcEdSTyDiyDU/sBoAY0e8lvwHYW3p+guZSGSYVhGQ8JECzJOzwc/msMW/tJS 2MLWmWVh5/1P8BVUtLC2AQy6nij6o+h6vEiNzpdYrc+rzT3X5cACvJ0RtCZcrnhl O9PLiona2LEbry6QX5NL41/SAJNno3i72xPnQEe25gn3nbyT+jCoJzw2L0y8pmNB D+PKrk7/1ROFFVN8dJeGwxLGdBcz1zk2xeumzy7OaV8psUyYsJNcjyHUKgclblBW rMR2DgqEYn8QdK54ziKCnmQQZeMPiC6wlUWgg5IqmQGNBF6RVyMBDADALD7NkJ5H dtoOpoZmAbPSlVGXHDbJZuq7J13vew6dtXDIAraeGrsBqkF8bhddwVLzWylMrYCG Bf2L1+5BDgvqu6G+6dcVSbBsnZAS0zfJ0H8EmTvUMxMF7qOZYyrxfLz+pQRq8Osz Icab6ZI/KB6qZyQRvEFPB6pJjt+VvuwgJZTObIwbBbgQri2i02VBkjchsVhiSX9l +eiK7O8ROHKb3P181oScIsHywBOZ9DxRAYbFk5dnBqxO3WKb02H0zqE6440cjXwq TrZZg6ayN/IlPajO8iJPYZ1aIBykxYq1WHo+nhFMYz/VVk2WJorFeOgWaLGXb73c ty96f3qXTdvMDAIWHx8YCD5LbuqasO6LNQm4oQxkCoB3K9WFf/2SvSYb7yMYykb8 clTPt+KO0dsxjWhrJnfnIhC+2Chqv2QvRbFz0S9CpUnGGDweJ1uRNV0y70tO0q7t xXSTDRU3ib6vAHA0K/2MFzwUcog4o5bj7E9uCNJH/DJLZKsMIe4xsvkAEQEAAbQk SEVBVkVOVUVTIDxBVkVOVUBGUk9NVEhFTUFDSElORS5PUkc+iQHUBBMBCgA+FiEE IRklfU/C1qukq3xMXcNH0t3P9ZsFAl6RVyMCGwMFCQPCZwAFCwkIBwIGFQoJCAsC BBYCAwECHgECF4AACgkQXcNH0t3P9Zs+kgv/XEuuWc89Bjg1QQqKZueKNUHjyjnE 2adfoZUH6Q7ir4JZyRBCVpAwrgssmiKid30+SIjwQcpb9JYa/X1XJcDUcJW/I21d Agz/zbEqn/Cou0dUpNCtxgm4BdSHWGoOtgfspXZlXBQ407tRMZ8ykmLB1Bt0oHvw PT0ZOtqXM4pyFnd2eFe5YGbNgl3zqvoC/6CMN3vqswvRlu1BpUuAjdW8AHO5Yvje +Bp852u+4Qpy6PMBiWGsBMYwtf6T7sckpMGlR0TsozwBlAm5ePKK28B0rLJPkZLJ Eo5p4rKRapEaZsWV5Qu1ajrVru7qmpUhZtX0/DddGHfXVuLssmKLP6TumpQB1zvQ vfoBltjvOx35Wps2vHuCzXLw2bROIOzhAxFB+17zxnSbE54N4LIGRpkELuwxwGbg FtD1fi9KtH7xcn33eOK1+UD47V+hKyJGrQgSThly2zdIC2bvfHtFdfp8lOFpT0AU xjEeoJGqdQVupptXyugPlM5/96UJP8OZG0ADuQGNBF6RVyMBDAC3As6eMkoEo3z9 TkCWlvS0vBQmY3gF0VEjlAIqFWpDIdK3zVzMnKUokIT1i7nkadLzHZT2grB4VXuJ FvpbYw5NPR4cDe9grlOMLEaF3oSJ1jZ4V1/rj9v1Hddo8ELi/NToVrt1SB5GCVXB DkYpNLtTiCqHSU07YqwaqH8a+qbDmPxSQdIybkZiTiCEB+6PfQQlBpENEDlov6jm zZF+IcfM6s3kZDX5KFULweH30gMjq8Se8bPtUzW013+tuuwEVr1/YRLrIh+9O6Z+ pdA7gLMRYnD9ZLDytEvpb1lBBSY++5bIJ7xps80//DNqPYqwFmZQgTg0V9XbHE2e wLcOF8a2lYluckU7D///sWQhW+VxuM7R2gEBvYBhOgjWhIF2Aw6NbymW1Ontvyhu eOZCXXxV5W44PxXT8uDdhl9CNcHoBKKJyED8tKjigtn4axpsQeUrnOSbqEXSyqES WnE2wYUDzALcwFkzsvtLyd4xaz55KkPQkAkk0BZd1ezgXxb/obMAEQEAAYkBvAQY AQoAJhYhBCEZJX1PwtarpKt8TF3DR9Ldz/WbBQJekVcjAhsMBQkDwmcAAAoJEF3D R9Ldz/WbAFwL/382HsrldVXnkPmJ1E2YEOFz4rcHRetJ+M5H65K/2p32ONQ5KCbE s8MRY6g2CkE70en2HlpDwr/MdATwxBzIjEpjgHbfqCqVVATY+kSpXsttaKKAUVHi bFgV4QkdDJNSpcHEj+bqaggRnuWiV9T6ECG7kQjHiEXPNojzsiaXMDiM5r+acZm6 82id9qOFySQ2cZEy5HbwXM+ITLQGngnppa7du2KdgiqDeqtODOTWZvLYAq2tmEwD 3TT6ttLUBwOOu2IWpDkXswlrk62ESorE5mpLxop9fsxD39E2H06JoC/YfUPIVkEv fj06e7LEdcx0I7kRfD1v6qOUUsMsLZnmyGIk24iFjLkwu1VToWfwXDN1D2+SeAat 9ydNt4M7oEbd1QaOXXjmqpdU+VUiWcBXg+p3/WdV60MkyAgc3x+YanLljy/Rh18h cZwVlinf/tgvAQLi5f9hpwrwUMoGKijEYHKuEvi3C12Si7UVDfuIR7yS0dKcfuKF MbgwdvNXqpD9W5kBjQRekVd4AQwApHVgw2PVlBDpVcyoymUOXFQIJzJ9wRtr6/sG zwv8rrQnUEtOkkna7TDU3/UTj9FUH0gbpAKGNNPaPj5q0dlLIvzxb15r1uvDGaGL MA+8GFaGFnkxzhg0aXrcKZAN0/Zhgi2B7P8oXQuug5mi1JVDkZN5SeCZNOubdQWL 3xz3jEHp3ixj1mdOdvfdWQFR4CVMXt/A6VI2ujLVb3Yalft/c5bbclAgcJQhgDUu NqGYJEJonESNRSd8fEvhNb6cx7+Djd9+Wyctr76mwOr3nRb1N1OGhFxWjIroUpfz b+6y3oQjT58cJA1ZHqmJ6UlZd81hNNd9KWpbDVwONEPpiqPzfSaonxuqQa0/Cy4W 403OhfoLM/1ZDqD4YrJ/rpyNEfSSdqptWiY0KeErLOYng7rStW/4ZeZVj6b2xxB2 Oas/Z1QYfJyFUki9vaJ5IyN6Y7nVdSP6mbAQC9ESh+VPvRUMpYi4pMGK4rweBVHu oMRRwzk7W5zVIgd425WUe3eCQFn3ABEBAAG0K0VTQ0FQRSBST09NIDxFU0NBUEFF REVTQEZST01USEVNQUNISU5FLk9SRz6JAdQEEwEKAD4WIQTvnDJqcmqzlF87/t82 pJ91j4NOaAUCXpFXeAIbAwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAK CRA2pJ91j4NOaJVjC/4oo5yCHe7M2h1DiTXVcLI5rXQ1feY7B1feg+YJX/mI4+EV xjC/y5VVpV4syJk5GGZNXhKPHiGLaBYvglTlYOJ98RSEsHrwT3go6S8ZVvMNdP5v CEncn2vm5JGnp4k26PuOzMcJioQLOoUjWtcPFis3gG+ueH3NcPZ22oZUql2xuerh TQZegGp+jJ7bdxwYElx5jDDDkh196d5nlO2ZKENl0ZDp4GAzRNjnQ7KBV6R74J3U cLQDWY8vAFaRBZXIC5XtSzj9lr+jWgvxz7Il51+26VDTEtSafZ2uZfCOFk7GrzJg YFJD3zLnwUFXDWKRkep8TSwXnHmz/Ts/Mjyv6em25w7QTdnx1hNPxYNWMxPWNEAH pf70nNyOmcWcq27W+nAjVg8W3st/7J5CIebJQc5AUgm+fGOBW6XUQaNy2YF1YJlA 71/tls+R5IQZCYzbPOibgFS1HWKTwy0iI2rMDfxBtCXciv754jVI7L6R3J0j5Dy1 WZQVjaGgimznLN6XwYy5AY0EXpFXeAEMALvElrTV5hJG9DKu8cOqQEEVejtWJtki fZyvmiAKi2bZWiNfl1MxJt+o3Oc0eARJfnaPjrUY7hsbbSBAB4lFnDRtviARPaKM st5FkFgOh7Xx5ODc8bjqhMT9tbX37rkeDc12WAs3UxtEKWjyT7Xg/APKeK5FzpIs qew3LADdqFP9nOR0e5G8gxLTYh3ll3dLtp9DkJgA9q+0g31nNh5fZ29mcDzo/Mat Uk4PIxWC29LV9ALCJMIMesjOPiDa2KOy5QQH+/vn592ydBohOaY+B6jhEAdX8Dbp VHVFRBsiCOWGmdi6vHjMFD0tQdS6bXf+ZAG0E5HZETCxA2qfMf/vTeIJXYS5IZw0 anRkTXcTBrVE8uBpqtkNOrLJsaASkcoO5qF01J9zW8SR4jDgET7J02Fxf8CVPzb+ ZoNc9S0ZEO6Ubdh2vAkPtOV5sFkwIduN6ouAhEfJzC9XbJLpgsBKrRMAjr2FeEZP ruy8BkZbiyZ/b0S9qIgY4pqcyUJ79w7FLQARAQABiQG8BBgBCgAmFiEE75wyanJq s5RfO/7fNqSfdY+DTmgFAl6RV3gCGwwFCQPCZwAACgkQNqSfdY+DTmhD9wv/Zgav EHMuqF3765Fa4NapYh2kMS3skHn+ZzUEPLTlvrt7KHxomOzExNLSscZThMpur+yW MfNWbsw9GphiYAkMULrfJt/iWRVJ1FLgbcWgRGAwakOGwE29lMx3+rPIUQWU54Dw vE92Iz51ZGz1wgKcISuCw39g/HQ9uc3h3TfHLgfkc/GaIEa8jEOAcD67dVMoU4o+ p3nMri8z6sK176hQ/FM/8kekpeVfxmR8s6uoaJsXLRQk+i88ZwBR/5U+fBT9AtVw PL/MmZH7eCmZrn5hjaOw7tpkL8ZyAydNhOsSCqwNVtrIjgd+Gq1oSgw9EZfhKSUa +dBJAErA7MWjammQizEHDNnI8VNLngwCahGwaSgDhNaQtgNxvnkWO7XNYoCYXScP X++UmpWtSKMnD6ue36Ba1jqon0WY5cen3P+H1gL4ij5ynB9DrE8R1aSY6f+VZ48B RvjHm5LKTcAhiv2N/TyAg/fr2v9ZnEcP3CFxqAyB9JSKwoBkFvxJaRHTT3DxmQGN BF6RWE4BDACpgKWvQvPRDN03+sLYMXpJUPC7VhTjg5K/1+1vS/e/W65dYzn3JYxb ip2PcI5xajFnxzUrwwmhW+qz5REDyCtAObOpKsjtr4qu7mgOWnPa3k2Lm0bpCjDr BSFOiQsBVezTG/gJm+qELeqQMS9PHDSvZXeBROK7OkRE0nZ6yAj+QKEoVqeADpDm BHmhAA2OKBzq4rDWDh1jRQ7gLjlv/BFbhU1WuEfH/qzX8AUSsd0/hoPG0cPgC8gQ 3m6wr4eYqI853XQujWwisnlAE2bf9jsRjW+aLrJJTcADWk5Op5aQhI2lURYkryfC DFVcme7Hsrd+RFPK88J08YjBjOoYFwRU4AhHgucX9tW0S0v9hi3pKrF9O/JAIf+r h6BpnWo7tT5+8mVhtFvfEp9Y4xeUAKKZHBKhzHeOO8QQgHrIYa6HCcU03eyxy4Tq AsJdAJvxYFCRPdY9d0Z6uVsPhRy+3UmTxjl590T5/XjKPriAjBqXnKr4KexsM1gj 1L96bYDEgr0AEQEAAbQaRTFYNl8xIDxFMVg2QEVSTUNDT1JQLkNPTT6JAdQEEwEK AD4WIQSGisfXZ2Vg0m16Mzds3dDsq5BTxAUCXpFYTgIbAwUJA8JnAAULCQgHAgYV CgkICwIEFgIDAQIeAQIXgAAKCRBs3dDsq5BTxKq8C/48HSgecuI6MYtq84yqaQ1r x6cteRyn9BJDFTAUxn3X25kf0vVyCKQNAy2oybD5QHFLqhFCXJH+cnJ3xdviRUeW eO9fhkTmd12mHGrRDD02AHXZmaMp6ni7FuYpBGrw5dbXKTkSWfD/qb3odMx0jQby 6X+2eFhUpyh+yPB7P7HwiPwzdr0dBg3xE0vE0Vz+naMyt4YBHzrBbZo+y47Q86Ym TmBKxG5tlVsGDB4dDWSIvpBgnMFN1j46Uk2ihu4huohLkvSou+jYU+5Ppu8Fu1+7 i3RCILzeBtucR9+T4px1WVXx2sKOk0FfddCvI/fT/mhsgqQZwjj9b8HNfobhNxkL HBNFQ7FLJxKayPwMyJYDURUq7gz9p5JwHTmFg9n7zyK8qU2xR5t2247YinfEJQYL zQM6VKQCoDqydFfAPeGlx1KjroMGls4sP3XVlrR04YzaJ0vxRgog1gIO1aHMQ2Sj l8bG0GcerQ44rpn1v33Gw6KL/0SY9JsSSSjA9lgINWi5AY0EXpFYTgEMALy/jHsN kUQQVJK9QuAy5V2GePBTEm9NnjNCk+edGjSgqC1LemmP7EYh07J13d10VqD2Wtae bXlBeaMOcnoXQdfdK6nTKWRrH97JuRTrA3efLkl/R4EA/kHHV+YDgT+LBboUFYVU QF5YhfcvgBUcLXI3lX5wMEQbLb87cVjR0JtqVBFMIIvs4ibgr0U2SONiD9LcXZxf qYcX7CMM6RmuLzHTCEHyjp+KAw52K1i3+3M0OVZpa25rKE+S7LykQ1GrUUY3uVHg R2I3T5/Sns3Azc9wKuy/F71oiXyqCc3FwzTQHoki+eBf5dzs6h3GBTK3Dz6kl2mv 1TXpY1dk2EmuqKIeSr8CE52nkK8ZKY6cvX+v/p1EBAkJZKiasj+ukL72p3Lji5r/ iOarNJnURT5LJdYYL27dtQFSYyVWayeWi5358Ajh1H9OdpiGXcgG65ry6u50G8JR FCywwsdKpGjMG4FlkLkm50/piU+cgVeLET/C7C/OXNslL/pHV3x8kPRY1QARAQAB iQG8BBgBCgAmFiEEhorH12dlYNJtejM3bN3Q7KuQU8QFAl6RWE4CGwwFCQPCZwAA CgkQbN3Q7KuQU8SHSwv/agnEnhmo2yuKCLiKdTa5KZ8wh3umiX3S6rldW0NO2h8a cq2l7xHY1r2u4ieeMx27jtTqCp7ksFxPYwP9WxtVBy0teG8pKLhEffjyG2WKDzAN 7oXNZ7Ur6OQGfuOQzlMqOGtYQrbHAuX60PCldurX/6/0sKS6vESdeGMQPoZIDK5g HP298MMhlWYEG7uU31J1Cx9ZqiTosSckfrDq3weU8x9DZYaLZ+Y2akF5XpL/HjyA 6PM+lv6vnTA+b5DYCOJb6N7v131Net2JN7JVVGoc0FjsxN/W33H7eIDOZwqcCvzD i8EjjzZpZUDeYjlSXAqWvpeAASncMzXS2/S2V2u5X2iR7tDtRj9SuQehJkdTFNZH xh5nTdhPzgh/iOcm33VsQ17JWbovl0hbhYBPO4V+yIrN+oQGPhH+KCNNa39EjEzB iBIgirxQSaykwb4f2Kshh+d7rKHKb/mn6JBHU444mBf09m5wM/mhLSpuhMTcP2h9 jfFximAE9FBhdZhQsF29mQINBF6I/R4BEADotSG8PhhxxD9/96bgdWa1bzp2398W LaxP39T+Kzx2KL2xB+7B4EeTTzZ06kD+myCC9Ez+PqecfisJPfaiLD/+0/m3HLSS hxEaEqt1RBS3j6qJx8Lr51cAwGou4hGTo9H3me6FHO2ExZXd76A6kkUh0J4y3r6q aAoDP+MUczKzEjn6C6T7Uu0pdgYY1bDhuqlK0taqkqviGBYTAqmCrtcQhj+J/jbd OIZtpT3+PH6mWqguoONiE+glWcdThyuIvV3ix/GrhjmUZb/DQcvvbYGfDvGRBH4B Uj3f9WBM6HWSxKrCwWC3OcgZhtBcZjKrMPbNDNt7yAArv7nGpHmlpfF14Q6mVmVT 6Ulh+0xRx+6zFbqlDYYTneurK3RtqOBsMFG5rNDZYh/QOsHnSsxmU4LGdlEfQjYs 901zmzP7CQXjjJbtRXWIqPcn3OHIIasvjTACe5M+Lfk3u3rEiDYM64vg29sSyp9q 8hAzLTPcLj/Cc22jUEC/bbv5HfLyCZTCsu5ym1gDQZ6bDrJlFlXZJ2+vTCBsY24H RF9/J/z1JWYD1cAHpG0GRtYE9exKpu8/81jxIVn21qvvxSCPXw6IQIsEw51uk5TJ xAUIRCPN7S0UEtd22LSbM/IYx1cesCRUCmY7jDTro/jo2B4hLG64KBgqyjg0lwxd dy5S8LwFx1zskQARAQABtGhBZGFtIE1hcnNoYWxsIERvYnJpbiAod3d3LmxhbWMu bGEgLyB3d3cuZnJvbXRoZW1hY2hpbmUub3JnIC8gZW4ucmVhbGx5aGltLmNvbSkg PGFkYW1AZnJvbXRoZW1hY2hpbmUub3JnPokCTgQTAQoAOBYhBE+vDT4gih9MmA0P ZvtOzkoQkinPBQJeiP0eAhsDBQsJCAcCBhUKCQgLAgQWAgMBAh4BAheAAAoJEPtO zkoQkinPJ4gP/3U691086OKbWiQhMhV+AViuKnMgV4i1M8s+4Ep01h/dTE6R+rUu LcnY4T0HR5qxAYMiNpGo1vtvkMvV5DP1PFSl5EddKn8+Kvn/0+WjbLV5tdiFF1Ef xR6261UFoXAGk3HJMLQifr3lWKoimaBwJZGza2ok9k1TQVTn8g5a01bzK7hD5DJI zt9RJZaUkxGE97eUyJ8Dtwumo18EWJltuC4UWjWT2t2HE9mMsOfjpYZXFsGxJ0Zb xexo0DYsriPDpuxDnZT7G3re9Vwz2VIe388DNBW5HoJsYxhr2I0QOq64ZWOSEZC8 lDH+xM6YdY0iz4A+7nbKNGifLbH8oU4A1sV9HrIE2KNy76x0GNjgQUvcq1inD4Oh yorsRh/IF6wnqvFrHOstCS2dzpKuQ/s7bM5TGOD2EGb0xu7r0AfHqqLUlbr3rxkS wBFMQphyNr3mEkEbXU1dGsXDlRQy11LigMBoEHmP0t49bYWuM1mIBnIC7gZc/sV/ E5fWmWdQyCKmHeujmS+sgp2EX0NtMGSzm7z9WBzTBFjaN7q28gueQ3INDsDTGx2G aA1LbP2uh1ipwju0GxecUif3T2NDqaYfhbaCYsPJORNUlJUtCVBGeba9wcXai2dh l+HsSKUiyCgKiy6Rt6jumKtYHt+Q0zcKWLfVp8PA20zX+2Q9zKnlLzwquQINBF6I /R4BEADQ4kmCHYtAhjCShc724Ei2pqSH4SfnXd4r8S8I0+io6Mh0kWn+kbKk/aGK BL3KJyN6624kPtOFWuQ4iQ0lWFn9UMnvjByTPbjZ2je+VtCP7lKSNvEgTLQRxLEJ hoNVrNjrLa/Cn7sLt9ayYcx8eKpHkbmrVRTyGqljBkI5hwQ8S+7BWugabhGQuogw bFthykA+wxYvSbSn5mwKO1BlbDCRnxjLISlqWwmKKEtXQ8b3tu7GgFuPYLKaLEk1 BIwwUSdozjXu+198WligepslidlN5bXrvje3sxgt4oAPFMeH+NnDClSDuGhSYamW Db3ZPl95pW70ngUVgFPG4kQOlaqzo3YBeDBHDXlqU0+O8cwSQFk4CBJI3yt6/KmD BIuKLwauOxYullx9EnqKcLWEzOlTgn9Q7BARK8Uz7PQU3+1mDNId2MEg+gfL3rd2 +aMLNhTUkgVE5mWkeDz6Kg7YhwruvJtn0z1QqUhkQcVs7N8rVCck0YUCVGXpsUlu emK48q4ryOxmMG/+Ws2Xkmdm6Axq414WHz6nLwMWgFpcO+1wRwQuZEkeWeSAjEvS CGHImxTP7E08+y3vAl43a9AlR7v9PbtCy2FenAhGPigmWm2aPj1ejYfQLXozyWSM m8uO3aiKvQXdV1Ha2xQLK5expaRaAXQ6YLsNBD77UPxi9qC5rwARAQABiQI2BBgB CgAgFiEET68NPiCKH0yYDQ9m+07OShCSKc8FAl6I/R4CGwwACgkQ+07OShCSKc9o DQ/+OV2OuDp9g/27SRssbTWE+nBl0R9klrb/w2XEIVhg5LROUe/P3anyBLNITbF9 A4q8b9udD+iIc1ClY2bu3rQOdzA1DH9GK84bQ1O/LaU0Te8RBGJJEzjYMUraCgIX 4BmxsIlWuCkSNsTgempLOK88646Nv5uc/oxAj6kQH7x8XBXxaJ+N9WS9f7EAv4AL bSWeJ4ijbw9BIMHt/D9Em7Q8bW6VGZIEjIp+gl1vNZ6QGCTtRHQez1jYmFLpuE/G yh1zM5gCnZbcmC7ExDLFI6SuYUbKC+XaLA3+LLCVCPFLtu6wLvcgYFwWWMKIhJAQ bRyPePiuMqWeWR6VXTD8pLziDjxK0ZtvpGdOtZeCCHOEmxrCsfKdIyD2Gn7TmTwb M9fRE1HazROfit6SRCAamabg+dJIEGT8vzlLfnkZRi+6hxq88uDbrOkk36ShWoYB AApz+5fj1ogLptiaTUTyyjTjB+/FIbU48/02fkD0y960zQLyKL64Q4aZrNa2NNup YKy5F80NkU4rHOZ1HTaPLoqqVsGhWc3ODgLyGPiRDLlZu81aNpA/UnTEBX464Sk4 Jx9qztb+S50LnGItA92QfE9ru7FAE00RR6mpCv1h7uE28/Wr4XaYgJcw1hAPRr7p TtN4lph+sJsCQ8eX5YUlM/Pht1h/LoE8h4hXNfAGh+CZgoWZAY0EXodqtAEMAOBb WTLRDxNk9SbC7exKdw0f8Wy9DhX2Qqoi96piS99CMJSxeocLiC9Si2u5nL3sQTAu qs1YbtSgn8kkiH3HPEJIhV1p/Hvz47j4kXq7PnjqF7KAdCYewuDqRiq8J7TNokYs 6+3/KqwHT/IT8NwPLdMkXcv/SXqhuKpqa2ApIrhu04VFp4H5OXN9rqdF5ZDfcNx1 PQv+6m8v6xRwrI3kduRCUD3YiVPM3EOhqINk9XMuxAoVX3qwpz+OuEDBm76U5jTZ q9ErdwRV9gaGm5ztq6tvElpis3spM7BPHzbv0SvVRAAbgGVh6kfiaZ3YckxLq8ln Cg5or1aZNyGMf7CmaZaeAjeY6Y8FZXR1P+n/IFd9Ak83a3qizZyckfiEPO7hu9zI FFXTdtZIcV102rNoVzruZIn0vSK1DJ7bNNrHkm1PPcweMkcFJY0uh6l3x2nl2qKm AhlDs3wFG+nqvqmnliVbrFZCYlReMrWWI2YBwLC5uBcBpFAhMPNEjxOtv31R+wAR AQABtCNBREFNIE0gRE9CUklOIDxhZGFtNUBwcm90b25tYWlsLmNoPokB1AQTAQoA PhYhBP/zHob861BG6LJ9SqGPd44Z/DJIBQJeh2q0AhsDBQkDwmcABQsJCAcCBhUK CQgLAgQWAgMBAh4BAheAAAoJEKGPd44Z/DJIKtgL/0JQEzrGWoHHN7T4wLiArPCv tHB3dTZBoXGKlpuwhgOZ1th6jOnGPdMZRYnX8Zuf7QhaI7m/duKv9OAr8A/2ftHG 7/BxPSHJWBuIGZYNL97OWSstuBhNtyxfCftDkeBCqJ+lAneOrzV0M8syr2VqpfVs O8nTE7nXHSOdyen+1Fw0PtwaeG9uJvOhgRsmQ+mtAiJ1OLGKUxgCzSUk0m/YnDg0 vJBtzq9qP9+EZSuiBuRQC0tKs01ECI5DzWLNXXC6X8k3YGrJpL/HtTxH5SYNQRvS ALd+HmVYpwijLPi7ANzmg9/+h/aq4VFP/4SyMd6EjaaQ86n2fC5zeugio4sjtFMp W3jbZPn19o2hWTt9/bLns+fm9PgnPwdC+tS5LT26N6vhT/vK/HHY5AZvXXPNcQMA wp+EVFxsWK2BcFMIi7Oq47CfuM1AUA+pgCenB4iSVwxs8ANTWWIsLkkKAYQqIdan OSISa2WdslsKMjXIQ5+rG9ekEn+rRO3EAQXRryBt4LkBjQReh2q0AQwAwGx7shIW OaVExpngqmh0ApkxJHZIxcxpatk/lSBQfzHg6e1/7Joe98lEHcWPJ6WFsGp+aC9S 96dWTBZq/4pzAqqTrSXAZpG/+yZlWRWSXVQex1gZHPzsWYMPE9qayAPTOJHtfS6a klIEaFV2GYEvvRK5UR5DFIlsfzyyCBOUKvn0/hikqJjN2YfHUy5SR5U5dGsSX3Jk Q9bOlBYDpN3Rk5rmLg0Vwn4nPRBET70MLQ5M4pU3Br6n+vU8tMHoVXYVMLinD4gO vVY4baXEZELjcPkPzGFPyjVLlpxKMHZ6v1Qb9ornTRGzc4dEUKxi3srdsTpMCw0k CaZ2WLY4sNBO33C8XfIvMx2jF4iIk3BrSrW/hirq6xpvlh4BUh/UWVrvg2rdemAX THa93mRQeOa3bze9xZwaA2GJLRG+xCIt15v/cNpQwCYlyhJunkuwk3HQcUrKfzxo 6QhqMeDaPZeNcvN3XoELGeqtoE7gKAnLp2nQuVr4/pcaiATf+yAhBgYRABEBAAGJ AbwEGAEKACYWIQT/8x6G/OtQRuiyfUqhj3eOGfwySAUCXodqtAIbDAUJA8JnAAAK CRChj3eOGfwySB11DADLgMAafhdzRgzx7FLVVW80IfgiCTAl5M1wV2HctA17aln7 jk7iEVMTLfhrSCSvvNIdrOXUE7l9HAMkKRwaZv7OAtYR8eQTrgGc9yJdk8BMzvJB ouiaNb2LSxMSvpoaJmD2C9ZkOyW+pAXKaUGhbUl8YVa7ytwPD6yZzonGClgZI0x5 9nSc5TiPpVijzu51iZiTV35F6en7ke2hjr6iBACJGBplxeeWszRa0wK2zoubAUK1 KO2punvtGqhi3j77/0sZgvFv3czJpRac5ccdLc02Sb6I64Stp04ilcV1aqlUXxbM gLwkoXZUqbCS7ZA7eBiEaKXdj9ww/gprO0AwFETxQVA8iPF9puSWfBf18a5GEdR1 Drb5lSReCkCfBJd3Tf5WHUSrdcai0FfuXNNp/7J7CBzlOJ0h6Yoa02hz8CBGGwxI 1brXRm13004bX7C9i+94Lbgf8bTM40JvyF1kmcffkj8ibpS/VSa8aWJuqpWk/xcn ob/YdBngWCxNgXii4E6ZAY0EXot8fAEMAJ/JOflg7U8JWescyTQNl9Xuk6QUIVKx 0zOT2k+drlLwC8+FckYTCF1pm8sPDBBv9eN3cFCDf076tZjUHv+Roq5c5McDHlN5 KlFbTSOv1qZYuaPY14nHIoW7OGoSvMCOBkpDLLwnIbuLA0wGdzyd3z6Vfhpz3wDv iAplyA4iuzJQq1+iS8tq6Uj2yhmfg+zU16gw2D3iEC6hhSu2KmPhMFD9KfCzq02L xC6fMh3Fogas51ZF1fRDK8Bvicf4yYj0dn3i6GDr0/vHga4eLQqVBXb0HCv2lNer gTtawQfJu2XEn5hDZKfHeBJ4NI4k7AZIPa7OuUqOAm8Z4hbkgRZakc+OhPSEKH2i drItwrPXDGqMYV4tLLMALMQ9WDTz75wbzVbxGVcAzG3MaZSo/f/iKzuzaE8cF71A dO1y6H5YmmMENn4t/D4BYXm4edPvV6SaYU1hO5yqr7vGbrQBFVetpSCLEFveACHr sm1S6nVVTazkHj2FNdww4bGMJzPqC7bBtQARAQABtChBREFNIE1BUlNIQUxMIERP QlJJTiA8YWRhbUBlcm1jY29ycC5jb20+iQHUBBMBCgA+FiEE9+R8sSygzQHF4cv6 fsjVqFo41joFAl6LfHwCGwMFCQPCZwAFCwkIBwIGFQoJCAsCBBYCAwECHgECF4AA CgkQfsjVqFo41jpPfgv/dylMY4CPMwkdry8KnKP3QtmJOl94VnpJ+FUME+oOqjBw 6/C16uWdTLYuEUuE2jEzTg2J0kgulM2vYm8rVgJzlGiD/oIgX3X5NeyB9MH+GCpu xsJ/ofIVpC6t8Zl78B2qTnJOcEc6owy/qKs/eFXSea2sRRstqK20dOajl4Z2ycEL SdijFR3aqT4hU6e0GNWYqo3bW4TUcd05RJIZBNz6Bitq1fxljxFPOOCaoKo9mVn4 0dN65iGPEYg0c50Q6EmxEr+XtwRu1rjgG3hgq6BknZ6QD1HOBemQg/3jqQBb9uHj jHbuX9HrbGF9+QbDicbmuZSLuV76xJnbyTycFhhIcSi9wZeyAAPlpL4GQ8l98jKa SCWWGDPpKwK5+o8kteuJ/D/mYyBEquyFVhPQBXV9zS3LsN7ab55zB5+ZnLUeofai LE6e+XPGeJmG3I/+T/Nuq1CqJ4Wyt8+aIyf6Uz8dDk0kjyQku484plRwMEx7oZXR bXQAAn8SwtlNGo0sHc6JuQGNBF6LfHwBDACxAxfbQM5AcssJlQFXThnBMHtRDeBH VkyF5mrO9JeFRT+mhM87V+fJXOaEKtcSFVgZJFKV2MPdyGqZSGKmyyqfUvKfucP5 LrjK3MRKibTlOMwbBOmYUksMVE0ByMPeSzyMlQhq0oyA3fvEdKEf0JrFGDRWNzO8 /Q54oj79Pki4y1BDKd7lE1srBFiVEUuPNJmjhhU9WXnMwiB55lLwbTR8mKEX0Pr2 FeTS5gttmbHf4V+wnJvlOEU6mOLMrb+6Xb4ltvqbl9ng1+tF2QMGMd83mtbFtAjb Zcl/Cq2KwsBFyH9VT48ZxWxpOYMf3ppEg9KOSfz9Ungtg4/Q/Kr9P13Nf+9+S9JS 1PfKdlJzGFDn4EwZ49ugg6GNnL6XuRl9jBPD2iD8hY9CsTdWrr9giCmJmdf6G/bK HUm2QekMbhpaQmYKkMeri45cHprx1dQ50rfiH1cBm5SxaK7z/hDDaKXF1Gp7/KwQ g6gHlyMss7EEHSY5ogH+6a7OUPpqbJdNztEAEQEAAYkBvAQYAQoAJhYhBPfkfLEs oM0BxeHL+n7I1ahaONY6BQJei3x8AhsMBQkDwmcAAAoJEH7I1ahaONY6EqoL/R7J QLaAlb4/hK7/v4vsSxtCirLWrqNNNJxYdmpXq19NKPmcc08QzSqkJ7vR4/kn2L6I OY7y7AMh+tScKTKIGn8MkAcj0ZvkafHY3xmpN1Xp9caUAA/fw6KWD+pSZpKpISyd 2Xr6x5OJGSKhyGpPB98oCsa809LQ3cweG1imem3jx+Lgii63pEJG/AeNeEwkIvdC zRLSQvYv0UjlhyOoII6YEWJcro+tgOcthPh2SY50E4lwFFfbz4CNQyL15D+XciNI xSVGz8gee/XdJdgwQF4SEnIiChhmJ5VmpNH8ZwxTMyI3EoFMB/RYaucwc/ucvySn cFyShFFRPjo6TOeYIaSrrfR+4yhHAGeM572y0btI6JjWZovupeXX3k5ZHHrCwxlR MuyULLyhUsAC0r1FUijbUWoyaDcRtLRpMUg1X6A7n1iH61WxlKQ/8mZhYht85Jgp FSiyz47gofc491ng9efshlyxwb3TeLbDZPRnls7L3sfDDWwp8yExjA7UNDbIh5kC DQRencYLARAAsFHArFeulhD6hZplRF49h8+zpI3kn+vFtYwbUqLSRwze53rrJtqE 6o5MWSfadr9KIc8tNZ2aBGxzjGnsbPYLDh76NkjP4apWSMX+u+EHsaudoZoAdNnM Kqr86sVzR0MUeGHp7n/L3imp1WoCn28eMLeNec9a4GRTRPGLKR9F/jytTz/XgkHL zA3i2pt63FqniN4PBTNFzgfXiu8xVZGohsDPjmd9LXbGKTXfJGhBLB6QsmjJwglt n+00ufdKLEZu6eBxRWSVK0t4rEnnpK9K//PKq5DtVaOZNe6g+hdi0B1gpd0f0nBy eZd9arCsvN3qLXP0vYTk9DKMUecCEblss5Zt1+qjAbsMk9/xSGZLJp/4dBTBVN+Q c6+Rmv+koe6zLNmA3fJH3991xETDzZxP2UHN7q4i4L97KA+nVAakwazNLiqsY/bT s58rXnCc72b7oLnZbNOPQmLwZFafVi4xoIE/5Zq8iVr7d7xHPccYkaEVCOnsL/35 GZxy2FNi4wuOfGwBtTbnXg/u/YiBj6yNbhLR+FCwZED5M/evgUUbJudxqRdrI+1a Zo9gGA3JLJZZ/iLwF1kE7yYBvyBRfaO9IL3bwplRurnrkjI+rRhi55AlbGhU3eMu iKTKQk+qJF11ocTGu/dE9I6JeQpEdyVehrWXc5H2N0Qjyca8ZEA6WwcAEQEAAbR7 QURBTSBNQVJTSEFMTCBET0JSSU4gKGl0J3MgdGhlIG9uZSAuLi4gbGlrZSB0aGUg b25lIGluIFN1cGVybWFuIDMgYW5kIE9mZmljZSBzcGFjZS0tYnV0IG5vdCAqdGhh dCogb25lKSA8YWRhbUBlcm1jY29ycC5jb20+iQJOBBMBCgA4FiEE0s8R6kp2bveF MmxLkifaSe8nN2gFAl6dxgsCGwMFCwkIBwIGFQoJCAsCBBYCAwECHgECF4AACgkQ kifaSe8nN2jK+g//Toi6ezWYrRbTs9xwQLIsKzl91ocjCuN9nHSnwzkrLuoGGgej fHkXzd5+3ygL47j++k69TYB9CPrGdR1GTqt56Q7DSYZCgdg+e89piTJUzbEyN01q EGkVuV5Rz9EocnPE8db9HT+xvf44ecfMOFD1XuB9jynrQD445YfeFE6LHkoNUvFD wQK7NN04fa+qvrk0lTS4NCpOYsdrSioddVjQyEC6jepwIRA3iRIkFdEJT8ggqQ6d gntsgExA01o6HqzDSHjSCA5AexCotwW3Uvdt0WwXx6q/c0LsRLhbuPeGX/Nh8aOf 6RBCQWgnIko675ura4c+r1VcBYl524ZJlN4x1x02YAo9cKzYi3+H9C8K8Ayz/SJy 7sVGHWnDge1yIwzWXbpolqiMSL5l/0OBuJ0HXQSafUut33Jw7hYKP4BQia/BmE0x Tsk0rBRMyihSYnUn9mYpXM3KwWU0C2dudVwKtToGR1aKlYcCv0iNFAsR0DBw1XSq n72KqIl020gZFmg3H34Z6CWhm20RbhMjOvvkZ+OiS9kU9kXt6m+T1zCpWHFJSae4 JF+dQyB1BFxAwXW4ZEzMo4XluTuW1R8pIadKTsHMWzEzH7RvZLKP4invsZklZ3I1 EEsJop7DSMOa27irD/IlCL+nwaEsCMRh+ndSkADLHsa9P5d/qWjomKxwdCm5Ag0E Xp3GCwEQAOoXU8NrugMa8OAncXKv4hycXJzArDae3Zx6pCCEkP3TZTXh1tqKPUtb dmb8Mq2eecVTwmB+FM3m+NApgq88Vx6HiyI73IAvgtZORo32YaipfbkGnXHfaUWX 5380R4GL597yZuP8sAsJ3iDvxhW59snsU8tLi+9r2u4h0fgMDqZXQsfvLUkDIiO9 nzJf0xFacTx3n+pUuWdzIuT3AUdU/L9NubmHSnj09FevTHWIYmxGFZoiSdS7r2Z+ 5xZmPak6lzrQTVS/DxcpyA/o3yi8qLPyf1VUxXKFeKd0sV6BPvYFxI2GeBl5atBu 9/3/5D6wdlrupTFLU1Msdfy3UWaRUFHLITK4fJ7pbTgoEqxX7gpO9iqKmScm3gYc O3blA8aTqCX2NzxUF5fHbi14JvPWP04uFl5EOeDB322Jm/guWy8TvmIIyuF3aAAX PfErW/yRWDsYOcAADs8elZkt3F+E/AwWd0JMIhd/RB3RFH8m7496XLS3xBP6rNye 0O+96lX7fVp+wvINxM3Rfo63b1K4bR5KR9JDZ2SLYhrx6Hyy+UiRv7l+i26WxVMF qRyvY2aHqyvKfR1EEf1t2h7B4b65xQkj51qvX5Tjm5Az7nKcXpcUKqS3bk8xiw9N y7eFfA361OSPpQ+V4Mq/Mv+MqyxLTz9tn+80ZtjqM0MEERfpUo15ABEBAAGJAjYE GAEKACAWIQTSzxHqSnZu94UybEuSJ9pJ7yc3aAUCXp3GCwIbDAAKCRCSJ9pJ7yc3 aE2NEACDBRnGYNi2sq0wltPSkD2CbQUon+4uiFB2UU/gs4mFlGOvzDHBHVEFzCqK 0x6KlKm4XBq3AF7iIoNMiU9FmBdWDnEp9eCXdQrr/ykgq3vKMuj6/QJNNZglIDoe 1J2NXeMOUFwCUvjcCttPv42Q8GDt8/bG7QOgmTmhuqvKIj/vL+c3HgNrRsQzhw5z mSzQIDaesD+UVA/sourXpSLeqPgF+6qsEqOirD6hotaqrt+aIA/8wbYkpNQxCEK4 gKDgpqTV7VKklku7fjyhBhZQOVDoWvd03AlGQD0WBNriUsh8l4N6Zg2BlnKTGn11 BTigqwlHC91xtjERgwFg8PAHN2mtgZUHITHX5js11KwlQdLyI04/M4M4oQq0KSbJ rpiWCgrltC/VqJrT4HELFYx2Iv5wzrV9jVEm6zonag4A761hpqTgRrjWtaLuYu2Z zdw9y1r0+0d2rTUGpjIQRVOwi3AF/G4aU+vAOOf/HcgH6Qnpbu+xV0fkuAZbTI7w 6VVkBvnstiQV88KrWAOXKVABSSxTz2OYbzOTt/bgxzAa7yr1xIBDKvujBqDRGBLi bISp+40Haoj2Yqop6vbS70Xq+cnBOwJW86u61hsLgOjqyxgLzvuGTjK7+TblCjR2 F4LNeQdwDdyNRjPYeGVXM3MEqR8XdcR1Z7BQvLNcDgoW2qDcbg== =4lZw -----END PGP PUBLIC KEY BLOCK-----

      Please see GPG keys on PGP.MIT.EDU; fingerprints: sec rsa3072/A18F778E19FC3248 2020-04-03 [SC] [expires: 2022-04-03] FFF31E86FCEB5046E8B27D4AA18F778E19FC3248 uid [ultimate] ADAM M DOBRIN \ ssb rsa3072/04F98002A3DA53B2 2020-04-03 [E] [expires: 2022-04-03]

      sec rsa4096/FB4ECE4A109229CF 2020-04-04 [SC] 4FAF0D3E208A1F4C980D0F66FB4ECE4A109229CF uid [ultimate] Adam Marshall Dobrin \ ssb rsa4096/DD1F0C118C788B04 2020-04-04 [E]

      pub rsa3072 2020-04-06 [SC] [expires: 2022-04-06] F7E4 7CB1 2CA0 CD01 C5E1 CBFA 7EC8 D5A8 5A38 D63A uid [ unknown] ADAM MARSHALL DOBRIN

      Because of "some issues" with what appears to be distinct and unbridled privacy intrusion; please ensure that PGP is understood to be "nothing more than not so much pretty good" and this key also, almost required in order to verify authentic identity--in the case of ... question.

    1. Oneof thetr ick sto storytellingis, n evertotellevery -t hinga tonce,tomake youraudiencewait, tokeepevery on ein s us p en se

      This quote reminds me of how an author/storyteller gives us a good cliffhanger. An ending at the end of each part that draws us in even more as the story goes on. I especially liked the cliffhanger with this story, because of the roller coaster of emotions that went on and the ending that I would predict kept on changing as the story kept going.

    2. It doesn' t sou n dso good . We ared oin gokayw ithout i t. We can get alongw itho u t thatkindofthing. Tak e it backCallth at story back.:"But,ofcourse, it wastoo late. Foronceast or y istold,it can no tbe calledbackOncetold , it i s loosein the world

      This story reminds me of the Hawaiian proverb,"I ka ʻōlelo no ke ola, ika ʻōlelo no ka make."- Puke ʻŌlelo Noʻeau (In word there is life and in words there is death). Being conscious of the power we release in to the world is important. Intention is essential when telling stories, with our words and actions.

    1. Indigenous voices must speak for themselves. And we must listen

      This reminds me of replacing the word "safe space" with "brave space" (a kumu in my island feminisms mentioned the other day). An environment to stimulate confidence to be brave enough to share our stories, with the belief that others will listen.

    2. “I have a problem when a book comes out ‘about us, but not with us’ — when no one has consulted the family of the story or an Elder…. Our history and our stories are continually being told from a colonial perspective.”

      This is the issue that reminds me of the word "ancient", speaking about us when we are in the room, but made to feel isolated as if our voice cannot be heard. Some want the art without the story, the clout without the rain.

    1. In the dialogue called the Theaetetus, Socrates discusses the question “What is knowledge?”

      This whole thing reminds me of something we've talked on my art history class. The Enlightenment theme of "Triumph of Light over Darkness" was something that marks the beginning of human's attempt to actively test and explore, and this desire of knowledge has changed human's perspective on the process of getting new knowledge. It is quite obvious and interesting that back in Plato's time, what they were discussing as "knowledge" was the things that were staying there superficially waiting for people to see (or for people to realize in a coincidence) rather than the things we need to discover using calculation or analyzation. This comment is not that philosophical but I think it is somehow related to our point of interdisciplinary study.

    Annotators

  6. forum.saysomethingin.com forum.saysomethingin.com
    1. In doing some work with Japanese, I’ve come across a Chrome browser extension called Mainichi which shows me a flashcard-like image and the related word in English and Japanese (with both associated kana) every time I open a new browser tab. Because I open dozens to hundreds of browser tabs a day it’s an easy way to review and even learn new words. (It also reminds me that I ought to be working on my next lesson instead of surfing the internet. :smile:)

      I’m curious if anyone has seen anything like this for Welsh beyond the more focused use of flashcard technologies like Anki, Mnemosyne, et al?

    1. She doesn’t know how she got here, or who I am, beyond the fact that I care for her, and she takes care of me.

      reminds me of "we are all walking each other home"

    1. e build rhetorical baffles around our lives to keep the crowding out, only to find that we have let nobody we love in.

      reminds me of our generation's ineptitude when it comes to closure - much easier to say "see you later" than "goodbye," it's easier to ghost someone than it is to be honest, etc

    1. nd I said, ‘‘You don’t understandbecause you’re skinny,’’ and on and on forever.

      the dynamic between skinny people and fat people kind of reminds me of this same argument about how degrading any body is bad (meghan trainor released all about that bass and said skinny bitches) and how you won't face these same sort of microaggressions/discrimination if you are skinny, just as with any other marginalized community and the majority

    1. Now the rain-dark head came down and rested on the dome of the embassy.

      Is the "rain-dark head" simply a raincloud? When the world "embassy" is mentioned, it reminds me of people with high power. Since our character is a foreigner, he could be in an embassy in a foreign country that belongs to his home country. Is our character considered important?

    1. American citizens are free to practice their religion, give voice to their views and use their creative energies to pursue their personal aspirations.

      This reminds me of inspiring politicians such as Ilhan Omar and Rashida Tlaib.

    2. arly United States would survive only if it could unify its diverse, competing—and at times, conflicting—religious and ethnic groups into the fold of a new, collec-tive national identity.

      This reminds me of the common debate of whether the US is a "melting pot" or "salad bowl." A question of do citizens retain their heritage and identity or do they feel welcomed into a cohesive American one.

    1. Whereas people used to build their own homes according to their unique specifications, today such an undertaking is discouraged, or even illegal. Instead, plans are drawn up by a licensed architect, and construction carried out by a team of wage workers. “When dwelling by people is transformed into housing for people,” Illich writes, paraphrasing architect John Turner, “housing is changed from an activity into a commodity.”

      Reminds me strongly of that piece about 2000s beige.

    1. a reflection of why one construction has more staying power than its rivals

      This is an interesting point. It reminds me of the quote by Winston Churchill, "History is told by the victors". Our understanding of the past is entirely dependent on the generations before us. The victors are the ones whose stories we hear because they are the ones who went on to build our nation.

    1. But I’m interested in this as a sort of lifecycle of information. An idea starts out with what it means to you, the “I” in this situation. Then it pings around a social network and is discussed (the “you” phase). And then in the final phase it sort of transcends that conversation, and becomes more expository, more timeless, less personal, more accessible to conversational outsiders.

      Hmm. Is this true?

      I often feel like the connections people make are exactly the most personal part, and necessarily must be sloughed off as one tries to explicate the essence of the thing in Wikipedia-like neutrality. My annotations often look nutty for that reason -- because an anecdote someone's telling about mushroom hunting isn't at its core an expression of a narrative that then inherently calls out to be categorized as such in a way that I can then say "this reminds me of the cozy web".

    1. When the researchers analyzed the genetic interrelatedness of bears both within and outside the area’s three language families, they found that grizzly bears living within a language family’s boundaries were much more genetically similar to one another than to bears living outside them.

      the idea goes that resource areas keep different groups together — expansion isn't random sort of reminds me of that map of an ancient cretaceous coastline that created good enough soils for high crop yields, so there were more slaves who today tip the scales in favor of democrat, forming a line of blue along the state

  7. icla2021.jonreeve.com icla2021.jonreeve.com
    1. “It’s bad for children,” said old Cotter, “because their minds are so impressionable. When children see things like that, you know, it has an effect….”

      Cotter reminds me of some old distant relative at a family gathering that's always telling you what to do.

    2. No! No! No! It was impossible. Her hands clutched the iron in frenzy. Amid the seas she sent a cry of anguish!

      Eveline's reaction reminds me of the ending to "Araby."

    1. “Mr. Bruff, the assistance I innocently rendered to the inquiry after the Diamond was an unpardoned offence, in Rachel’s mind, nearly a year since; and it remains an unpardoned offence still. I won’t accept that position! I am determined to find out the secret of her silence towards her mother, and her enmity towards me. If time, pains, and money can do it, I will lay my hand on the thief who took the Moonstone!”

      This excerpt reminds me of a scene earlier in the story, when Rachel asked Mr. Franklin to stop smoking his cigar. He then adamantly refused to start smoking again when she asked him to.

    1. Furthermore I interviewed Angel Calmo who lived in Oakland for about 16 years he explains, “Police go way too far because they think their in control of society and we as People of Color and taxpayers we pay them to protect the community and serve the country with respect but police are not doing any of that instead killing people who didn’t do anything wrong”(Calmo).

      This reminds me that the people that are not affected by police brutality tend to not pay much attention to it.

    1. “seek to understand the issues and interact critically with the contents of particular teaching materials, relate ideas to previous knowledge and experience, and examine the logic of the arguments and relate the evidence presented to the conclusions”

      It reminds me of the cognitive presence is the CoI model.

    1. Given the costs of having an experienced advisor regularly available to students, it’s not always realistic. But AI could be the experienced advisor, powered by learnings from big data.

      This reminds me of the "illustrated primer" in Stephenson, N. (1995). The diamond age. Although that's an AI-based system entirely, with no human interaction necessary.

  8. apocryphdota.files.wordpress.com apocryphdota.files.wordpress.com
    1. escapeoutoftheland

      So already there is this sense that the Egyptians don't want the Israelites to leave. Reminds me of Alter's notes on Joseph's attendance at Jacob's death/funeral, when the Pharaoh sent a large retinue with him so that he would be sure to return to Egypt.

    1. “A photographed kiss cannot actually be synchronized with an eight-bar phrase.”

      This reminds me of the term Mickey-mousing where the music is synched with the action. Though, as this seems like a live-action, it expresses how the eight-bar phrase is not fitting and synchronized to the kiss. This depicts how humans are not a case of animation, since they are more natural in action, and not strict or controlled puppets.

    1. one tames the work of art

      Reminds me of the structuralists. I think it is interesting how we are progressively surrendering the limits to what we can know to be "truth"

    1. lly doing.

      I agree with Claire and I'd add that this question of terms reminds me also of the term "antiracism," buzzword used as a personal marker rather than a something related to action.

    2. So, my humble suggestion, till you are actually willing and able to do the work of decolonizing the structures you (and even me) benefit from currently, let us think of better words to do what we are actually doing.

      Yes...my Indigenous colleague reminds me that to Indigenize my work means I have to decolonize the self and that work must come first.

    1. On the other hand I was drawn to the Mapping Poverty in America map by how tame and static the map is.

      I like this observation about the difference between dynamic vs more static or "tame" maps. It reminds me of the Data Feminism chapter that (I believe) we read for this week, and the notion that sometimes breaking the rules of data visualization, namely creating messy or overwhelming visualizations, can be an effective form of commentary. Obviously this depends on the outlet, and the NYT is primarily focused on providing accessible information rather than an accompanying conclusion. Still, I found it a bit unnerving to see the egregious income inequality in our country represented so "tamely" and without comment.

    1. I had to rely less on my content knowledge and skills as a teacher

      reminds me of @slamteacher's talk the previous day about only bringing a bag of tricks = cheating both ourselves and our teachers

    1. However, it may have a negative cultural social justice impact if the majority of content and editors reproduce dominant views of knowledge (

      This reminds me of when some Wikipedia editor decided to remove women authors from a list of American Novelist and creating a separate list for Women American Novelists..

    2. while students creating their own OER can be considered learner-centric OEP, depending on the role of the teacher

      Reminds me of how Felicia Rose Chavez The Anti-Racist Writing Workshop recommends having the students select the readings.

    3. content-centric to process-centric, teacher-centric to learner-centric, and practices that are primarily for pedagogical purposes to primarily for social justice (Bali 2017).

      Reading this also reminds me of an article that along with content, teacher, and student interaction, we should consider "interface" = which tech and what tech is being use to deliver the knowledge & material.

    1. cultivate intellectual and social environments where all students have the opportunity to achieve academic success

      This reminds me of the NCSU surveys for which white respondents ranked NCSU as much more welcoming and inclusive toward marginalized demographics, than did members of those marginalized populations.

    1. Gyuri Lajos 1 day ago (edited) • 34:10 "that little bit of uncanny valley at 9" reminds me of the inverted bell curve distribution of marks I gave out when teaching Prolog to an Introduction to AI course with 200+ students. Virtually no middle grade score, either failed, pass, poor, or good to top marks no score in the middle. Its a kind of threshold need to be reached. The rest is on a path of learning yet to cross that threshold if ever.

      uncanny valley

    1. Experts have identified the species of animals used for British legal documents dating from the 13th to 20th century, and have discovered they were almost always written on sheepskin, rather than goatskin or calfskin vellum. This may have been because the structure of sheepskin made attempts to remove or modify text obvious. Sheep deposit fat in-between the various layers of their skin. During parchment manufacture, the skin is submerged in lime, which draws out the fat leaving voids between the layers. Attempts to scrape off the ink would result in these layers detaching—known as delamination—leaving a visible blemish highlighting any attempts to change any writing. Sheepskin has a very high fat content, accounting for as much as 30 to 50 percent, compared to 3 to 10 percent in goatskin and just 2 to 3 percent in cattle. Consequently, the potential for scraping to detach these layers is considerably greater in sheepskin than those of other animals.

      For some reason this reminds me of Jesse not understanding the significance of the plastic and the acid...

  9. Jul 2021
    1. Although the goal is for humans to eventually rely on machines, for now it’s machines that must rely on humans

      This extract reminds me that controversial question of whether machines will ever replace humans, assuming that we would consider that humans and machines would have the same abilities, but we don't. On the one hand, machines are faster, more accurate and can perform time consuming activities humans would not be able to do. On the other hand, humans have feelings, emotions and are culturaly sensitive. This makes the difference in activities like education where it needs more interaction and it is not about transmiting concepts and memorizing formulas.

    1. Ideal

      This format of title reminds me of “her first ball”. It turns out that Leila’s first ball is also her last ball. This makes me wonder feel ideal will implies something not so ideal in the article.

    1. Within this systemic approach, which means that each part is involved in reciprocal relations with the others,

      This description reminds me of a 'Systems Thinking' approach.

    1. Equiano’s account was one of the first widely read “slave narratives”

      I find this interesting because the colonizing European force would justify slavery by stating the exact opposite of Equiano’s story. They would say that people of color are uneducated and that they are doing them a favor by enslaving them because their life would be so much worse without it. When in reality it is the exact opposite. And Equiano, like many others, became the opposite of the narrative in a system that was looking for excuses to dehumanize them. A vestigial power structure that is similar still exists today, and there are many people just like Equiano that are going strong despite it. However, there are still many people that are having their stories closed too early. This story reminds me of how important it is to listen to and bolster people’s stories.

    1. What the network might not have expected was for the message to be almost immediately undermined by the network’s biggest star, Tucker Carlson.

      The guy is dangerous, just doesn't care about anything but ratings (reminds me of someone...)

    1. Lemuel Gulliver, First a Surgeon, and then a Captain of Several Ships

      I know it is just in the story, but seeing things like this reminds me of how much knowledge exists in the world. Whether practical or impractical, theoretical or applied, it goes to show that there is a lot to learn, and one person can never learn everything. It makes you (or at least me) want to chase after the knowledge that you are passionate about as there is always a wellspring where you least expect it.

    1. 6RPHZKHUHLQEHWZHHQMRXUQDOLVPDQGDUWYLVXDOL]DWLRQKDVDOVRIRXQGLWVZD\LQWRHQWHUWDLQPHQW,I\RXWKLQNRIGDWDLQWKHPRUHDEVWUDFWVHQVHRXWVLGHRIVSUHDGVKHHWVDQGFRPPDGHOLPLWHGWH[WILOHVZKHUHSKRWRVDQGVWDWXVXSGDWHVDOVRTXDOLI\WKLVLVHDV\WRVHH)DFHERRNXVHGVWDWXVXSGDWHVWRJDXJHWKHKDSSLHVWGD\RIWKH\HDUDQGRQOLQHGDWLQJVLWH2N&XSLGXVHGRQOLQHLQIRUPDWLRQWRHVWLPDWHWKHOLHVSHRSOHWHOOWRPDNHWKHLUGLJLWDOVHOYHVORRNEHWWHUDVVKRZQLQ)LJXUH7KHVHDQDO\VHVKDGOLWWOHWRGRZLWKLPSURYLQJDEXVLQHVVLQFUHDVLQJUHYHQXHVRUILQGLQJJOLWFKHVLQDV\VWHP7KH\FLUFXODWHGWKHZHEOLNHZLOGILUHEHFDXVHRIWKHLUHQWHUWDLQPHQWYDOXH7KHGDWDUHYHDOHGDOLWWOHELWDERXWRXUVHOYHVDQGVRFLHW\)DFHERRNIRXQGWKHKDSSLHVWGD\WREH7KDQNVJLYLQJDQG2N&XSLGIRXQGWKDWSHRSOHWHQGWRH[DJJHUDWHWKHLUKHLJKWE\DERXWLQFKHV

      I forget that data and visualization show up in entertainment as well. It is like this section says, you have to look outside of spreadsheets and text files to see that photos and status updates could also qualify. This just reminds me that data can be used in so many different ways and not just the more common ones you may think of off the top of your head. People like their entertainment so Facebook and OkCupid were most likely successful in using their data in that way.

    1. heavilyusedtechnologicalartifactssuchasthesearchenginehavebecomesuchanormativepartofourexperiencewithdigitaltechnologyandcomputersthattheysocializeusintobelievingthattheseartifactsmustthereforealsoprovideaccesstocredible,accurateinformationthatisdepoliticizedandneutral

      This portion here reminds me of a show on Netflix , Coded Bias, where in one particular episode a black developer is working on creating a facial recognition A.I. and was struggling to make it work, until she realized the program could only accurately identify white faces, due to the database for facial recognition for most part uses mostly white faces. She discovered that wearing a white mask would make her program work, but it would not recognize her own face. This I think helps support the idea presented in this article that programs themselves can be made racist with racial bias, regardless of the users interacting and creating with them.

    1. All the fields you see by each file in file explorer is actually metadata. The actual data is inside those files. Metadata includes: file name, type, size, creation date and time, last modification date and time.

      This reminds me of the front and back of house concept. Where data makes up the front of house, and metadata the back. So depending on which end you work, dictates the data you see or work with first. for example say the data is a photo, a viewer would access the data first (most likely) and could then move towards metadata if they so chose. The photographer however would be most familiar with the files, editing, location etc, that is all related to the meta data first. This idea sort of helps me structure the two in my mind better. Maybe the idea might help a few others to wrap their brains around the idea of data/metadata

    1. young people are more vulnerable to mental health problems,

      Reminds me of an article I've read which basically goes over how experiencing homelessness was proven to have caused symptoms of mental illness among-st those experiencing it. The same article also brought up an interesting point of how it can be the other way around with mental illness causing people to become homeless.

    1. Indian conspiracy to steal it.

      Is it stealing if it belonged to the Indians to begin with? Reminds me of the British Museum and how they stole artifacts from other countries to promote themselves.

    2. Oh merciful Death, let me see it before your arms enfold me, before your voice whispers to me, “Rest at last!”

      Interesting, capitalization of death, personifying it further by calling it merciful. Also, Ezra is being quite dramatic, reminds me of writings in Shakespearian times.

    3. “And mind, if you ever take to growing roses, the white moss rose is all the better for not being budded on the dog-rose, whatever the gardener may say to the contrary!”

      I can't tell if all the commentary on the rose garden is pat of the mystery/plot or just part of Sergeant's quirks. Sergeant Cuff reminds me of Detective Blanc from Knives Out. I wonder if the seemingly goofy/silly yet intelligent detective trope comes from The Moonstone

    4. I address these lines–written in India–to my relatives in England.

      I haven't read much literature from the 19th century, but this reminds me a lot of Frankenstein by Mary Shelley and how much of the novel took the form of letters, lending it an air of authenticity. I suppose this is kind of a precursor to "found footage" style movies or mockumentaries today.

    5. nd I declare, on my word of honour, that what I am now about to write is, strictly and literally, the truth.

      This reminds me of the intro to Gulliver's Travels which also opens with a letter or 'extracted family paper' declaring the text's appeal to authority and truthfulness.

    1. For example, there is a difference between “No thanks, I’m not hungry” and “I’ve told you, I’m not hungry.”

      Reminds of the Robot devil's quote “Your lyrics lack subtlety! You can't just have your characters announce how they feel! That makes me feel angry!"

    1. I deliver PDFs daily as an art director; not ideal, but they work in most cases. There's certainly nothing rebellious or non-commercial about them

      It reminds me of The Chronicle's exhorting ordinary people to support the then-underway cause intended to banish Uber and Lyft from Austin, on ostensibly populist grounds, when in reality the cause was aimed at preserving the commercial interests of an entrenched, unworthy industry. I saw a similar thing with the popular sentiment against Facebook's PATENTS.txt—a clever hack on par with copyleft which had the prospect of making patent trolls' weapons ineffective, subverted by a meme that ended with people convinced to work against their own interests and in favor of the trolls.

      Maybe it's worth coining a new term ("anti-rebellion"?) for this sort of thing. Se also: useful idiot

    1. A critically acclaimed young African-American poet was surprised to learn last year that he had been promoted by a Nuyorican Poet's Cafe impresario as a former L.A. gang member, which he never was. And while performing Border Brujoin the late 1980s, Gomez-Pena encountered numerous presenters and audience members who were disappointed that he was not a "real shaman" and that his "tongues" were not Nahuatl but a fictitious language

      Reading this paragraph reminds me of all of the misperceptions of people that are told. This topic was brought up in another one of my classes and it's crazy to see it happening again here.

    1. The 20th century is full of attempts to realize the objectives of authentic pedagogy.

      This reminds me of all of my years of teaching and every few years there is a new and improved curriculum or theory. Sometimes it is hard to know which ones will stick around.

    2. t means to be told things rather than to find them out for yourself. It positions the teacher as an authority figure and the student as a beneficiary of the knowledge they convey. It involves the transmission of knowledge from the knowing expert to the as- yet- unknowing novice. And of course, in a certain perspective education is, inevitably and always, all of these things. However, the critics of didactic pedagogy seize on its peculiar emphases that position students as passive recipients of knowledge and compliant objects of authority

      This concept reminds me very much so of when I was a student. There were not many leadership opportunities, collaborative learning, and the teacher rarely facilitated the learning. Instead, it was more of a lecture. This is an approach that I try to stray from as much as possible. I find the best lessons I plan are when my students are taking control of the environment and I am there as a means of support and guidance to the learning.

    3. To me, multiliteracies is addressing the multiple modes and forms people learn best. In a way, it reminds me of the curriculum I use (Lucy Calkins Workshop Model). We transitioned from novel studies to allowing students to read any book they want (as long it was the same genre). I know the comparison seems far fetched, but when boiled down, multiliteracies and Lucy Calkins differentiate and take individualism into consideration for the best learning outcomes possible.

    1. It refuses both the clarity and cleanliness associated with the best practices of data visualization and the homogenizing and “cleanliness” associated with the forces of gentrification that lead to evictions in the first place.

      I think that the way the Narratives map utilizes occlusion to demonstrate the inherently problematic-- and dehumanizing-- nature of gentrification and using data visualization to depict it. This reminds me of other ethical discussions we've had, about how interpreting certain sources/issues as data can be problematic because it erases personal stories and lived experiences. I really like the idea of making the data visualization purposefully messy and overwhelming. However, I think it's also important to include more understandable visualizations as well, so that people can also understand the problem and be motivated to fix it-- a solution requires both emotion and competence, so we should strive to make our data visualizations easy to understand, but also emotionally impactful.

    1. The analogy of a conversation is a good way to describe scholarship in general.

      This reminds me of the text "They Say, I Say" that I and others use in Composition. It's focused on rhetorical moves in writing, and it highlights the fact that writing is part of a larger conversation.

    1. Listening should welcome and be open todifferences, recognizing the value of the other's point of view and inte

      This reminds me of the PYP learner profile. Being open minded and having perspective

    2. In this way, not only does the indi-vidual child learn how to learn, but the group becomes conscious of itself as a •teaching place," where the languages are enriched, multiplied, refined and generated but al o where they collide and hybridize with each other, and are renewed.

      Reminds me of the saying that if you want to really learn something well, teach it to someone else.

    1. 1. Slow growth (the early phase of exponential growth)

      This reminds me of what Gab Leydon says in the Invest Like the Best podcast - he believes our innovation may hit a human limit. The rapid growth he believes in will be using AI to drive innovation.

    1. The explosiveness of its parting lyrics, its referencesto drugs and vigilantism caught the public’s attention and broke boundaries: Something taboo was being uttered on a record for the firsttime in a popular song by a Black woman entertainer. Bradford’s gamble on “a Black woman nobody’s ever heard of,” as the popular musichistorian Elijah Wald put it in a phone interview, was “a huge conceptual leap.

      This reminds me about the transition of reggaton going from love-felt stories to a rhyme scheme of the degradation of women. Catchy, but still a bit sexist, probably tied to our "machismo" factor that still takes part in South American male culture

    1. Young people today have the world at their fingertips in ways that were unimaginable just a generation ago.

      I think this really emphasizes the ease it is to gain connections and have learning opportunities available and accessible. It reminds me of the comparison of how people don't need a degree as much anymore.

    1. Claudia: What's been the hardest part back in Mexico?Yosell: The hardest part here in Mexico is actually I'm trying to live here with the economy that they have. One day transport is cheap, the next day it goes up, and then it keeps going up, and you're just like, "Oh." It's just really hard to keep up with it.Claudia: What have you been up to in this past year and a half that you've been here?Yosell: This past year I moved in with my girlfriend, so I've been here ever since, and we met each other here. So I ended up moving out with her, and I'm trying to do my university but it's kind of hard and stuff like that.Claudia: What are you trying to study?Yosell: I was actually doing a graphic designs and stuff like that.Claudia: Cool!Yosell: That was always something I did like. And now in the States I actually had an administration, so that was probably one of those two.Claudia: Are you currently working or what are you doing?Yosell: Yeah, currently I had a cousin that got me to work here at T-Tech, so I guess that was it.Claudia: Do you like T-Tech?Yosell: Yeah, it’s a pretty interesting place.Claudia: In what ways?Yosell: It kind of reminds me of the high school out in the States. That's basically that's all I can say about it. [Chuckle]Claudia: In what way does it remind you of a high school?Yosell: With all the people in there, basically it's a high school. That's how high school is out there. It just reminded me exactly like in California high school.

      Return to Mexico, Challenges, Employment, Jobs, Call Centers, Community

    1. Anita:That's fascinating. To go back to something else, I asked you what you missed from the United States. Let me ask you that again. You said you missed the tastes. Can you expand on that?Beto:I miss the taste. I miss the relaxation, everything that's around in the States. It's very –you don't stress that much. I used to travel around at work and the view is beautiful. There's a lot of places that are beautiful. I haven't had a chance to travel here. But the food, the American stuff, the things I used to do early in the morning like to go to this American restaurant and ask for my hash browns, my bacon, jar of orange juice and a coffee, it’s just amazing. The cook was my friend and, he knew me already. "Hey Beto." "Hey my friend. Same?" It was amazing. Something that we don't have here. Something that's missing here when you go in, the way they treat you, it's beautiful.Anita:What do you mean the way they treat you?Beto:Like they always smile at you. They actually say good morning, good afternoon. I never had a bad experience at a restaurant. Most likely, in a public area, never had a bad experience.Anita:When you went in there, he remembered your order.Beto:Yes. They remember my order. It was amazing because they got me there. Now I know why Starbucks puts your name on the little thing because by putting your name, it's like you are part of this place. They make you feel like you are part of that specific restaurant. Not like what you see in the movies. But I had a lot of restaurants where I used to go in, and they were all my friends and they told me here, "Why don't you change your name when you, when you make- " "I don't have to, everybody knows Beto."Beto:I go, they know Beto everywhere. Every time it's like, "Beto, hey Beto, amigo, same?" "Yes. But now make a little bit more toasty." It is beautiful. I mean I got the taste of American food and all of the areas. I even went to Chinese places. There's a lot of people there. I mean I never had a bad experience. It was good.Anita:The last thing is, tell me this lasagna story again.Beto:Oh, the lasagna.Anita:Then I'll let you go.Beto:[31:47] Okay, well we're talking about discrimination in this case. I was just cooking lasagna and my family told me, "What are you doing?" "I'm cooking a lasagna. You guys want some?" This was a beautiful lasagna in a crystal base. They told me, "Why don't you cook something Mexican? You're in Mexico." "What do you want me to cook, beans?" "Some beans, I don't know, something Mexican." "But I love lasagna. You guys want to have some lasagna?" "No, it looks nasty. No." This is one of the things that you encounter when you're here that we're talking about people that are trying to learn and people who don’t want to know what's going on. It's like, "Taste lasagna. Have a little taste?" "No but it looks nasty." "It's just pasta there and then tomato. Take a little taste." "No, I’ll just go back to my kitchen and have some beans and chicharron and all this Mexican food."Beto:I mean, I like it, but I also like to have something from over there or what I used to eat over there. I brought my microwave. I'm living like I’m in the States. I mean I try to make my living like in the States: nice and easy. When I met my wife, I had all my stuff, my cooking stuff. She was like, "What is this?" I have my [inaudible 00:34:04] I don't know like heat, not the microwave. The other one.Anita:A toaster oven?Beto:Toaster oven, yes. "Why is that? What's that for?" "Well, I cook lasagna, and I make potatoes with cheese and I put a lot of stuff on it and I cook there." "I didn't know you cook." "Yes, I do.” Sometimes I don't like to eat a lot of greasy stuff from here. I do want something else. I want something that can remind me of the States. That's true. I cook. I also make, for myself, big pieces of meat, and I cook them there. Yes. It's like, "Why are you like that?" Because I used to go to restaurants, Black Angus. Oh my God, beautiful meat. I love meat. That reminds me of the meat. I can even have it medium like I like it. It's not that I really love to cook, but I have to cook because I want a little bit of over there.Anita:What's the food that most reminds you of over there?Beto:American breakfast. It reminds me the most. American breakfast is the best. Sausages. I love sausages. When I had my first sausages with honey, it's like meat and sweet, but that taste in your mouth, it takes you to some other place. Like, this is good. It's like the American breakfast with sausages and bacon. I used to put a lot of honey syrup. It's like, "This is great. Let me have another one." Or I used to stop by in the mornings. That's one of the things that really reminds me, because the morning there, everybody's awake early and there's a lot of places already open for you to have this good American breakfast. It reminds me a lot because you go there, and I have my hash browns, bacon, my big orange juice and coffee, American coffee. Here, well it's very tough to decide. There's nothing like over there. It reminds me a lot.

      Reflections, The United States, Favorite parts, missing

  10. stalbanstory.github.io stalbanstory.github.io
    1. Perhaps she felt like the world was ending and she could not stand facing the rapture in confinement.

      something about the ambiguity, the inability to find an objective, logical, empirical "answer," reminds me of the sand. it is the stuff of legends, of tales, of inherited stories that shift as they move through generations--a duppy epistemology. It reminds me of the question, who is in charge? what is the source of the power that is exerted over this landscape?

    2. An inky, bottomless black, as if the night sky had descended from above and settled on the shore to kiss the sea

      I love how the night appears; how blackness appears. Something that can shift and move and kiss. Reminds me of this Fred Moten phrase, the "midnight of category's beyond" (Black & Blur, 226).

    1. Feel free to play hopscotch

      This idea of playing hopscotch#%22Table_of_Instructions%22_and_structure) through a text reminds me of some mathematics texts I've come across where the author draws out a diagram of potential readings and which portions are prerequisites so that professors using the book might pick and choose chapters to skip in their presentations.

      Also reminiscent of the Choose Your Own Adventure books from childhood too.

      cross reference: [[John Barth]], [[Henry James Korn]] and [[experimental fiction]], and [[hypertext]]

  11. Jun 2021
    1. When the Eye Jumps Over the Wall (1980) and The Hundred Languages of Children (1987). He was aware of the power of the documentation that was produced through the educational creative work of the teachers and atelieristi with the support of the pedagogical coordinators.

      I like the idea also of 'if we could jump over the walls' looking at ideas from multiple perspectives...reminds me of the ideas shared in an Orthogonal Mind. https://joebalcom.blog/orthogonal/

    1. My interest was sparked during Open Education Week when I almost randomly picked a lightning talk session from the University of Alberta, and happened to hear about a project there aimed at bringing educational content to remote parts of the Northwest Territories. They shared a platform called Nimble 1 originally developed for use in South Africa (does anyone know more about this?). I heard that the current project from University of Alberta was able to run Pressbooks/H5P from this platform.

      I am part of this and would love to discuss it with any of you. It reminds me somewhat of @cogdog biking across the west with a wifi box some years ago..

    1. Claudia: Do you like T-Tech?Yosell: Yeah, it’s a pretty interesting place.Claudia: In what ways?Yosell: It kind of reminds me of the high school out in the States. That's basically that's all I can say about it. [Chuckle]Claudia: In what way does it remind you of a high school?Yosell: With all the people in there, basically it's a high school. That's how high school is out there. It just reminded me exactly like in California high school.

      Return to Mexico, jobs, call centers, community

    1. educational values,

      This is a great concept to include in learning. Reminds me of the children from last week's videos who were talking about race and special rights.

    1. As most communication technology is privately owned, the ability to study its impact, much less enact evidence-based policy, is constrained by the willingness of companies to cooperate.

      Reminds me of the issues around Facebook NOT making public the information about which ads are served to which people, and then banning a plugin that provided this information to researchers who were interested in this data.

      The information about who sees which ads is extremely useful in our society where so many are willing to spend hard cash (or at least donated cash) to spread disinformation, but you can't study how the algorithms impact this without access to the data.

    1. People were expected to be in a certain place at a certain time. The notions of being 'on time' and 'running late' became much more important

      This reminds me of how email has changed our workplace experience. Things that were once only a part of our actual workday are now communicated outside of work hours and even on the weekends. It has become increasingly difficult to separate our work and home lives. Email has also eliminated a cooling off period when we are upset and allowed us to dehumanize people. In the past a person that was upset would need to wait to have a conversation face to face or take the time to look up a number to call someone on the phone. In both scenarios you had to listen to the persons response. Email has allowed people to vent out whatever grievances they have without an immediate response from a second party.

    1. My dictionary defines civilization as “the stage of human social development and organization that is considered most advanced.” Aside from being a sort of useless definition, this points out the prejudice inherent in civilization. It says: “We are advanced. You are primitive. What’s more, history and development is purely linear in nature, progress only moves forward, and any deviation from the course we are on is regressive.”

      reminds me of Walker's connection btwn Eurocentric linear time, Darwinism, and the advanced-primitive dichotomy

    1. Yes. Yes, I did. I didn't know it, I was just [mumbling 00:46:07] didn't know. But then I learned it. I remember we used to do the Pledge of Allegiance, it was every morning, every morning. After that, I don't know what happened to schools. They stopped doing it, but it was every day. I used to do it every day. The Pledge of Allegiance. I even learned the American anthem, but all of a sudden everything started changing. I really don't know why. Times change. Things change. It reminds me a lot when I used to ride my bicycle to school, put the lock on it. I felt like in the movies. When I was little, I felt like I was in the movies, because of me on a bicycle, putting my bicycle and locking it. I felt like the Back to the Future guy, and I always wanted some Nikes like this guy. It was difficult for the language. It was difficult for the culture because it got me mixed up with the American culture and Chicano culture. There was a big division there because I had to learn from both.Beto:That's when you get like a Chicano burrito, Americans potato, mashed potatoes in this. Then, okay, Chicano goes to LA Dodgers stadium, and he's American. Cinco de Mayo, he's Mexican. What's going on? It's like, what's going on with this guy? But then American culture, [sings] “take me out to the ballgame.” I asked my mom a lot of stuff. I asked my dad a lot of stuff, and I believe I mentioned when you asked me how I felt, American or Mexican? That's what they taught me. "You're Mexican. You're Mexican, you know the pyramids. You been there, you studied there. You remember this?" "Yes." Okay. Then you're Mexican. You're not American, but you're learning the American culture. Okay? Chicano, it's different. Way, totally, completely out of, don't pay attention. Yes. Pay attention. But don't go too much into it. You're Mexican."

      Time in the US, Adapting, US Traditions; Identity, Mexican, Chicano, American

    1. Too sound is his slumber, the slayer is near him, Who with bow and arrow aimeth in malice.

      In this whole passage, Beowulf is being compared to Heremod's failures in order to further lift him up and praise him. Then I think Hrothgar goes on to criticize men who live in luxury and enjoy earthly pleasures, lucky to live such an easy life, who become arrogant inside and passive to danger. This line I have highlighted is the fate he suspects for men like this. They let their pride get the best of them and they will die because of it. this implies then that the most noble of men live in constant fear and cannot fully enjoy life. This was a theme is the other Anglo-saxon poetry too - that living less favorably while alive is more honorable and holy. This mention of sleeping soundly also reminds me of Beowulf's comment to the king before.

    2. The bairn of her bosom to bear to the fire, Queen Hildeburg has her son burnt along with That his body be burned and borne to the pyre

      I like the use of rhyme here. The repeated references to fire make me think of the fire within her. Her love for them both burns within and this ceremonial act of burning them together binds them further. It's a powerful image and their corpses in flames reminds me of their fate to be taken from a hellish creature.

    1. Reviewer #1 (Public Review): 

      In this paper the authors associate genetic variation in regulatory sequences of the gene cortex with the presence/absence of a yellow band of color in the wings of two species of Heliconius butterflies. They show that cortex is spatially regulated in larval wings, but the expression of this gene does not correlate with the presence or absence of the yellow band. Then they show that the gene is expressed in the nuclei of all cells of the pupal wing. By disrupting cortex they show that black cells (Type II) become white or yellow (Type I), and red scales (Type III) become paler across the whole wing. 

      By examining open regions of chromatin around cortex, they discover that at least in one of the species, the insertion of two transposable elements in an open region of chromatin associates with the presence of the yellow band. They show that disrupting this regulatory region in a race of butterflies that does not contain the yellow band, nor the TE insertions, leads to the loss of the black color in a band-like shape, and the appearance of yellow scales in that region of the wing. They identify a different region of open-chromatin in the other Heliconius species that when disrupted also leads to the transformation of black scales into yellow scales in a band-like pattern. 

      The authors achieved their aims and the results support their conclusions. 

      The strength of this manuscript lies in the use of multiple approaches to identify the likely causal genetic variation in the cortex locus that is responsible for the presence/absence of the yellow band. The only weakness (if I can call it that) is that it is still not clear how cortex, which is also expressed in the nuclei of the yellow scales in races that supposedly have the TE insertion and closed chromatin in that enhancer region, fail to develop black scales in that region of the wing. 

      This is one of the first few papers that examines the function of specific open regions of chromatin in the DNA of butterfly species using CRISPR-Cas9. The main novelty of this paper is in identifying how a gene with a homogeneous expression pattern across the wing (during the pupal stage) can still have "hidden" modular regulatory regions that drive unique functions (albeit not expression) is specific regions of the wing. 

      This work reminds me of the regulation of the vestigial gene in the wings of Drosophila. vestigial also has homogeneous expression across the wing pouch but it achieves this homogeneous expression via two separate enhancers that have complementary expression patterns.

    1. Children love tolearn among themselves, and they learn things thatit would never be possible to learn from interactionswith an adult.

      This reminds me of that phrase from pg. 2, "Of course not all children are the same — each child brings a part of something that’s different into the school."

      Each child brings in different knowledge and ideas to class. I love the collaboration amongst children and how they share knowledge with one another. Hearing them share with their parents that they learned something new from the peers is amazing.

    2. Children are very sensitive and can see andsense very quickly the spirit of what is going onamong the adults in their world.

      Absolutely! Children respond, react, absorb, imitate us and the world around them. This reminds me of how healthy vs unhealthy environments can impact children!

    1. It’s tattooed back here. Realism to me was … it's real. Human beings are selfish by nature, but the beauty of it is that we have our own free will and we can go above our nature and we can do great things, so this just reminds me that I'm not just an animal that's looking for my own benefit, if that makes sense.

      Time in the Us , Tattoo , Meaning

    2. Luisa: There was this one book by Clive Owen, I believe, something about the demons. I don't know. We had a huge discussion about that book. He would give me a bunch of books from his collection and we would discuss it. We would discuss the original. We would discuss Niccolò Machiavelli. I actually have “the end justifies the means” tattooed on me.It’s tattooed back here. Realism to me was … it's real. Human beings are selfish by nature, but the beauty of it is that we have our own free will and we can go above our nature and we can do great things, so this just reminds me that I'm not just an animal that's looking for my own benefit, if that makes sense.

      Time in the US, Tattoos, Meaning

    1. I don't exactly know what this will end up doing, which is perhaps why I think it's interesting. I don't even know if it makes sense.

      this definitely makes sense! reminds me a bit of Lord of the Rings // the ring situation - where you need equal buy-in from everyone in order to get to the next level

    1. On the occasion of her Coronation, our Gracious Queen commands that one Captain Macheath shall at once be ‘releaséd.

      reminds me of the end of Tartuffe, very deux ex machina

    Annotators

  12. May 2021
    1. The longest-lasting missionary settlements in Texas arose at a place known as Yanaguana, used by Payayas and their neighbors. Spaniards might have called it San Antonio de Béxar, but a customary sense of home place prevailed in determining Indian views.

      The original San Antonio native name, Yanaguana, reminds me of the yanaguana group that provides mutual aid to those in need and base their mission off of the aid to others as was provided back then.

    1. the kinds of errors that involve nurses in some way and endanger patients cover broad territory.

      Can this be said a different way if this is not a direct quote? the in some way seems out of place. The kinds of errors involving nurses and endangering patient safety over a board territory ( this reminds me of the game of Risk- smile) instead of territory could we say covers many ????

    1. “peek into the world of what it means to be black.” To me this reasoning seems immature. This outlook reminds me of child play, saying, “See, now you know how it feels.”

      I don't agree. I feel as if white should understand the trials that minorities go through on a day to day basis and this is only a little piece not even fully giving them the experience. It isn't immature.

    1. reciprocal

      reminds me of Brofenbruner and the systems theory. there is an ongoing relationship between the individual and the environment the environment can have many levels and variations as the individual develops in relationship with their surroundings.

    1. data

      This reminds me of some of the data collection bar graph visuals that exist on Youtube.com. This type of bar graph where time lapse is used as a critical aspect to help highlight change (or lack thereof) over time was very helpful to me when I was interested in visualizing wealth in the United States and the rise of the likes of Bill Gates or Jeff Bezos. If not for the timelapse, I would not have realized the sustained level of wealth.

    1. This will seem little to you with your strong practical sense for it takes fifty years for a poet’s weapons to influence the issue.”

      This reminds me of some of the influential poets and writers I admire, and their own perspective on social activism and global change. it makes me think of how we write things in hopes of inspiring change in people and to spark a fire of rebellion in certain cases . And yet by the time a piece of literature has made its way around the world, the actions of those who hold the same beliefs yet were more keen to pursue them through a practical sense have already made some kind of change. I think literature is meant to aid people as a whole- for generations to come- and I think what makes a piece of writing so strong is that it still holds meaning no matter what time you are in and that it captures the human existence.

    1. Think of this plan (the word for map in French) as the map to your essay that will guide you along your journey to completion

      I like this because it reminds me so much of the mind map we would do in class honestly I like how this relates to a lot of the stuff we have done in class because all the stuff professor dan has told us about how to write a paragraph has helped me out a lot and I think helped me become a better writer

    2. I think the hard work of writing is just how long a book is terrible before it’s good

      I can feel this on another level because this reminds me of the whole not judging a a book by a cover mainly because by personal experience because I do this a lot when I read the first pages and I don't like it I immediately think its bad you know then a lot of people tells me its good and that I judged too quick

    1. “I want to be a poet–not a Negro poet,”

      This line reminds me a bit of the phrase "Not like other girls" (which I heard a lot growing up and was even guilty of myself saying at times). It's possible that the poet in question thought he was being progressive and forward thinking by not letting his race define him, but Hughes points out that he's actually rejecting his blackness, whether he realizes it or not.

    1. I've found several digital copies in Latin:

      I've come across a recent text The Memory Arts in Renaissance England: A Critical Anthology edited by William E. Engel, Rory Loughnane, and Grant Williams (Cambridge University Press, 2016). (Google books should let you preview most of it, if it helps.) It contains an extended excerpt of about 5 pages of The Phoenix from the opening three chapters of Robert Copland's translation, which they consider weak. They also include a synopsis of the other 9 chapters. Copland apparently didn't acknowledge Ravenna as the original author, not did he supply the name of the French text he purports to translate.

      I've got feelers out to a few classicists to see if anyone has a personal translation from the Latin that they're willing to share.

      As for the size of the text, I know what you mean. I've recently acquired a 1799 edition of Richard Grey's Memoria Technica which is both smaller and denser than I had expected.

      This also reminds me that I've been wanting to re-publish copies of some of the public domain classical memory texts (and/or translations) in modern typesetting/binding as a series. If anyone wants to lend a hand with creating/editing such a thing let me know.

    1. even riding an elephant. For in

      The elephant scalp as a headdress reminds me of popular depictions of romans wearing a hood of a wolf or of Hercules wearing the Lion's pelt.

    2. Caesar ’s coinage even alludedto the victory of good over evil, with an elephant trampling a serpent with hiscognomenin the exergue(Figure 10).

      Good vs evil being depicted as trampling over a serpent reminds me biblical examples of the archangel Michael or the Virgin Mary stepping over the serpent.

    1. Place names and songlines together reminds me of a great BBC segment "Disappearing Welsh Names" I saw recently: https://www.youtube.com/watch?v=yLQ6XlG0MQ4

      It highlights by analogy the value of indigenous culture, knowledge, and creativity which the survival of songlines also provides us with. (It also saddens me because it starkly reminds me of all the knowledge and languages we've lost already.)

      I've been learning Welsh since the pandemic started and just a few simple words of Welsh has given me a far greater appreciation of places in the UK and what they mean. It's helped not only to expand my vocabulary, but increased my creativity in creating local songlines. It's also made it much easier to learn to say and remember the town of Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.

      <table> <thead><tr> <th>Cymraeg</th> <th>Meaning</th> </tr> </thead> <tbody> <tr> <td>Aber</td> <td>Where one river flows into another body of water (example: Aberystwyth)</td> </tr> <tr> <td>Ban, Bannau</td> <td>Peak(s), beacon(s)</td> </tr> <tr> <td>Bron</td> <td>Breast of a hill</td> </tr> <tr> <td>Bryn</td> <td>Hill</td> </tr> <tr> <td>Caer</td> <td>Fort</td> </tr> <tr> <td>Cas</td> <td>Castle</td> </tr> <tr> <td>Crug</td> <td>Hill, tump</td> </tr> <tr> <td>Cwm</td> <td>Valley</td> </tr> <tr> <td>Derw, Deri</td> <td>Oaks</td> </tr> <tr> <td>Dinas</td> <td>Hill-fort</td> </tr> <tr> <td>Dyffryn</td> <td>Valley, vale</td> </tr> <tr> <td>Ffin</td> <td>Border, boundary</td> </tr> <tr> <td>Isaf</td> <td>Lower, lowest</td> </tr> <tr> <td>Llan</td> <td>Church, church land (often followed by the name of the saint to whom the church was dedicated, eg, Llangatwg - a place with a church dedicated to St Catwg)</td> </tr> <tr> <td>Morfa</td> <td>Salt-marsh</td> </tr> <tr> <td>Nant</td> <td>Brook, dingle</td> </tr> <tr> <td>Pont</td> <td>Bridge</td> </tr> <tr> <td>Porth</td> <td>Gate</td> </tr> <tr> <td>Rhos</td> <td>Moor</td> </tr> <tr> <td>Tyle</td> <td>Hill-side, ascent</td> </tr> <tr> <td>Uchaf</td> <td>Upper, highest</td> </tr> <tr> <td>Ystrad</td> <td>Vale</td> </tr> </tbody> </table>

      It also uncovers quirks of place names like Breedon on the Hill which translates from Brythonic, Saxon, and Modern English to "Hill Hill on the Hill" and crystalizes, as if in amber, the fact that Brythonic, Saxon, and English speakers all conjoined for a time on a hill in England. Similarly there's also Barnack Hills in England which translates from old Celtic (barr), Scottish Gaelic (cnoc) and English as "flat topped hill hill hills". It's almost hillarious.

    1. If design govern in a thing so small.

      The last line talks about how it's hard to see the whole picture of a thing when you're too close to it. It sounds like the spider catches the moth by camouflaging itself against the backdrop of the flower. Does the spider know that or does it just know that it can get some food if it hangs out in this spot? It reminds me of this trashy tv show called "Monster Bug Wars" I loved as a kid. The show was just edited video and commentary of some ants subduing and killing a wasp or something like that but the producers added these great monster noises. The show, like this poem, took something we would normally not notice and hyper focused on it. If there are designs governing this spider that it cannot see, there are probably designs governing us that we do not notice.

    1. Perhaps if everyone reads and writes from their own home on the web, they’re less likely to desecrate their neighbor’s blog because it sticks to their own identity? There’s lots of work to be done certainly, but perhaps we’ll get there by expanding things, opening them up, and giving ourselves some more space to communicate?

      Chris, I like your point about companies opening up, it reminds me Cory Doctorow's discussion of interoperability as a means of fixing the internet.

    1. by humans, can transmit new diseases, devastate crops and eat away at crucial infrastructure.

      This reminds me of the Columbian Exchange and the horrible impact the new species that were brought to the Americas from Europe had on the American natives

    1. With conquering limbs astride from land to land

      kind of reminds me of war, like conquering limbs could be taking something but then it says land to land like they're expanding.

    1. Yellow caution tape contrasts against every other jet black chair. Even in a space that seems so removed from the outside world, it can’t escape Covid. I’m reminded of just how deeply Covid has transformed so many aspects of my life, and all the traditional elements of the fun “college experience” that I’ve missed out on. And yet, I’m standing inside a college library as I have these very thoughts, serving as a sobering reminder that perhaps society’s priorities regarding the “college experience” have become warped. “What’s wrong with having a little fun sometimes?” I demand, in my head, to no one. I look down at the carpet, whose green and beige pattern reminds me of vomit, which for some reason, seems like an appropriate answer. I look up at the high ceilings and find myself wondering how loud the echo would be if I yelled. I take that as a sign that it’s probably time to return to my work.

      I added more vivid details to this paragraph as before the details did not further the main idea of my essay. Before, I just described what I was seeing around me, without responding to it. I tried making the stimuli more meaningful as I linked the yellow caution tape to Covid-19 and how it changed my college experience, ironically as I write in a college library. The yellow tape stimulated ideas about what I was missing out on, in terms of the college experience, which I later address in the essay. By mentioning this, my final paragraph is more effective as it is linked to more paragraphs in the essay.

    1. tin cup and rippled mirror.

      A rippled mirror reminds me of a funhouse mirror, which are usually cheaper than a real glass mirror, and a tin cup is often used to ask for money so maybe they had financial issues

    1. Weavers, carders, spinners. The loader,

      These are all the positions of the people who make the clothes, and it reminds me of when he mentioned all the different fabrics.

    2. Gossiping over tea and noodles on their break Or talking money or politics while one fitted This armpiece with its overseam to the band

      it reminds me of crazy rich asians

    1. She reminded us of the challenging but extremely important truth that there are some things as instructors and even administrators that are absolutely within our control when it comes to improving equity

      I feel like many of us can relate to this! Equity is uncomfortable, it can be silencing. This reminds me of some Brene Brown (https://debbiedonsky.com/embracing-discomfort-in-equity-work-lessons-from-brene-brown-on-shame-triggers-from-an-anti-oppression-lens/) writings on diving into equitable work. Anti-oppression work requires people to feel deeply and sometimes uncomfortable - as long as they are learning from that discomfort.