5,023 Matching Annotations
  1. Jan 2022
    1. N A T U R A L A T O M I C O R B I T A L A N D N A T U R A L B O N D O R B I T A L A N A L Y S I S

      Welcome to the NBO results for propargyl silane! Atom numbering in the molecule is as shown below. Silicon is atom 1; that's tough to see. Most important is that carbons 3 and 4 are triply bonded and carbon 3 is the internal carbon.

    1. N A T U R A L A T O M I C O R B I T A L A N D N A T U R A L B O N D O R B I T A L A N A L Y S I S

      Welcome to the NBO results for propargyl silane! Atom numbering in the molecule is as shown below. Silicon is atom 1; that's tough to see. Most important is that carbons 3 and 4 are triply bonded and carbon 3 is the internal carbon.

    1. SciScore for 10.1101/2022.01.12.22269192: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: All studies are approved by the University of Washington Human Subjects Division Institutional Review Board.<br>Consent: Informed consent was obtained from all enrolled participants.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">(HAARVI) study (STUDY00000959), Healthy Adult Specimen Repository study (STUDY00002929) or COVID-19/SARS-CoV-2 Prevalence and Antibody Therapy Development study (Gale Lab, STUDY00009810).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>STUDY00000959</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>STUDY00002929</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>STUDY00009810</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Secondary antibodies were diluted in dilution buffer as follows: anti-human IgG-HRP (Jackson ImmunoResearch) at 1:3000, anti-human IgM-HRP (Southern Biotech) at 1:3000, or anti-human IgA-HRP (Southern Biotech) at 1:1500.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG-HRP</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human IgM-HRP</div><div>suggested: (MyBioSource Cat# MBS673990, RRID:AB_10891687)</div></div><div style="margin-bottom:8px"><div>anti-human IgA-HRP</div><div>suggested: (SouthernBiotech Cat# 2050-05, RRID:AB_2687526)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For surface phenotyping, cells were washed and barcoded using four different fluorescently labeled CD45 antibodies to create eight unique barcodes as previously described (Becht et al., 2021).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD45</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For intracellular cytokine staining, cells were first incubated with anti-CXCR5 antibody at room temperature for 40 minutes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-CXCR5</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 1 hour incubation at 37°C, the plasma/virus mixtures were added to 96-well poly-L-lysine-coated plates seeded with human ACE2-expressing 293T cells (BEI Resources: NR-52511) 20 hours prior.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 30 min of incubation at 37°C, the plasma/virus mixtures were added to 12 well plates of Vero cells and incubated for 1 h at 37°C, rocking every 15 min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Percent neutralization was calculated as (1 – (sample+293T-ACE2+virus RLU - 293T+virus RLU)/(293T-ACE2+virus RLU - 293T+virus RLU) x 100.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RLU - 293T+virus RLU)/ ( 293T-ACE2+virus RLU - 293T+virus RLU</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">GFP vector plasmid (BEI Resources; NR52516), a second generation helper plasmid pMD2.g (gift from Didier Trono; Addgene #12260), and either: the SARS-CoV-2(o) pseudotyping plasmid above, or a plasmid encoding the SARS-CoV-2(Δ) variant spike (Invivogen, San Diego, CA,USA; pLV-Spike-V8, B.1.617.2, delta).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GFP</div><div>suggested: RRID:Addgene_126657)</div></div><div style="margin-bottom:8px"><div>pMD2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data was analyzed in Prism (GraphPad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">High-dimensional analysis of cytometry data: AIM-positive (CD154+CD69+) cells from all data files were concatenated with keywords and subjected to Phenograph clustering algorithm using k=40 nearest neighbors (Levine et al., 2015) and UMAP dimensionality reduction plugins using parameters IL-2, IFN-γ, IL-10, IL-4, IL-21, CD127, CD25, and CXCR5 in FlowJo 10 (Becton Dickinson).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Phenograph</div><div>suggested: (Phenograph, RRID:SCR_016919)</div></div><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2022.01.11.475922: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Western blot: Western blot was performed using an anti-SARS-COV-2 S antibody following a protocol described previously (56).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-COV-2 S</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Alkaline phosphatase conjugated anti-Rabbit IgG (1:5000) (Sigma-Aldrich, St. Louis, MO) was used as a secondary antibody.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Rabbit IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To measure binding of a full-length S protein to monoclonal antibodies, the antibody was immobilized to anti-human IgG Fc Capture (AHC) biosensor (ForteBio, Fremont, CA) following a protocol recommended by the manufacturer.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Control sensors with no ACE2 or antibody were also dipped in the S protein solutions and the running buffer as references.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, Expi293F cells transfected with monomeric ACE2 or dimeric ACE2 expression construct and the supernatant of the cell culture was collected.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Expi293F</div><div>suggested: RRID:CVCL_D615)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, to produce S-expressing cells, HEK293T cells were transfected by polyethylenimine (PEI; 80 μg) with either 5 or 10 μg of the full-length SARS-CoV2 (G614</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To prepare for infection, 7.5×103 of HEK 293 cells, stably transfected with a full-length human ACE2 expression construct, in 15 μl culture medium were plated into a 384-well white-clear plate coated with poly-D-Lysine to enhance the cell attachment.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudotyped virus particles were produced in 293T/17 cells (ATCC) by co-transfection of plasmids encoding codon-optimized SARS-CoV-2 full-length S constructs, packaging plasmid pCMV DR8.2, and luciferase reporter plasmid pHR’ CMV-Luc.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T/17</div><div>suggested: ATCC Cat# CRL-11268, RRID:CVCL_1926)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The 293T cell line stably overexpressing the human ACE2 cell surface receptor protein was kindly provided by Drs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: KCB Cat# KCB 200744YJ, RRID:CVCL_0063)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The S gene was fused with a C-terminal twin Strep tag (SGGGSAWSHPQFEKGGGSGGGSGGSSAWSHPQFEK) and cloned into a mammalian cell expression vector pCMV-IRES-puro (Codex BioSolutions, Inc, Gaithersburg, MD).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV-IRES-puro</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudotyped virus particles were produced in 293T/17 cells (ATCC) by co-transfection of plasmids encoding codon-optimized SARS-CoV-2 full-length S constructs, packaging plasmid pCMV DR8.2, and luciferase reporter plasmid pHR’ CMV-Luc.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV DR8.2, and luciferase reporter</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pHR’</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Automated data collection was carried out using SerialEM version 3.8.6 (59) at a nominal magnification of 105,000× and the K3 detector in counting mode (calibrated pixel size, 0.83 Å) at an exposure rate of 13.362 electrons per pixel per second.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SerialEM</div><div>suggested: (SerialEM, RRID:SCR_017293)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Image processing and 3D reconstructions: Drift correction for cryo-EM images was performed using MotionCor2 (60), and contrast transfer function (CTF) was estimated by Gctf (61) using motion-corrected sums without dose-weighting.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MotionCor2</div><div>suggested: (MotionCor2, RRID:SCR_016499)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Density maps were corrected from the modulation transfer function of the K3 detector and sharpened by applying a temperature factor that was estimated using post-processing in RELION.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RELION</div><div>suggested: (RELION, RRID:SCR_016274)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Several rounds of manual building were performed in Coot (64).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Coot</div><div>suggested: (Coot, RRID:SCR_014222)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on pages 32, 26, 28 and 30. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Klenke-Borgmann, L., Cantrell, M. A., & Mariani, B. (2020). Nurse educator’s guide to clinical judgment: A review of conceptualization, measurement, and development. Nursing Education Perspectives, 41(4), 215-221. https://doi.org/10.1097/01.nep.0000000000000669 ↵Klenke-Borgmann, L., Cantrell, M. A., & Mariani, B. (2020). Nurse educator’s guide to clinical judgment: A review of conceptualization, measurement, and development. Nursing Education Perspectives, 41(4), 215-221. https://doi.org/10.1097/01.nep.0000000000000669 ↵

      both of these references appear to be the same, and if so, why not have just the one reference?

    1. Stock, S. J., Carruthers, J., Calvert, C., Denny, C., Donaghy, J., Goulding, A., Hopcroft, L. E. M., Hopkins, L., McLaughlin, T., Pan, J., Shi, T., Taylor, B., Agrawal, U., Auyeung, B., Katikireddi, S. V., McCowan, C., Murray, J., Simpson, C. R., Robertson, C., … Wood, R. (2022). SARS-CoV-2 infection and COVID-19 vaccination rates in pregnant women in Scotland. Nature Medicine, 1–9. https://doi.org/10.1038/s41591-021-01666-2

    1. This is the profile for Mark Hughes (0000-0002-2168-0514). Up until now I've been generating my own linked data version of ORCID records that look very similar to this, but going forward this will simplify life.

      Note that I've truncated the above example, it's actually this:

      {
        "@context": "http://schema.org",
        "@type": "Person",
        "@id": "https://orcid.org/0000-0002-2168-0514",
        "mainEntityOfPage": "https://orcid.org/0000-0002-2168-0514",
        "givenName": "Mark",
        "familyName": "Hughes",
        "affiliation": {
          "@type": "Organization",
          "name": "Royal Botanic Garden Edinburgh",
          "identifier": {
            "@type": "PropertyValue",
            "propertyID": "RINGGOLD",
            "value": "41803"
          }
        },
        "@reverse": {
          "creator": [
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428619000283",
              "name": "BEGONIA MAGUNIANA (BEGONIACEAE, BEGONIA SECT. OLIGANDRAE), A NEW SPECIES FROM NEW GUINEA",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428619000283"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.11646/phytotaxa.407.1.11",
              "name": "A revision of Begonia sect. Petermannia on Sumatra, Indonesia",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.11646/phytotaxa.407.1.11"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.11646/phytotaxa.407.1.4",
              "name": "Two new species of Begonia (Begoniaceae) from Borneo",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.11646/phytotaxa.407.1.4"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428619000052",
              "name": "AN UPDATED CHECKLIST AND A NEW SPECIES OF BEGONIA (B. RHEOPHYTICA) FROM MYANMAR",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428619000052"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1371/journal.pone.0194877",
              "name": "Chloroplast and nuclear DNA exchanges among Begonia sect. Baryandra species (Begoniaceae) from Palawan Island, Philippines, and descriptions of five new species.",
              "identifier": [
                {
                  "@type": "PropertyValue",
                  "propertyID": "doi",
                  "value": "10.1371/journal.pone.0194877"
                },
                {
                  "@type": "PropertyValue",
                  "propertyID": "pmc",
                  "value": "PMC5931476"
                },
                {
                  "@type": "PropertyValue",
                  "propertyID": "pmid",
                  "value": "29718922"
                }
              ],
              "sameAs": [
                "https://europepmc.org/articles/PMC5931476",
                "https://www.ncbi.nlm.nih.gov/pubmed/29718922"
              ]
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428618000136",
              "name": "TWO NEW SPECIES OF BEGONIA FROM SUMATRA",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428618000136"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s096042861800001x",
              "name": "A REVISION OF BEGONIA SECT. SYMBEGONIA ON NEW GUINEA",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s096042861800001x"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.5852/ejt.2018.396",
              "name": "A revision and one new species of Begonia L. (Begoniaceae, Cucurbitales) in Northeast India",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.5852/ejt.2018.396"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1002/tax.606013",
              "name": "Pliocene intercontinental dispersal from Africa to Southeast Asia highlighted by the new species Begonia afromigrata (Begoniaceae)",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1002/tax.606013"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.11646/phytotaxa.381.1.16",
              "name": "Taxonomic notes on the Philippine endemic Begonia colorata (Begoniaceae, section Petermannia)",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.11646/phytotaxa.381.1.16"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1186/s40529-017-0182-x",
              "name": "Three new species of Begonia sect. Baryandra from Panay Island, Philippines.",
              "identifier": [
                {
                  "@type": "PropertyValue",
                  "propertyID": "pmid",
                  "value": "28664395"
                },
                {
                  "@type": "PropertyValue",
                  "propertyID": "doi",
                  "value": "10.1186/s40529-017-0182-x"
                },
                {
                  "@type": "PropertyValue",
                  "propertyID": "pmc",
                  "value": "PMC5491425"
                }
              ],
              "sameAs": [
                "https://www.ncbi.nlm.nih.gov/pubmed/28664395",
                "https://europepmc.org/articles/PMC5491425"
              ]
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.3767/000651917x695083",
              "name": "A new species of Begonia section Parvibegonia (Begoniaceae) from Thailand and Myanmar",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.3767/000651917x695083"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428617000075",
              "name": "TAXONOMY OF BEGONIA ALBOMACULATA AND DESCRIPTION OF TWO NEW SPECIES ENDEMIC TO PERU",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428617000075"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428617000051",
              "name": "FOUR NEW SPECIES OF BEGONIA (BEGONIACEAE) FROM THAILAND",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428617000051"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.3850/s2382581216000077",
              "name": "A new species and a new record in Begonia sect. Platycentrum (Begoniaceae) from Thailand",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.3850/s2382581216000077"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.5852/ejt.2015.119",
              "name": "Begonia yapenensis (sect. Symbegonia, Begoniaceae), a new species from Papua, Indonesia",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.5852/ejt.2015.119"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.11646/phytotaxa.197.1.4",
              "name": "A new section (Begonia sect. Oligandrae sect. nov.) and a new species (Begonia pentandra sp. nov.) in Begoniaceae from New Guinea",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.11646/phytotaxa.197.1.4"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.5852/ejt.2015.167",
              "name": "Further discoveries in the ever-expanding genus Begonia (Begoniaceae): fifteen new species from Sumatra",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.5852/ejt.2015.167"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1186/s40529-015-0099-1",
              "name": "Three New Species of Begonia Endemic to the Puerto Princesa Subterranean River National Park, Palawan",
              "identifier": [
                {
                  "@type": "PropertyValue",
                  "propertyID": "other-id",
                  "value": "al:1817406x-201507-201507290029-201507290029-c1-14"
                },
                {
                  "@type": "PropertyValue",
                  "propertyID": "doi",
                  "value": "10.1186/s40529-015-0099-1"
                }
              ],
              "sameAs": "http://www.airitilibrary.com/Publication/alDetailedMesh?DocID=1817406X-201507-201507290029-201507290029-c1-14"
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.5852/ejt.2013.56",
              "name": "Memecylon pseudomegacarpum M.Hughes (Melastomataceae), a new species of tree from Peninsular Malaysia",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.5852/ejt.2013.56"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1186/1999-3110-54-38",
              "name": "Recircumscription of Begonia sect. Baryandra (Begoniaceae): evidence from molecular data",
              "identifier": [
                {
                  "@type": "PropertyValue",
                  "propertyID": "other-id",
                  "value": "al:1817406x-201309-201401170003-201401170003-70-74"
                },
                {
                  "@type": "PropertyValue",
                  "propertyID": "doi",
                  "value": "10.1186/1999-3110-54-38"
                }
              ],
              "sameAs": "http://www.airitilibrary.com/Publication/alDetailedMesh?DocID=1817406X-201309-201401170003-201401170003-70-74"
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.11646/phytotaxa.66.1.2",
              "name": "A new species and new combinations of Memecylon in Thailand and Peninsular Malaysia",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.11646/phytotaxa.66.1.2"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428612000078",
              "name": "A NEW SPECIES OF BEGONIA (BEGONIACEAE) FROM PENINSULAR THAILAND",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428612000078"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.3329/bjpt.v19i2.13134",
              "name": "Pollen morphology of Begonia L. (Begoniaceae) in Nepal",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.3329/bjpt.v19i2.13134"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1111/j.1365-2699.2011.02596.x",
              "name": "West to east dispersal and subsequent rapid diversification of the mega-diverse genus Begonia (Begoniaceae) in the Malesian archipelago",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1111/j.1365-2699.2011.02596.x"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428611000072",
              "name": "NINE NEW SPECIES OF BEGONIA (BEGONIACEAE) FROM SOUTH AND WEST SULAWESI, INDONESIA",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428611000072"
              }
            },
            {
              "@type": "CreativeWork",
              "name": "Begonia blancii (sect. Diploclinium, Begoniaceae), A New Species Endemic to the Philippine Island of Palawan",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "other-id",
                "value": "al:1817406x-201104-201106150032-201106150032-203-209"
              },
              "sameAs": "http://www.airitilibrary.com/Publication/alDetailedMesh?DocID=1817406X-201104-201106150032-201106150032-203-209"
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428609005307",
              "name": "BEGONIA SECTION PETERMANNIA (BEGONIACEAE) ON PALAWAN (PHILIPPINES), INCLUDING TWO NEW SPECIES",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428609005307"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428609005484",
              "name": "TWO NEW SPECIES OF BEGONIA (BEGONIACEAE) FROM SOUTH SULAWESI, INDONESIA",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428609005484"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428609005320",
              "name": "TWO NEW SPECIES OF BEGONIA (BEGONIACEAE) FROM CENTRAL SULAWESI, INDONESIA",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428609005320"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s096042860800509x",
              "name": "BEGONIA VARIPELTATA(BEGONIACEAE): A NEW PELTATE SPECIES FROM SULAWESI, INDONESIA",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s096042860800509x"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428607000777",
              "name": "BEGONIA CLADOTRICHA (BEGONIACEAE): A NEW SPECIES FROM LAOS",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428607000777"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428606000588",
              "name": "FOUR NEW SPECIES OF BEGONIA (BEGONIACEAE) FROM SULAWESI",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428606000588"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1600/0363644054782297",
              "name": "A Phylogeny of Begonia Using Nuclear Ribosomal Sequence Data and Morphological Characters",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1600/0363644054782297"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1016/s0006-3207(02)00375-0",
              "name": "Population genetic structure in the endemic Begonia of the Socotra archipelago",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1016/s0006-3207(02)00375-0"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1017/s0960428602000082",
              "name": "A NEW ENDEMIC SPECIES OF BEGONIA (BEGONIACEAE) FROM THE SOCOTRA ARCHIPELAGO",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1017/s0960428602000082"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1046/j.1471-8286.2002.00201.x",
              "name": "Isolation of polymorphic microsatellite markers for Begonia sutherlandii Hook. f.",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1046/j.1471-8286.2002.00201.x"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.1046/j.1471-8286.2002.00185.x",
              "name": "Polymorphic microsatellite markers for the Socotran endemic herb Begonia socotrana",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.1046/j.1471-8286.2002.00185.x"
              }
            },
            {
              "@type": "CreativeWork",
              "@id": "https://doi.org/10.3126/botor.v7i0.4386",
              "name": "Distribution Patterns of Begonia species in the Nepal Himalaya",
              "identifier": {
                "@type": "PropertyValue",
                "propertyID": "doi",
                "value": "10.3126/botor.v7i0.4386"
              }
            }
          ]
        },
        "url": [
          "https://www.rbge.org.uk/about-us/organisational-structure/staff/tropical-diversity/dr-mark-hughes/",
          "https://www.mendeley.com/profiles/mark-hughes/"
        ],
        "identifier": [
          {
            "@type": "PropertyValue",
            "propertyID": "Loop profile",
            "value": "845425"
          },
          {
            "@type": "PropertyValue",
            "propertyID": "Loop profile",
            "value": "826408"
          }
        ]
      }
      

      This gives us a list of Mark's publications from ORCID. If there aren't any publications listed, the @reverse property is empty. Note that @reverse is a JSON-LD trick that enables the JSON-LD document to include not only things linked from Mark's ORCID id (e.g., his name and affiliation) but also things his ORCID id is linked to (e.g., that he is the author of works such as https://doi.org/10.1017/s0960428619000283).

    1. SciScore for 10.1101/2022.01.10.475620: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Euthanasia Agents: Fourteen days after the second immunization, mice were sacrificed by either cervical dislocation or CO2 inhalation.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Animals and authorizations: Six-weeks old C57 Bl/6 and C57 Bl/6 K18-hACE-2 transgenic [19] female mice were purchased from Charles River and hosted at the Central and BSL3 Animal Facilities of the Istituto Superiore di Sanità</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">For in vivo titration of the SARS-CoV-2/Italy INMI1#52284 isolate, age-matched K18-hACE-2 mice were randomized by body weight into groups of 4, and challenged with 5-fold serial dilutions in 1×PBS of the virus preparation containing 2.2×105, 4.4×104, 8.8×103, or 1.8×103 TCID50.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 16 h, cells were discarded, and the plate was incubated for 2 h at room temperature with R4-6A2 biotinylated anti-IFN-γ antibody (Mabtech) at the concentration of 100 μg/mL.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-IFN-γ</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Non-specific staining was minimized by pre-incubating cells with 0.5 μg of Fc blocking mAbs (i.e., anti-CD16/CD32 antibodies, Invitrogen/eBioscience Thermo Fisher) in 100 μL of 1×PBS with 2% FCS for 15 min at 4 °C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-CD16/CD32</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 preparation and in vitro titration: VERO-E6 cells were grown in DMEM (Gibco) supplemented with 2% FCS, 100 units/ml penicillin, 100 μg/ml streptomycin, 2 mM L-glutamine, 1 mM sodium pyruvate, and 1× non-essential amino acids (Gibco).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VERO-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To determine SARS-CoV-2 stock TCID50 (tissue culture infectious doses 50%), 2.2 × 104 Vero E6 cells/well were added onto 96-well plates (Corning, Mediatech Inc) and, the next day, octuplicate cultures were inoculated with 10-fold serial dilutions of virus (100 μL/well).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Animals and authorizations: Six-weeks old C57 Bl/6 and C57 Bl/6 K18-hACE-2 transgenic [19] female mice were purchased from Charles River and hosted at the Central and BSL3 Animal Facilities of the Istituto Superiore di Sanità</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Bl/6 K18-hACE-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For in vivo titration of the SARS-CoV-2/Italy INMI1#52284 isolate, age-matched K18-hACE-2 mice were randomized by body weight into groups of 4, and challenged with 5-fold serial dilutions in 1×PBS of the virus preparation containing 2.2×105, 4.4×104, 8.8×103, or 1.8×103 TCID50.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>K18-hACE-2</div><div>suggested: RRID:IMSR_GPT:T037657)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">DNA constructs: Open-reading frames coding for Nefmut fused with either S1, S2, or N SARS-CoV-2 proteins were cloned into pVAX1 plasmid (Thermo Fisher) as previously described [18].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pVAX1</div><div>suggested: RRID:Addgene_137909)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Samples were then analyzed by a CyotFLEX LX (Beckman Coulter, Brea, CA, USA) flow cytometer and analyzed using Kaluza software (Beckman Coulter)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Kaluza</div><div>suggested: (Kaluza, RRID:SCR_016182)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Our study presents limitations. The use of fluorescent tetramers in ICS/flow cytometry analyses would have identified SARS-CoV-2-specific CD8+ T cell sub-populations more accurately. In addition, challenging immunized mice with sub-lethal viral doses may have revealed potentially protective effects induced by S1-specific CD8+ T cells also. Furthermore, the lack of quantification of viral loads in lungs of protected mice precluded the evaluation of the effects of N-specific immunity on viral spread within airway tissues. Emergence of variants against which anti-S neutralizing antibodies lose potency represents one of the most relevant shortcoming for current anti-SARS-CoV-2 vaccines. Notably, N-specific antiviral CD8+ T cell immunity is not expected to suffer from such a limitation. In fact, as reported in fig. 7, amino acid sequences of N protein from current variants of concern (VOCs) are well conserved, at least in part because mutations in this key viral component could have detrimental effects on optimal viral fitness. By consequence, the N-specific CD8+ T cell immune response against a single viral strain is anticipated to be effective also against other VOCs. In addition, based on the observations on patients recovered from SARS-CoV infection [11], SARS-CoV-2 N-specific CD8+ T cell immunity would wane with a kinetics much slower than that of anti-S neutralizing antibodies. We here demonstrate that adequate levels of N-specific CD8+ T cell immunity correlate with protect...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Olson, S. M., Newhams, M. M., Halasa, N. B., Price, A. M., Boom, J. A., Sahni, L. C., Pannaraj, P. S., Irby, K., Walker, T. C., Schwartz, S. P., Maddux, A. B., Mack, E. H., Bradford, T. T., Schuster, J. E., Nofziger, R. A., Cameron, M. A., Chiotos, K., Cullimore, M. L., Gertz, S. J., … Randolph, A. G. (2022). Effectiveness of BNT162b2 Vaccine against Critical Covid-19 in Adolescents. New England Journal of Medicine, 0(0), null. https://doi.org/10.1056/NEJMoa2117995

    1. SciScore for 10.1101/2022.01.09.22268975: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: The patients who did not complete their course of hospitalization and were released with their consent were excluded.<br>IRB: The study protocol was approved by the local ethics committee of Shiraz University of Medical Sciences (IR.SUMS.MED.REC.1400.382).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SPSS version 23 (SPSS Inc, IBM</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SPSS</div><div>suggested: (SPSS, RRID:SCR_002865)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">M, New York, NY) and MedCalc statistical program, version 19.5 (MedCalc Software, Mariakerke, Belgium) were used to analyze the data.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MedCalc</div><div>suggested: (MedCalc, RRID:SCR_015044)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      This limitation is especially pronounced in ICUs for patients requiring mechanical ventilation (17). It is necessary to develop a scoring system that can be used by physicians, to estimate the severity of the disease and prognosis of each patient at an early stage of the disease, which will grant a wider timespan for interventions. This tool also helps to reduce hospital care costs and improves its quality in the health care units (18-20). In this survey, we designed a simplly calculated clinical risk score, by using the patient’s clinical characteristics and laboratory data, which can be used as a predictor to estimate the severity of the disease, the need for hospitalization, and the possibility of ICU admission requirement during hospitalization. Low DBP (≤ 75 mmHg), prolonged PT (> 16.2s), increase in the level of LDH (> 731 U/L), BUN >23mg/dl, elevated CRP (> 73.1 mg/L), and decrease in oxygen saturation (<84%) were detected as risk factors for disease severity among 480 adult patients. Using this scoring system is a useful strategy for screening high-risk patients in crowded care centers during the COVID-19 outbreak. Severe hypoxemia (O2 sat<84%) had the highest odds ratio (OR= 9.19) among the 6 risk factors determining the severity of the disease in our survey. This finding was consistent with a cohort study by Bahl et al. among 1461 patients in which O2 sat of ≤188% was associated with a higher mortality rate (21). In the review conducted by Petrilli et al. among 4103...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2022.01.09.22268986: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Study approval and ethics: Approval to undertake the study was obtained from the Kanagawa Dental University Research Ethics Review Board (approval number: 792) on April 6, 2021.<br>Consent: Written informed consent was obtained from all participants themselves or informed assent from their legal representatives, mostly parents (in the case of children or adolescent participants aged below 20 years), prior to the study onset.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Detection of anti-SARS-CoV-2 antibodies: Enzyme-linked immunosorbent assays (ELISAs) to measure the binding of IgA in saliva, as well as IgA and IgG in serum, to SARS-CoV-2 spike-1 were performed using an assay system modifying the human IgA ELISA quantitation set (#88-102; Bethyl Laboratories, Montgomery, Texas, USA) that had been reported by Yamamoto et al (61).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">However, since that antigen reacts with IgG, spike-1-His recombinant protein (#40591-V08B1; Sino Biological, Beijin, China) was used to measure the cross-antibodies in serum.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>spike-1-His recombinant protein (#40591-V08B1; Sino Biological, Beijin, China)</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To the wells thus coated with diluted saliva or serum samples for measurement of SARS-CoV-2-reactive IgA or IgG antibodies, 100 μl per well of biotin-labeled antigen at a concentration of 1 μg/ml was added, and incubated for 1 hour at 25 °C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgG</div><div>suggested: (Bethyl Cat# A300-652A, RRID:AB_519340)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">As positive control, commercially available two antibody products, i.e. spike-neutralizing IgG antibody (cat#40592-R001, Sino Biological; from 0 to 20 μg/ml) and spike-neutralizing IgA antibody (cat#E-AB-V1027, Elabscience, Houston, Texas, USA; from 0 to 2 μg/ml) for detecting SARS-CoV-2-reacting IgG and IgA, respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>spike-neutralizing IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>spike-neutralizing IgA</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>cat#E-AB-V1027</div><div>suggested: (PhosphoSolutions Cat# CoV2-RBT, RRID:AB_2868515)</div></div><div style="margin-bottom:8px"><div>IgA</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">ODs were measured at 450 nm in a microplate absorbance reader (Bio-Rad Laboratories, Hercules, CA, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Bio-Rad Laboratories</div><div>suggested: (Bio-Rad Laboratories, RRID:SCR_008426)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Analyses were performed using IBM SPSS Statistics version 27 (IBM, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SPSS</div><div>suggested: (SPSS, RRID:SCR_002865)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      The present study has both strengths and limitations. By implementing this immunological survey in a community-based cohort study with a wide age range of healthy Japanese people who had been unexposed to SARS-CoV-2, we were able to collect preliminary but unprecedented epidemiological data regarding the prevalence and levels of assumable polyreactive natural salivary IgA autoantibodies that exhibit reactivity with the virus. To the best of our knowledge, our survey, along with the preceding one (38), is the only available study which has provided data useful for considering a putative role mucosal natural IgA antibodies in protecting the human host from SARS-CoV-2 infection. Supportably, the presence of natural polyreactive sIgA autoantibodies acting as the frontline of mucosal defense against various infections has been demonstrated (59). Our study has several limitations. Firstly, our sample size was not large with limiting the robustness of our findings in saliva, as well as in serum. If such samples could be increasingly available, statical power for the analyses presented here will be increased. Secondly, we do not know whether and what levels of the salivary IgA detected in the presented study are protective through neutralization against SARS-CoV-2 infection. Thirdly, because of the lack of follow-up data, it was also unable to directly correlate negativity for or low levels of SARS-CoV-2-reactive salivary IgA with the feasibility to have the virus infection. Neverthe...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a protocol registration statement.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2022.01.08.22268944: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Virus Strains and Culture Methods: Vero E6 cells modified to constitutively express TMPRSS2 (Vero E6/TMPRSS2 cells (72); obtained from NIBSC, UK) were cultured at 37°C and 5% CO2 in Dulbecco’s Modified Eagle Medium (DMEM, high glucose; Sigma, UK) supplemented with 10% foetal bovine serum (FBS, Sigma), 100 units/ml penicillin (Gibco, UK), 100 µg/ml streptomycin (Gibco, UK), and L-glutamine (Gibco, UK).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Stocks of SARS-CoV-2 isolates were produced by inoculation of Vero E6/TMPRSS2 cells at a multiplicity of infection (MOI) of 0.01 and incubating the cells for 48- 72 h in Eagle’s minimum essential medium plus GlutaMAX (MEM, Gibco, ThermoFisher, cat# 41090036) supplemented with 2% v/v FBS and 0.1 mM non-essential amino acids (MEM 2% FBS).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6/TMPRSS2</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a protocol registration statement.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Fernandez-Castaneda, A., Lu, P., Geraghty, A. C., Song, E., Lee, M.-H., Wood, J., Yalcin, B., Taylor, K. R., Dutton, S., Acosta-Alvarez, L., Ni, L., Contreras-Esquivel, D., Gehlhausen, J. R., Klein, J., Lucas, C., Mao, T., Silva, J., Pena-Hernandez, M., Tabachnikova, A., … Monje, M. (2022). Mild respiratory SARS-CoV-2 infection can cause multi-lineage cellular dysregulation and myelin loss in the brain (p. 2022.01.07.475453). https://doi.org/10.1101/2022.01.07.475453

    1. Frenzel, S. B., Junker, N. M., Avanzi, L., Bolatov, A., Haslam, S. A., Häusser, J. A., Kark, R., Meyer, I., Mojzisch, A., Monzani, L., Reicher, S., Samekin, A., Schury, V. A., Steffens, N. K., Sultanova, L., Van Dijk, D., van Zyl, L. E., & Van Dick, R. (2022). A trouble shared is a trouble halved: The role of family identification and identification with humankind in well-being during the COVID-19 pandemic. British Journal of Social Psychology, 61(1), 55–82. https://doi.org/10.1111/bjso.12470

    1. SciScore for 10.1101/2022.01.05.475037: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: Written informed consent was obtained from all study subjects.<br>IRB: This study was approved by the Institutional Review Board of The University of Hong Kong/Hospital Authority Hong Kong West Cluster (Ref No. UW 21-120 452).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Briefly, 6-10-week-old male and female hamsters were obtained from the Chinese University of Hong Kong Laboratory Animal Service Centre through the HKU Centre for Comparative Medicine Research.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">The hamsters were randomized from different litters into experimental groups.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Serially diluted plasma from healthy individuals or previously published monoclonal antibodies against SARS-CoV-2 (B8) were used as negative controls.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Two consecutive staining steps were conducted: the first one used an antibody and spike cocktail incubation of 30 min at 4 °C; the second staining involved staining with anti-His-APC and anti-His-FITC antibodies (Abcam) at 4 °C for 30 min to detect the His tag of the RBD.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-His-APC</div><div>suggested: (Miltenyi Biotec Cat# 130-101-322, RRID:AB_2800415)</div></div><div style="margin-bottom:8px"><div>anti-His-FITC</div><div>suggested: (Miltenyi Biotec Cat# 130-092-675, RRID:AB_1103226)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were further permeabilized with 0.2% Triton X-100 and incubated with cross-reactive rabbit sera anti-SARS-CoV-2-N for 1 hour at RT before adding an Alexa Fluor 488 goat anti-rabbit IgG (H+L) cross-adsorbed secondary antibody (Life Technologies).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2-N</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-rabbit IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines: HEK293T cells, HEK293T-hACE2 cells and Vero-E6-TMPRSS2 cells were maintained in DMEM containing 10% FBS, 2 mM L-glutamine, 100 U/mL/mL penicillin and incubated at 37 □in a 5% CO2 setting 51</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>HEK293T-hACE2</div><div>suggested: RRID:CVCL_A7UK)</div></div><div style="margin-bottom:8px"><div>Vero-E6-TMPRSS2</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, The pseudovirus was generated by co-transfection of 293T cells with pVax-1-S-COVID19 and pNL4-3Luc_Env_Vpr, carrying the optimized spike (S) gene (QHR63250) and a human immunodeficiency virus type 1 backbone, respectively 54</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The antibody-virus mixtures were subsequently added to pre-seeded HEK 293T-ACE2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293T-ACE2</div><div>suggested: RRID:CVCL_A7UK)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mixtures were then transferred to 96-well plates pre-seeded with 1×104/well Vero E6 cells and incubated at 37°C for 24 hours.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, The pseudovirus was generated by co-transfection of 293T cells with pVax-1-S-COVID19 and pNL4-3Luc_Env_Vpr, carrying the optimized spike (S) gene (QHR63250) and a human immunodeficiency virus type 1 backbone, respectively 54</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pVax-1-S-COVID19</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pNL4-3Luc_Env_Vpr</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">https://www.ncbi.nlm.nih.gov/igblast/).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>https://www.ncbi.nlm.nih.gov/igblast/</div><div>suggested: (IgBLAST, RRID:SCR_002873)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sequences were aligned using Clustal W in the BioEdit sequence analysis package (Version 7.2)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BioEdit</div><div>suggested: (BioEdit, RRID:SCR_007361)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Half-maximal (IC50) or 90% (IC90) inhibitory concentrations of the evaluated antibody were determined by inhibitor vs. normalized response --4 Variable slope using GraphPad Prism 8 or later (GraphPad Software Inc.)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The fluorescence density of SARS-CoV-2 infected cells were scanned using a Sapphire Biomolecular Imager (Azure Biosystems) and the neutralization effects were then quantified using Fiji software (NIH)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Fiji</div><div>suggested: (Fiji, RRID:SCR_002285)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The structure alignment, cartoon representations, labeling of amino acids in RBD (from PDB 7K45) were generated by PyMOL.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMOL</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Quantification and statistical analysis: Statistical analysis was performed using PRISM 8.0 or later.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PRISM</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Limitations of the study: ZCB11 probably represents the broadest breadth among bNAbs reported thus far with comparable potency against all current SARS-CoV-2 VOCs including Omicron and OmicronR346K. We are still in the process in determining its mode of action by solving structures of the RBD-ZCB11 Fab complex. Such information will be useful to guide vaccine design as mentioned because the frequency of elite vaccine remains low (2/34 in this study). To understand the frequency of ZCB11-like bNAb among BNT162b2-vaccinees, we need to investigate other elite responders who show equally potent bNAb responses. More ZCB11-like bNAbs should be also discovered to improve current antibody-based cocktail immunotherapy. For animal challenge experiments, we have done a single dose efficacy experiment. Different doses and routes of administration or antibody combination will be tested in future experiments to provide useful information to support clinical development of ZCB11 and ZCB11-like bNAb.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Douaud, G., Lee, S., Alfaro-Almagro, F., Arthofer, C., Wang, C., McCarthy, P., Lange, F., Andersson, J. L. R., Griffanti, L., Duff, E., Jbabdi, S., Taschler, B., Winkler, A. M., Nichols, T. E., Collins, R., Matthews, P. M., Allen, N., Miller, K. L., & Smith, S. M. (2021). Brain imaging before and after COVID-19 in UK Biobank (p. 2021.06.11.21258690). https://doi.org/10.1101/2021.06.11.21258690

    1. SciScore for 10.1101/2022.01.04.474979: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Contamination: Cells were frequently tested for mycoplasma contamination and consistently tested negative.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 15 additional minutes, cells were incubated in blocking buffer (permeabilization buffer supplemented with 1 % BSA), and further incubated in blocking buffer containing anti-Strep mouse antibody (1:1000 dilution), and anti-Sirt5 rabbit antibody (1:1000 dilution).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Strep</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-Sirt5</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The next day, the cells were washed with PBS three times and incubated in the blocking buffer containing anti-mouse IgG donkey antibody conjugated with Alexa 488 (1:500 dilution, Thermo Fisher)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">anti-rabbit IgG donkey antibody conjugated with Alexa 555 (1:500 dilution, Thermo Fisher), and for counter-staining, DAPI (1 μg/ml</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit IgG donkey antibody</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-rabbit IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A549 cells stably expressing ACE2 (A549-ACE2) were a gift from O. Schwartz (Pasteur Institute, Paris).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Early passage HEK293T cells were transfected with 1.5 μg of dCas9-KRAB-MeCP2 repressor plasmid (Addgene #110824) and 0.5 μg of Piggyback Transposase (gift from Maxim Greenberg), using PEI 25K transfection reagent (Polysciences Inc, Cat. 23966-1), according to the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">We combined 10 pmol of Streptococcus pyogenes NLS-Sp.Cas9-NLS (SpCas9) nuclease (Aldevron, USA, Cat. 9212) with 30 pmol of total synthetic sgRNA (10 pmol each sgRNA) to form ribonucleoproteins (RNPs) in 20 μL of total volume with SE Buffer for A549-ACE2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549-ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Transfection, Strep affinity purification, and Flag immunoprecipitation in HEK-293T cells: HEK-293T cells were plated in six-well plates or 10-cm dishes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sample Preparation for Proteomic Analysis: HEK-293T Sirt5-KD cells were transfected with plasmids expressing Nsp14-strep in the presence or absence of SIRT5 with 3 biological replicates for each condition.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Sirt5-KD</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 stocks were propagated in Vero-E6 cells, and their sequences were verified by next-generation sequencing.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For infection experiments, A549-ACE2 or Calu3 cells were seeded into 12- or 24-well plates and rested for at least 24 hours prior to infection.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu3</div><div>suggested: RRID:CVCL_EQ19)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Infections of HCT-8 cells with HCoV-OC43 were performed similarly.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HCT-8</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmids expressing GFP and Nsp14 proteins (from SARS-CoV-2, SARS-CoV and HCoV-OC43) with a C-terminus strep tag were a gift from Nevan Krogan (1, 2), and are also available on Addgene (pLVX-EF1alpha-SARS-CoV-2-nsp14-2xStrep-IRES-Puro, Addgene #141380).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLVX-EF1alpha-SARS-CoV-2-nsp14-2xStrep-IRES-Puro</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mammalian expression plasmids for SIRT5 and SIRT5-H158Y with a myc-his tag in a pCDNA 3.1 vector were available in the Verdin lab (26).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCDNA 3.1</div><div>suggested: RRID:Addgene_20407)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Early passage HEK293T cells were transfected with 1.5 μg of dCas9-KRAB-MeCP2 repressor plasmid (Addgene #110824) and 0.5 μg of Piggyback Transposase (gift from Maxim Greenberg), using PEI 25K transfection reagent (Polysciences Inc, Cat. 23966-1), according to the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>dCas9-KRAB-MeCP2</div><div>suggested: RRID:Addgene_110821)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Nsp14 is cytotoxic, and we used 0.5 μg of Nsp14-strep plasmid for a six-well plate and 4 μg for a 10-cm dish.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Nsp14-strep</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Other co-transfecting plasmids, such as pcDNA-SIRT5, were used at the same concentration except when specifically mentioned.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA-SIRT5</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Protein purification and enzymatic assays: Nsp10 and Nsp14 proteins from the Wuhan strain of SARS-CoV-2 (NC_045512.2) were codon-optimized, ordered as Gblocks (IDT), and cloned into a pVFT1S expression vector using a HiFi DNA Assembly kit (NEB)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pVFT1S</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Methyltransferase assays were performed in reaction buffer (50 mM Hepes, pH 7.0, 6 mM KCl, 2 mM DTT, 1 mM MgCl2, and 0.1 mg/ml BSA) in presence of 0.1 mM NAD+ and 10 μM SAM.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SAM</div><div>suggested: (SAM, RRID:SCR_010951)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Analyses were run using GraphPad Prism version 9.1.2 for macOS (GraphPad Software, USA, www.graphpad.com).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A genome index was constructed using GRCh38 genome build with Gencode v38 annotation of the transcriptome, and Genbank MT246667.1 for the sequence of SARS-CoV-2, USA/WA-1/2020 isolate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gencode</div><div>suggested: (GENCODE, RRID:SCR_014966)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Differential gene expression analysis was done with DEseq2, which was also used to generate normalized gene counts (71).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>DEseq2</div><div>suggested: (DESeq2, RRID:SCR_015687)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Over-representation of biological gene sets in the gene clusters was investigated using the R clusterProfiler package and enricher function (72).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>clusterProfiler</div><div>suggested: (clusterProfiler, RRID:SCR_016884)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code and data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2022.01.03.474825: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: Informed consent was obtained from all participants as part of ethics approvals (Decisions# 2020-01620, 2020-02881 and 2020-05630) from the National Ethical Review Agency of Sweden.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell culture: HEK293T cells (ATCC CRL-3216) and HEK293T-ACE2 cells (stably expressing human ACE2) were cultured in Dulbecco’s Modified Eagle Medium (high glucose, with sodium pyruvate) supplemented with 10% fetal calf serum, 100 units/ml penicillin, and 100 μg/ml streptomycin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>HEK293T-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Therefore, 3D-classification was performed within CryoSparc 3.31 without pose alignment using 20 classes with a mask around the two RBDs in up conformations and their bound Fabs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CryoSparc</div><div>suggested: (cryoSPARC, RRID:SCR_016501)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Structure figures and EM density-map figures were generated with UCSF ChimeraX40 and COOT, respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>COOT</div><div>suggested: (Coot, RRID:SCR_014222)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">l analysis: Neutralizing IC50 values were calculated in Prism v9 (GraphPad Software) by fitting a four-parameter logistic curve, to neutralization by serial 3-fold dilutions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2022.01.03.22268599: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: NSCLC patient cohort: Peripheral blood samples from NSCLC patients were collected at Winship Cancer Institute following written informed consent approved by the Institutional Review Board at Emory University.<br>IRB: NSCLC patient cohort: Peripheral blood samples from NSCLC patients were collected at Winship Cancer Institute following written informed consent approved by the Institutional Review Board at Emory University.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">MesoScale Discovery Assay: V-PLEX COVID-19 Respiratory Panel 2 Kit (K15372U panel 2) were used to measure the IgG, IgM and IgA antibody against the antigens SARS-CoV-2 Spike, receptod binding domain (RBD),</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antigens SARS-CoV-2 Spike , receptod binding domain ( RBD) ,</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Following this, 50 uL per well of 1X MSD SULFO-TAG™ Anti-Human IgG Antibody was added and incubated for one hour at room temperature, shaking at a speed of 700 rpm.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-Human IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were incubated with either an anti-SARS-CoV spike primary antibody directly conjugated to Alexaflour-647 (CR3022-AF647) or an anti-SARS-CoV spike primary antibody directly conjugated to biotin (CR3022-biotin) for at least 4 hours at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CR3022-AF647</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-SARS-CoV spike</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CR3022-biotin</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viruses and cells: VeroE6 cells were obtained from ATCC (clone E6, ATCC, #CRL-1586) and cultured in complete DMEM medium consisting of 1x DMEM (VWR, #45000-304), 10% FBS, 25mM HEPES Buffer (Corning Cellgro), 2mM L-glutamine, 1mM sodium pyruvate, 1x Non-essential Amino Acids, and 1x antibiotics.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">VeroE6-TMPRSS2 cells were generated and cultured as previously described18. nCoV/USA_WA1/2020 (WA/1), closely resembling the original Wuhan strain and resembles the spike used in the mRNA-1273 and Pfizer-BioNTech vaccine, was propagated from an infectious SARS-CoV-2 clone as previously described19.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6-TMPRSS2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Using VeroE6-TMPRSS cells, the B.1.1.529 variant was plaque purified directly from the nasal swab, propagated once in a 12-well plate, and expanded in a confluent T175 flask to generate a working stock.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6-TMPRSS</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Focus Reduction Neutralization Assay: FRNT-mNG assays were performed on VeroE6 cells and FRNT assays were performed on Vero-TMPRSS2 cells as previously described18,21,22.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-TMPRSS2</div><div>suggested: JCRB Cat# JCRB1818, RRID:CVCL_YQ48)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Statistical analysis was conducted using Graphpad Prism V9 and R 4.1.2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Graphpad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2022.01.03.21268111: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: All participants gave written informed consent to take part in the study.<br>IRB: The DOVE study was approved by the North-West Liverpool Central Research Ethics Committee (REC reference 21/NW/0073).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Measurement of SARS-CoV-2, HCoVs and influenza antibody response by electrochemiluminescence: IgG antibody titres were measured quantitatively against SARS-CoV-2 trimeric spike (S) protein, N-terminal domain (NTD), receptor binding domain (RBD) or nucleocapsid (N), human seasonal coronaviruses (HCoVs) 229E, OC43, NL63 and HKU1; and influenza A (Michigan H1, Hong Kong H3 and Shanghai H7) and B (Phuket HA and Brisbane) using MSD V-PLEX COVID-19 Coronavirus Panel 2 (K15369) and Respiratory Panel 1 (K15365) kits.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2 trimeric spike (S) protein, N-terminal domain (NTD), receptor binding domain (RBD) or nucleocapsid (N)</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Caco-2 are an immortalized cell line derived from human colorectal adenocarcinoma, primarily used as a model of the intestinal epithelial barrier.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco-2</div><div>suggested: CLS Cat# 300137/p1665_CaCo-2, RRID:CVCL_0025)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A549 cells, a human alveolar adenocarcinoma line, were modified to stably express human ACE-2 and TMPRSS2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549</div><div>suggested: NCI-DTP Cat# A549, RRID:CVCL_0023)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Baby Hamster Kidney clone 21 cells and Vero ACE-2 TMPRSS2 cells were used in the isolation of live Omicron SARS-CoV-2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE-2 TMPRSS2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All cell lines were maintained at 37°C and 5% CO2 in DMEM supplemented with 10% foetal bovine serum (FBS), except for Calu-3 cells which were supplemented with 20% FBS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Generation of cell line expressing human ACE2 receptor: Lentiviral vectors encoding human ACE2 (GenBank NM_001371415.1) were produced as described previously69 and BHK-21 transduced cells were selected with 200µg/ml of hygromycin B.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK-21</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Generation of cell lines used for fusion assays: Retrovirus vectors were produced by transfecting HEK- 293T cells with plasmid pQCXIP-GFP1-10 (Addgene #68715) or pQCXIP-BSR-GFP11 (Addgene #68716)53 and packaging vectors expressing MLV gal-pol and VSV-G using Lipofectamine 3000 (Invitrogen) according to manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">BHK-hACE2 cells previously seeded at a cell density of 3x10^5 cells in T25 flask were inoculated with 400-500µL of resuspended samples in 5ml of complete medium (DMEM 2% FCS supplemented with gentamicin, penicillin- streptomycin and amphotericin B as above).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK-hACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, HEK293, HEK293T, and 293-ACE269 cells were maintained in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 10% FBS, 200mM L-glutamine, 100µg/ml streptomycin and 100 IU/ml penicillin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>293-ACE269</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK293T cells were transfected with the appropriate SARS-CoV-2 S gene expression vector (wild type or variant) in conjunction with p8.9171 and pCSFLW72 using polyethylenimine (PEI, Polysciences, Warrington, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Fusion assay: AAT-GFP1-10 and AAT-BSR-GFP11 cells were trypsinized and mixed at a ratio of 1:1 to seed a total of 2x10^4 cells/well in black 96-well plate (Greiner) in FluoroBrite DMEM medium (Thermo Fischer Scientific) supplemented with 2% FBS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>AAT-BSR-GFP11</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Generation of cell lines used for fusion assays: Retrovirus vectors were produced by transfecting HEK- 293T cells with plasmid pQCXIP-GFP1-10 (Addgene #68715) or pQCXIP-BSR-GFP11 (Addgene #68716)53 and packaging vectors expressing MLV gal-pol and VSV-G using Lipofectamine 3000 (Invitrogen) according to manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pQCXIP-GFP1-10</div><div>suggested: RRID:Addgene_68715)</div></div><div style="margin-bottom:8px"><div>pQCXIP-BSR-GFP11</div><div>suggested: RRID:Addgene_68716)</div></div><div style="margin-bottom:8px"><div>VSV-G</div><div>suggested: RRID:Addgene_138479)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK293T cells were transfected with the appropriate SARS-CoV-2 S gene expression vector (wild type or variant) in conjunction with p8.9171 and pCSFLW72 using polyethylenimine (PEI, Polysciences, Warrington, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCSFLW72</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sequences were aligned by mapping to the SARS-CoV-2 reference Wuhan-Hu-1 using Minimap2 (https://doi.org/10.1093/bioinformatics/bty191).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Minimap2</div><div>suggested: (Minimap2, RRID:SCR_018550)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were analysed using MARS software and plotted with GraphPad prims 9 software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Structural modelling: The file 6vsb_1_1_1.pdb containing a complete model of the full-length glycosylated spike homotrimer in open conformation with one monomer having the receptor-binding domain in the ‘up’ position was obtained from the CHARMM-GUI Archive [cite Woo et al. 2020, cite CHARMM-GUI 2021].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHARMM-GUI Archive</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Author Response

      Reviewer #1 (Public Review):

      In Wang et al., the authors investigate issues related to the relative proportion of flux for the enzymatic decarboxylation of pyruvate between PDH (pyruvate dehydrogenase) and PFOR (pyruvate-ferredoxin oxoreductase) in the model organism Synechococystis. The manuscript provides evidence that PDH becomes increasingly inactivated by a high ratio of NADH:NAD+ as well as evidence to suggest that PFOR is transcribed and remains intact under aerobic conditions. The authors put forward the theory that both PDH and PFOR are functionally active routes for pyruvate decarboxylation under aerobic conditions, whereas PFOR has previously been assumed to be inactive under growth conditions containing oxygen. This distinction is particularly highlighted by conditions where Synechocystis is grown photomixotrophically - and where the NADH:NAD+ pool may be relatively over-reduced because of two parallel inputs of reductant (water-splitting at PSII and catabolism of glucose). The authors examine growth under photoautotrophic and photomixotrophic conditions for a number of relevant mutants including members of the ferredoxin/flavodoxin family, PFOR, and NDH-1 complex subunits.

      The theory put forward in this manuscript is of general interest regarding electron flux through the combined electron transport chain (photosynthetic + respiratory) of cyanobacteria. The authors further broaden the potential audience for the manuscript by elaborating on the potential significance of these results in the context of a switch from PFOR (ancestral) to PDH (oxygenic/modern).

      Comments:

      Generally, theories put forward in this manuscript are intriguing and have a number of potential implications for understanding electron flux and regulation of central metabolic processes in photosynthetic microorganisms. If these theories are supported and become more generally adopted, they would have significant impact on the understanding of the regulation of central carbon metabolism in cyanobacteria. That said (due in no small part to the complexity of some of these pathways), the evidence provided to support the hypotheses is indirect in many instances. In some cases, there is a pairing of indirect data with broad statements that can come across as over-reach. These problems can be somewhat exacerbated by an unclear organization at parts of the Discussion, a lack of succinctly defined claims, and numerous typographical considerations.

      Thank you very much for this point. We now reorganized the discussion and overhauled it completely. It starts with aspects that are best supported by our data. We then added two sentences to stress that the following lines include hypothetical considerations that are meant as thought-provoking impulses. We hope that thereby over-reach is prevented.

      Major considerations:

      A major component of the proposed theories in this manuscript rest upon the assumption that PFOR is an active enzyme under highly aerobic conditions: this claim is never directly demonstrated.

      This is true. We could show though that PFOR of Synechocystis is in constrast to most bacterial PFORs stable in the presence of oxygen. However, as stated likewise for the oxygen stable PFOR of the obligate aerobe Sulfolobus acidocaldarius (3), and PFOR from E. coli, which was recently shown to contribute to metabolism in the presence of oxygen in vivo (1) we as well had to remove oxygen for enzyme acitivty in vitro. This point is discussed frankly.

      Indirect evidence of altered growth of pfor mutants, increased repression of PDH, and the higher NADH:NAD+ ratio under photomixotrophic conditions is in general alignment with this theory. However, while deletion of pfor does indeed result in altered growth dynamics in Synechocystis under periods of photomixotrophy, the alterations do not entirely align with the idea that this pathway is critical for rapid growth under aerobic conditions. For instance, pfor and most of the highlighted mutants (fdx 3, fdx 9, isiB) presented in Figure 3 show the greatest defects in their OD after reaching stationary phase (more rapid decline in OD on/after Day 6) relative to WT. This doesn't align as nicely with the highest NADH:NAD+ seen in Days 3-5 (which is also specifically called out: e.g., Line 146, Supplemental Figure S8).

      We are very cautious to compare growth experiments day by day. This is due to the fact that the growth behaviour of WT and mutants differ between experiments. We therefore repeat these experiments in several independent experiments including at least three replicates and show the data of typical growth experiments. In the case of the shown growth behaviour of WT and pfor and the NADH/NAD+ ratios under photoautotrophic and photomixotrophic conditions shown in figure 1, NADH/NAD+ ratios were determined in exactly those cultures for which growth data are shown. It is therefore legitimate to directly compare these results day by day. However, we did not determine the NADH/NAD+ ratios of the cultures shown in Fig. 3. The rise in NADH might have started with a delay here.

      In this context, the deletion of F-GOGAT is much more convincing in it's severity and timing, yet for this mutation to have a more severe phenotype is unexpected if PFOR is one of the primary/sole electron donors to the ferredoxin pool from glucose utilization as proposed (i.e., stated differently, F-GOGAT is only one of the enzymes downstream of ferrodoxin and might be expected to have a more subtle phenotype in comparison to the KO of PFOR if that is a primary source for electrons to ferredoxin under photoheterotrophic conditions).

      F-GOGAT requires reduced ferredoxin which can be provided by PFOR and in addition also by PSI. As electrons from glucose oxidation can be fed via photosynthetic complex I into the PQ-pool they will eventually arrive at PSI (Fig. 3C) where ferredoxin can be reduced and transfer electrons to F-GOGAT. However, to get a truly complete picture of the situation several issues will have to be addressed in the future: we do not know which of the low abundant ferredoxins as well as high abundant ferredoxin 1 interact with PSI, F-GOGAT, PFOR and photosynthetic complex I. It would be furthermore helpful to know all midpoint potentials of the different ferredoxins. Without this information it might be too much to ask for a simple interpretation.

      A central tenant of the argument put forward on the evolutionary importance of using either PFOR vs. PDH is the conservation of extra free energy by the former reaction. However, additional information on the ferredoxin paralog(s) that accept electrons from PFOR is necessary to evaluate these claims. Based on the data within these manuscripts, Fdx3, Fdx9, and IsiB have the strongest links to PFOR: though the authors do take care to never state directly that they have evidence that these are the acceptors in vivo. Given the variability in the midpoint potentials of different ferredoxins, some ferredoxin acceptors may better conserve the free energy in pyruvate, while others may actually be more 'wasteful' than NAD+ as the acceptor through PDH. Unfortunately, the midpoint potentials for Fdx3, Fdx9, and IsiB are unknown or not stated in this manuscript. It is therefore unclear what ferredoxin is being used as the reference point for conservation of Gibbs free energy in Figure 4C and referenced multiple times in the text.

      We agree that it would be great if we already knew the redox potentials of all the ferredoxins involved. We are currently working on this issue. All that we know for now is that the redox potentials of ferredoxins lay between -240 mV to -680 mV whereas the redox potential is around -320 mV for NAD(P)H/NAD(P)+. Unpublished data that require further validation reveal that the redox potential of Fdx9 is definitely more negative than the redox potential of Fdx1 (-412 mV) in Synechocystis and is thereby clearly more negative that -320 mV. However, as these data require further validation, we did not name numbers. In addition, interaction studies on PFOR and low abundant ferredoxins are planed and preparations are in progress.

      Finally, the measurements of NADH:NAD+ (most prominently used for measurements in Fig 1B) utilized kits that require multiple, long centrifugation steps in the dark prior to assaying this rapidly exchanging pool. While it appears that the authors were able to get reproducible results with these kits, it is difficult to interpret what the increase in relative NADH levels in glucose-fed cells means given that 10+ minutes of incubation in the dark and/or changing temperatures elapsed after the cyanobacteria were removed from the incubator before the NADH:NAD ratio was assessed. While it superficially makes logical sense that the cytosol would be over-reduced when illuminated and under glucose feeding relative to illumination alone, it shouldn't be assumed that these measurements are representative of this rapidly-exchanging pool under the steady-state growth conditions.

      Thank you very much for raising this important point. We are very much aware of the difficulties to determine the redox state of NADH:NAD+ using these kits. However, there is no other method available that properly distinguishes NADH and NADPH. Furthermore, the centrifugation step was done at -9°C which should minimize metabolic reactions during this step. However, we now added in vivo measurements using the NAD(P)H-module available for the PAM and using the Dual-KLAS/NIR to determine the redox state of ferredoxin (newly added Fig. S4). Both methods show that NAD(P)H as well as ferredoxin are more strongly reduced under photomixotrphic conditions in comparison to photoautotrophic conditions and thus support our previous data.

      Reviewer #2 (Public Review):

      The observation that cyanobacteria can use two alternative pyruvate decarboxylating enzymes using either NAD+ or ferredoxin is an interesting and the work is useful contribution. The authors very nicely characterize the enzymatic properties of the two pyruvate metabolizing enzymes and also are able to connect the ideas of redox balance with a set of ferredoxins. Even though they are not able to definitively characterized the specific ferredoxin which interacts with the enzyme, the analysis is nicely conducted and it's clear that the suggestion they're making regarding the involvement of the minor ferredoxins is compelling. However, the work could be written in a way that might be more useful.

      Specific comments:

      Overall this is an interesting study, but the arguments could be sharpened and better connected with the literature. The introduction needs to be considerably revised in my opinion. It is not obvious whether it is even appropriate to discuss the enzymes as an aerobic enzymes or aerobic enzymes, since this concept is simplistic and perhaps, archaic. Indeed, placing the results of the present study in the context of "aerobic enzymes versus aerobic enzymes" is a bit of a 'strawman' argument. For example, the counter examples of O2-tolerant enzymes cited seem to suggest that PFORs have been capable of evolving into O2-tolerant enzymes quite readily and that two types of decarboxylase have evolved for quite different reasons than simple replacement for a new environment. Instead, I think a more current and general perspective relates more to the interpretation that the authors are already putting forth. Namely, the enzymes are utilized according to redox balance considerations rather than sensitivity to oxygen.

      Therefore, I think the very long and pedantic introduction is useful for review, but only if it is shortened and also includes the alternative interpretation regarding adaptations to redox potential in the cytoplasm. My guess is that there are plenty of examples of redox balance function arguments in the literature to refer to in contrast to the evolutionary replacement argument used. Certainly, there are good examples regarding glucose toxicity in mutants of Synechocystis that can be considered.

      Thank you very much for this point. The O2-tolerant PFORs mentioned were merely shown to be stable in the presence of oxygen in vitro which means that they can be isolated under anaerobic conditions. However, all enzymatic in vitro assays required anaerobic conditions. Only one PFOR was shown to be active in the presence of oxygen in vitro. Physiological studies on the importance of these enzymes under aerobic conditions in vivo are completely missing. However, animated by the requests of the reviewers we searched the literature intensively again and indeed found a recent report, which describes the involvement of PFOR in redox regulation in an aerobic culture of an E. coli mutant, in which glucose-6P dehydrogenase (ZWF) was down-regulated (1). We included this study both in our introduction and discussion. It very much supports our own findings, as the E. coli PFOR requires likewise anoxic conditions in in vitro enzyme tests. We agree that the idea that PDH complex and PFOR are exclusively regulated by oxygen availability might sound simplistic. However, we do not fully agree that this is a strawman argument as both enzyme systems are still mostly discussed as counterparts for either aerobic respiration (PDH complex) or anaerobic fermentation (PFOR)(4). To the best of our knowledge, the study that was included now and our own data, are the very first ones that put clearly forward the idea, that redox control governs the activity of these enzyme systems at the pyruvate node independent of oxygen. However, doubts about the rather simplistic distinction between aerobic versus anaerobic enzymes in general have indeed been expressed. Even though these studies in general lack physiological in vivo experiments. We therefore included this information in the introduction as well. (line 76: There are several reports on the aerobic expression of enzymes that are assigned to anaerobic metabolism in prokaryotes and eukaryotes and therefore challenge the simplistic distinction between aerobic versus anaerobic enzymes (5-7). Their physiological significance and regulation are only partly understood.) This did not result in a shortened introduction though as additional information was added. The new introduction thus includes alternative interpretations as requested and is therefore hopefully more balanced.

      Given the interpretation that the alternative forms of the enzyme help cells adjust their redox balance to different conditions, such as photomixotrophic growth, the very nice enzymatic analysis and growth studies of the mutants work would be significantly strengthened by more direct physiological measurements that report intracellular redox states.

      Thank you very much for this important point. Intracellular redox states were shown by measurements of the NAD+/NADP level (Figure 1B) and were now extended by new in vivo measurements that show that both the NAD(P)H and the ferredoxin pools are more reduced under photomixotrophic in contrast to photoautotrophic conditions (new Fig. S4).

      Minor comments:

      line 211: Perhaps, "..the deleted alleles failed to segregate, keeping some wild type copies."

      This was changed to: the deleted alleles of fx2 (sll1382) and fx5 (slr0148) failed to segregate, keeping some wild type copies.

      It would be interesting to characterize whether the observed distribution of PFOR correlates with specific physiological features. In other words, PFOR seems to become important upon the addition of an external carbon source in way that must integrate with autotrophic metabolism (i.e. mixotrophic growth) altering the balance of the oxidized and reduced form of redox cofactors--does the observed distribution correlate at least with the metabolic characteristics of the handful that have been studied in the lab?

      Thank you very much for this suggestion. We checked the lists of cyanobacteria that either possess or do not possess a PFOR in order to search for shared known physiological features. However, the challenge is currently that the number of uncharacterized cyanobacteria in our list is too large. It is therefore impossible to find solid correlations. But we fully agree that it would be interesting to find these.

      A more detailed set of calculations that help explain panel C in figure 4 need to be included to support the quoted values for redox potential in free energy. I assume these are standard values and and the specific superscripts and subscription associate with the ΔG nomenclature needs to be defined.

      The calculations are shown in the materials and methods part. A respective notice (for calculations see materials and methods part) is now given in the legend of Fig. 4C. Information concerning the nomenclature is found in the cited literature in the materials and methods part as well.

      Reviewer #3 (Public Review):

      The manuscript by Wang et al. conclusively demonstrates that the cyanobacterium Synechocystis sp. PCC6803 prefers to use the ferredoxin-reducing enzyme PFOR over the NAD+-reducing PDH-pathway when grown under photomixotrophic conditions while the PDH-route is favored under photoautotrophic conditions. Both the potential physiological meaning of this switch and implications for the evolutionary history of the role of the respective enzymes and their pathways are discussed.

      The main hypothesis of this work considers that PFOR-mediated decarboxylation of pyruvate replaces the PDH-based one when cells shift from photoautotrophic to photomixotrophic growth conditions. This hypothesis is assessed via the comparison of growth curves measured on a host of deletion mutants and via direct detection of expression levels of certain enzymes. The authors' hypothesis is robustly supported by the majority of the reported experiments and the reviewer is fully convinced by these data. However, I would hold that the data shown with respect to phosphorylation of PDH (Fig. S4) are unconvincing. I can't see a clear difference in growth-curves for the incriminated mutants deltaspkB and L which would convincingly exceed the variation observed for the entire dataset.

      We agree that the data on the phosphorylation of the PDH complex including the kinase mutants are not very convincing. We were uncertain from the beginning on whether it would be a good idea to include these data sets and therefore discussed them very cautiously in the manuscript. Anyway, as the enzymatic tests with the E3 subunit of the PDH complex at different NADH concentrations show convincingly that high NADH levels have an inhibitory effect on the complex, we now decided to delete both data sets out of the manuscript, as they are not really required for the statement of the manuscript.

      1) S. Li et al., Dynamic control over feedback regulatory mechanisms improves NADPH flux and xylitol biosynthesis in engineered E. coli. Metab Eng 64, 26-40 (2021).

      2) T. Nakayama, S. Yonekura, S. Yonei, Q. M. Zhang-Akiyama, Escherichia coli pyruvate:flavodoxin oxidoreductase, YdbK - regulation of expression and biological roles in protection against oxidative stress. Genes Genet Syst 88, 175-188 (2013).

      3) A. Witt, R. Pozzi, S. Diesch, O. Hädicke, H. Grammel, New light on ancient enzymes – in vitro CO2 Fixation by Pyruvate Synthase of Desulfovibrio africanus and Sulfolobus acidocaldarius. The FEBS Journal 286, 4494-4508 (2019).

      4) M. Müller et al., Biochemistry and Evolution of Anaerobic Energy Metabolism in Eukaryotes. Microbiology and Molecular Biology Reviews 76, 444 (2012).

      5) S. B. Gould et al., Adaptation to life on land at high O2 via transition from ferredoxin-to NADH-dependent redox balance. Proceedings of the Royal Society B: Biological Sciences 286, 20191491 (2019).

      6) O. Schmitz, J. Gurke, H. Bothe, Molecular evidence for the aerobic expression of nifJ, encoding pyruvate : ferredoxin oxidoreductase, in cyanobacteria. FEMS Microbiol. Lett. 195, 97-102 (2001).

      7) K. Gutekunst et al., LexA regulates the bidirectional hydrogenase in the cyanobacterium Synechocystis sp. PCC 6803 as a transcription activator. Molecular Microbiology 58, 810-823 (2005).

    1. SciScore for 10.1101/2021.12.30.21268540: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Clinical cohorts and samples: Characterization of these samples at Stanford was performed under a protocol approved by the Institutional Review Board of Stanford University (protocol<br>Consent: All participants gave written informed consent, and all study procedures were approved by the Institutional Review Board of Stanford University (IRB-55619).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">There are 28 males and 29 females in the study.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Stanford Lambda cohort: 120 participants were enrolled in a phase 2 randomized controlled trial of Peginterferon Lambda-1a (Lambda, NCT04331899) Inclusion/exclusion criteria and the study protocol for the trial have been published(12).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After poly-D-lysine treatment, plates were washed three times with sterile water and then seeded with 1.5e6 cells of HEK 293T per well.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293T</div><div>suggested: KCB Cat# KCB 200744YJ, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Prior to infection, Vero E6-TMPRSS2-T2A-ACE2 cells were washed with 1X PBS and then 50 μL of the incubated pseudotyped particles and patient plasma mixture was then transferred from the U-bottom 96-well dilution plates onto the monolayer and placed into an incubator at 37°C and 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6-TMPRSS2-T2A-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 spike variant spike construction: The WT SARS-CoV-2 spike gene was previously amplified with KOD Xtreme Hot Start DNA polymerase (Millipore) using cDNA from SARS-CoV-2/human/USA/WA-CDC-WA1/2020 (GenBank MN985325.1) and cloned into pCC1BAC-his3 vector (27).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCC1BAC-his3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">50 fmol of each amplicon and 15 fmol of YCP/BAC vector were covalently joined using standard Gibson assembly reaction (NEB), transformed into E.coli DH10B competent cells (Thermo Fisher), and plated on LB medium with 12.5 mg/ml chloramphenicol.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>YCP/BAC</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Lastly, the spike genes lacking the cytoplasmic domain by deleting the last 18 amino acides were then cloned into the pCAGGS expression vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAGGS</div><div>suggested: RRID:Addgene_127347)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 24 hours (h), cells were transfected with 1 µg of pCAGGS-SΔ18 per well using Lipofectamine 2000 transfection reagent (ThermoFisher, Cat. No., 11668019).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAGGS-SΔ18</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A non-linear curve and the half-maximal pseudoparticle neutralization titer (pNT50) were generated using GraphPad Prism.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pNT50</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">E.coli transformants were verified to contain correct mutations using PCR and Sanger sequencing (GeneWiz).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GeneWiz</div><div>suggested: (GENEWIZ, RRID:SCR_003177)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A non-linear curve and the half-maximal pseudoparticle neutralization titer (pNT50) were generated using GraphPad Prism.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04331899</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Completed</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Single-Blind Study of a Single Dose of Peginterferon Lambda-…</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.30.21267140: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: 15 Enrolled participants were randomized 1:1 to receive lenzilumab or matched placebo in addition to current standard treatments per institutional guidelines at each site.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Trial Design: LIVE-AIR is a randomized, double-blind, placebo-controlled, phase 3 trial (NCT04351152) and enrolled hospitalized participants with COVID-19 pneumonia.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      No key resources detected.


      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      12 Limitations are associated with the analytic approach herein. The exploratory analysis of CRP as it relates to the primary endpoint of the likelihood of achieving SWOV was pre-specified, all other analyses were post-hoc, and none were prospectively powered. Therefore, the results should be interpreted with this caveat in mind. The findings herein will be further evaluated in the NIH-sponsored ACTIV-5/BET-B trial, that includes lenzilumab and where the primary efficacy analysis prospectively evaluates incidence of IMV, ECMO, or death in participants with baseline CRP<150 mg/L. In summary, this comprehensive analysis of LIVE-AIR CRP data provides evidence for the utility of CRP to predict progression to IMV and death. GM-CSF neutralization with lenzilumab significantly improved SWOV in adults hospitalized with COVID-19 pneumonia compared to placebo. Those participants who had baseline CRP levels <150 mg/L responded more favorably to lenzilumab treatment, than those with CRP>150 mg/L. These finding suggest that CRP may be a useful biomarker in determining which participants may be most successfully treated with lenzilumab.

      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04351152</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Active, not recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Phase 3 Study to Evaluate Efficacy and Safety of Lenzilumab …</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04280705</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Completed</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Adaptive COVID-19 Treatment Trial (ACTT)</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.29.474471: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A chimeric neutralizing antibody specific against SARS-CoV-2 S protein receptor binding domain (NR-55410) was provided by ACROBiosystems through BEI resources.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2 S protein receptor binding domain</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Rabbit monoclonal anti-N antibody (Sino Biologicals #40143-R001) was diluted 1:5,000 in 0.1% Tween-20 in PBS (PBS-T), and incubated on samples overnight at 4 °C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-N</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Huh7.5-hAT cells (provided by Gregory Melikian and Mariana Marin), have been modified to stably express human ACE2 and human TMPRSS2, to enhance infection by SARS-CoV-2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Huh7.5-hAT</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A549 (ATCC) are derived from human adenocarcinoma cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549</div><div>suggested: NCI-DTP Cat# A549, RRID:CVCL_0023)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Human embryonic kidney (HEK) 293T cells stably express the SV40 large T antigen, are resistant to neomycin, and were selected for their high transfectability (ATCC).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">293T-hAT cells (provided by Bruce Torbett) have been modified to stably express human ACE2 and human TMPRSS2, to permit infection by SARS-CoV-2</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T-hAT</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Chinese hamster ovary (CHO)-K1 cells (ATCC) are a clonal derivative of the parental CHO cell line and were cultured in humidified conditions at 37 °C in 5% CO2 in F12 medium supplemented with 10% FBS, 2 mM L-glutamine, and 100 U/ml penicillin and 100 μg/ml streptomycin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHO)-K1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CHO</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Both Caco2 and Calu3 cells were cultured in humidified conditions at 37 °C in 5% CO2 in Eagle’s minimum essential medium (EMEM) supplemented with 10% FBS, 2 mM L-glutamine, NEAA, and 100 U/ml penicillin and 100 μg/ml streptomycin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Calu3</div><div>suggested: RRID:CVCL_EQ19)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Construction of the SARS-CoV-2 subgenomic replicon (SARS-2R): DNA fragments of SARS-CoV-2 replicon were either synthesized from Integrated DNA Technologies Inc or amplified by reverse transcription and PCR (RT-PCR) with viral RNA template that was extracted from the supernatants of SARS-CoV-2-infected Vero cells (SARS-CoV strain 2019-nCoV/USA_WA1/2020 (WA1).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were pulsed once at 280 V for BHK-21 cells and 250 V for 293T cells with Ingenio EZporator MIR51000 electroporation system in low voltage (LV) mode (150 Ω internal resistance and 1050 μF capacitance).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Determination of Replicon EC50 and EC90 values: BHK21 cells seeded in 6-well plate were transfected with SARS-2R using jetPRIME transfection reagent (Polyplus transfection).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK21</div><div>suggested: ECACC Cat# 05062302, RRID:CVCL_6F52)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Generation of cells that carry SARS-2R replicon: BHK-21 cells were seeded into a 6-well plate, then transfected with replicon SARS-2R_NG_NeoR_NL using jetPRIME transfection reagent following the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK-21</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">qPCR to determine levels of SARS-CoV-2 nucleic acid: RNA and DNA was harvested from the BHK-SARS-2R_GFP_NeoR_NL cell line using the RNeasy mini kit (Qiagen) and the QIAamp genomic DNA mini kit (Qiagen), respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK-SARS-2R_GFP_NeoR_NL</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To titer viral stocks, VeroE6 cells were seeded in a 96-well plate at 20,000 cells per well.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Target cells were seeded at 4 × 104 cells/well (293T, 293T-hAT) or 2 × 104 cells/well (Huh-7.5, Huh7.5-hAT) and incubated at 37 °C for 24 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Huh-7.5</div><div>suggested: RRID:CVCL_7927)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Production of SARS-CoV-2 stocks: SARS-CoV-2 stocks were produced by infection of VeroE6 with SARS-CoV strain 2019-nCoV/USA_WA1/2020 or SARS2 hCoV-19/England/204820464/2020 (B.1.1.7).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmids, antivirals and chemicals: Plasmids pLVX-EF1a-IRES-Puro SARS-CoV-2 E_NR-52967 and pLVX-EF1a-IRES-Puro SARS-CoV-2 M_NR-52968 (BEI) were gifts from Nevan Krogan (University of California, San Francisco) (71).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLVX-EF1a-IRES-Puro</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-S in pCAGGS was a gift from Paul Bates (University of Pennsylvania) (72).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAGGS</div><div>suggested: RRID:Addgene_127347)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 S was synthesized (Genscript) and cloned into pcDNA3.1 between two PmeI sites using NEBuilder.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Multi-step cloning strategy was used, whereby the fragments named SARS-CoV-2/1 to SARS-CoV-2/9 were sequentially cloned into pBeloBAC11 vector to generate pBAC-SARS-CoV-2-REP.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pBeloBAC11</div><div>suggested: RRID:Addgene_60342)</div></div><div style="margin-bottom:8px"><div>pBAC-SARS-CoV-2-REP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Each well was transfected with 1 μg replicon SARS-2R_GFP_NeoR_NL, and 0.25 μg each of N, E, and M expression vectors, and 0.25 μg of expression vectors for one of SARS-CoV S, SARS-CoV-2 S, VSV-G or an empty vector, with 4 μl jetPRIME transfection reagent (Polyplus).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VSV-G</div><div>suggested: RRID:Addgene_138479)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">293T-hAT cells (provided by Bruce Torbett) have been modified to stably express human ACE2 and human TMPRSS2, to permit infection by SARS-CoV-2</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: (BioLegend Cat# 946101, RRID:AB_2892515)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Images were captured as a 5×4 matrix and GFP positive cells were enumerated using Gen5 software (Biotek).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gen5</div><div>suggested: (Gen5, RRID:SCR_017317)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The number of infected cells at each compound concentration was determined by high content microscopy and dose response curves were plotted and EC50s calculated with Prism software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A theoretically perfect assay would have Z’ = 1. Statistics: Data were tabulated and graphs plotted using Excel (Microsoft) or Prism (Graphpad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Excel</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Graphpad</div><div>suggested: (GraphPad, RRID:SCR_000306)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      A primary limitation in SARS-CoV-2 research is the high risk associated with working with a pathogenic respiratory pathogen, in terms of both the availability of suitable facilities and of suitably trained researchers. Here we present a range of approaches to facilitate research into all facets of SARS-CoV-2 replication, including cell entry, nucleic acid transcription and replication, and virus assembly and release; collectively these systems are tools to identify and characterize inhibitors at any point in SARS-CoV-2 replication. These systems are based on subgenomic SARS-CoV-2 replicons carrying reporter genes, reducing biological hazards and providing means to easily measure viral replication. The most popular strategy for generating replicons from positive-strand RNA virus is to transcribe RNA in vitro that can be electroporated into target cells to initiate replication. To facilitate use of the assay, particularly in the context of large-scale screening, we eliminated the need for in vitro transcription by cloning cDNA for the SARS-CoV-2 replicons into a BAC under control of a CMV promoter. The replicon comprised all replication-essential proteins and sequences but omitted the structural proteins S, E, and M; additionally, reporter genes were included as a separate ORF using the TRS-B of M to drive production of the sgRNA expressing the reporter cassette. Placing the reporter cassette in a sgRNA ensured that formation of a functional RTC was essential for reporter gene ...

      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04960202</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">EPIC-HR: Study of Oral PF-07321332/Ritonavir Compared With P…</td></tr></table>


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.27.21268459: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Ethics statement: This study was approved by the National Bioethics Committee of the Dominican Republic (CONABIOS).<br>Consent: Informed consent was obtained from all enrolled vaccinated.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">ELISA and neutralizations were performed blinded.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Contamination: The cell line has been tested negative for contamination with mycoplasma.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were washed three times with PBS-T (PBS with 0.1% Tween-20) and 50 μl of HRP anti-Human IgG Antibody (GenScript #A00166, 1:5,000) diluted in dilution solution added to each well.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Human IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, 300 μl of serial fold virus dilutions were used to infect Vero E6 cells in MEM supplemented NaHCO3, 4% FBS 0.6% Avicel RC-581.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Health care worker (HCW) volunteers from the Yale New Haven Hospital (YNHH) were enrolled and included in this study (IRB Protocol ID 2000028924, approved by the Yale Human Research Protection Program Institutional Review Board.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Yale Human Research Protection Program</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The clinical data were collected using REDCap (v5.19.15 @2021 Vanderbilt University) software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>REDCap</div><div>suggested: (REDCap, RRID:SCR_003445)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: All analyses of patient samples were conducted using GraphPad Prism 8.4.3 and JMP 15.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.28.474336: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: All animal studies were conducted in compliance with all relevant local, state, and federal regulations and were approved by the Bioqual Institutional Animal Care and Use Committee (IACUC)<br>IACUC: All animal studies were conducted in compliance with all relevant local, state, and federal regulations and were approved by the Bioqual Institutional Animal Care and Use Committee (IACUC)</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Animals and study design: Outbred adult male and female rhesus macaques (M. mulatta) and cynomolgus macaques (M. fascicularis), 6–12 years old, were randomly allocated to groups.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Animals and study design: Outbred adult male and female rhesus macaques (M. mulatta) and cynomolgus macaques (M. fascicularis), 6–12 years old, were randomly allocated to groups.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">All immunological and virological assays were performed blinded.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Contamination: The UVC preparations for use in non-human primate studies were analyzed for endotoxin levels (Wickham Laboratories Ltd) and absence of mycoplasma (Mycoplasma Experience Ltd).</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were then stained for intracellular spike protein using an Anti-SARS-CoV-2 Spike Glycoprotein S1 antibody (Abcam, ab275759, 1:50) followed by Goat Anti-Rabbit IgG H&L (Alexa Fluor 488) (Abcam, ab150077, 1:500).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ab275759</div><div>suggested: (Abcam Cat# ab275759, RRID:AB_2892127)</div></div><div style="margin-bottom:8px"><div>Anti-Rabbit IgG</div><div>suggested: (Abcam Cat# ab150077, RRID:AB_2630356)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Flow cytometry analysis of cell surface antigen expression: For flow cytometric analysis of cell surface expression of MHC-I, MICA and SARS-CoV-2 spike protein, cells were harvested from culture plates and washed using PBS with 1% Bovine Serum Albumen (Thermo Scientific) and were then stained with PE anti-human MICA/MICB Antibody (6D4, Biolegend)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2 spike protein</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human MICA/MICB</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>6D4</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Alexa Fluor 647 anti-human HLA-A,B,C (W6/32, Biolegend), and anti-SARS-CoV-2 Spike Glycoprotein S1 antibody (Abcam, ab275759, 1:50) followed by Goat Anti-Rabbit IgG H&L (Alexa Fluor 488) (Abcam, ab150077, 1:500).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human HLA-A</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>W6/32</div><div>suggested: (Bio-Rad Cat# MCA81A488, RRID:AB_324712)</div></div><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 Spike Glycoprotein S1</div><div>suggested: (Abcam Cat# ab275759, RRID:AB_2892127)</div></div><div style="margin-bottom:8px"><div>ab150077</div><div>suggested: (Abcam Cat# ab150077, RRID:AB_2630356)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Membranes were blocked in blocking buffer (5% non-fat powdered milk in TBST), before incubation with primary antibodies in blocking buffer (Rabbit polyclonal anti-SARS-Cov2, Sino Biological 40591-T62, 1:6000 dilution or Mouse b-actin, Abcam 8226, 1 μg/ml), detected with HRP conjugated secondaries in blocking buffer (Goat anti-Rabbit HRP, Sino Biological SSA003, 0.5 μg/ml or Goat anti-Mouse HRP, Abcam ab205719, 1: 4000 dilution) and visualised using the SuperSignal West Femto kit (ThermoFisher) as per kit instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-Cov2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>b-actin , Abcam 8226 , 1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-Rabbit</div><div>suggested: (Sino Biological Cat# SSA003, RRID:AB_2814815)</div></div><div style="margin-bottom:8px"><div>anti-Mouse HRP</div><div>suggested: (Abcam Cat# ab205719, RRID:AB_2755049)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 48 hours of culture, transfected cells were stained with aqua dye for live/dead discrimination and corresponding antibodies-MICA/MICB (Clone 6D4, PE, BioLegend) or ULBP-1 (clone 170818, PE, R & D Systems).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antibodies-MICA/MICB</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-CD107a antibody (clone H4A3, ECD conjugate, BD Biosciences)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-CD107a</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, luciferase reporter plasmid pLenti-CMV Puro-Luc (Addgene), and spike protein expressing pcDNA3.1-SARS-CoV-2 SΔCT were co-transfected into HEK293T cells with calcium phosphate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: KCB Cat# KCB 200744YJ, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To determine the neutralization activity of the antisera from vaccinated macaques, HEK293T-hACE2 cells were seeded in 96-well tissue culture plates at a density of 1.75 × 104 cells per well overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T-hACE2</div><div>suggested: RRID:CVCL_A7UK)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, to generate a standard curve, the SARS-CoV-2 E gene sgRNA was cloned into a pcDNA3.1 expression plasmid; this insert was transcribed using an AmpliCap-Max T7 High Yield Message Maker Kit (Cellscript) to obtain RNA for standards.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, the packaging construct psPAX2 (AIDS Resource and Reagent Program)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>psPAX2</div><div>suggested: RRID:Addgene_12260)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, luciferase reporter plasmid pLenti-CMV Puro-Luc (Addgene), and spike protein expressing pcDNA3.1-SARS-CoV-2 SΔCT were co-transfected into HEK293T cells with calcium phosphate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLenti-CMV</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pcDNA3.1-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For analysis by TIDE, PCR amplicons were Sanger sequenced (Eurofins or Genewiz) and paired .</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Genewiz</div><div>suggested: (GENEWIZ, RRID:SCR_003177)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Intracellular spike protein staining: Engineered UVC were harvested and then fixed and permeabilized using BD Cytofix/Cytoperm Fixation/Permeabilization Solution (ThermoFisher).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BD Cytofix/Cytoperm Fixation/Permeabilization Solution</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Flow analysis was carried out on a Fortessa flow cytometer (BD Bioscience), and data analyzed, and flow cytometry figures generated using FlowJo 10 software (BD Biosciences)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">GraphPad Prism was used to plot a standard curve and interpolate the sample values using a 4-parameter logistic fit.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, the packaging construct psPAX2 (AIDS Resource and Reagent Program)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>AIDS Resource and Reagent Program</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical Analyses: Statistical differences between two sample groups, where appropriate, were analyzed by a standard Student’s two-tailed, non-paired, t-test and between three or more sample groups using two-way or three-way ANOVA using GraphPad Prism 9.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      A limitation of the WA1/2020 UVC in a Delta heterologous challenge was the absence of any meaningful protection in nasal swabs. This discordance between vaccine variant, versus virus variant, is the principal challenge facing current vaccinated populations and might suggest the reason for ongoing infectious spread but more limited morbidity and mortality against these emerging variants29, 31. As regards duration of protection, the theoretical hyper-immunity postulated by creating a self-adjuvanting, hyper-immune UVC established robust initial nAb titers. When these animals were rechallenged 6-month later, the nAb response stayed robust at the higher, and now established for clinical use, 1e8 UVC dose. Moreover, the persistent nAb response at 6-months remained robust for SARS-CoV-2 WA1/2020, Beta and Delta variants. As regards intrinsic safety, the UVC undergoes lethal irradiation during manufacture and rapid apoptosis in the immune microenvironment upon vaccination. This is the principal mechanism of efficacy of the UVC, and fortunately its most redeeming safety feature, by virtue of the impossibility of in vivo persistence and teratogenicity of the cellular antigen carrier. The irradiation-induced apoptosis is further enhanced by CRISPR genetic engineering to remove MHC-I expression and introduce cell surface expression of the NKG2D ligand MICA, making the UVC potent targets for host NK cells. Recruited NK cells will likely recognize the UVC as virally infected cell through ...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.27.474288: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: The study protocol was approved by the CUIMC Institutional Review Board (IRB) and all participants provided written informed consent.<br>Consent: The study protocol was approved by the CUIMC Institutional Review Board (IRB) and all participants provided written informed consent.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lysates and virions were analyzed by Western blotting with the following primary antibodies: rabbit anti-SARS-Spike S1 (Sino Biological, Cat# 40591-T62), rabbit anti-SARS-Spike S2 (Sino Biological, Cat# 40590-T62), rabbit anti-p55/p24/p17 (Abcam, Cambridge, MA (Cat# ab63917)), mouse anti-VSV NP (Millipore, Burlington, MA (Cat# MABF2348)) or mouse anti-GAPDH (Millipore, Cat# CB1001).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-Spike</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-SARS-Spike S2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-p55/p24/p17</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-VSV NP</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-GAPDH</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The Western blots were developed with the following secondary antibodies: HRP-conjugated anti-rabbit antibody (Cytiva, Marlborough, MA (NA934-1ML)) or HRP-conjugated goat antimouse antibody (Jackson ImmunoResearch, West Grove, PA (Cat# 115-035-008)).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: (GE Healthcare Cat# NA934, RRID:AB_772206)</div></div><div style="margin-bottom:8px"><div>antimouse</div><div>suggested: (C. Birchmeier - Max Delbruck Center for Molecular Medicine, Berlin, Germany Cat# Guinea pig anti-mouse Lbx1 polyclonal antibody, RRID:AB_2532144)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">S1, S2 and NP were detected as described above; huACE2-Fc bound to the pseudovirus particles was detected with Peroxidase AffiniPure goat anti-human IgG (H+L) antibody (Jackson ImmunoResearch).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines: HEK293T, 293T-ACE2 (BEI), Vero-E6, and COS-1 cells were cultured in Dulbecco modified Eagle medium (DMEM) supplemented with 10% fetal bovine serum (FBS) and 100 mg/ml penicillin-streptomycin (Thermo Fisher Scientific, Cambridge, MA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>COS-1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Expi293 cells were maintained in suspension culture directly in Expi293TM Expression Medium, supplemented with penicillin and streptomycin, and were incubated at 37°C in a humidified atmosphere of 8% CO2 in air and on a shaker platform rotating at 125 rpm.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Expi293</div><div>suggested: RRID:CVCL_D615)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero-E6 and COS-1 are from African green monkey kidneys.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">S glycoprotein expression, processing and incorporation into pseudovirus particles: HEK293T cells were transfected to produce VSV- and HIV-based particles pseudotyped with SARS-CoV-2 S glycoprotein variants, as described above.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: KCB Cat# KCB 200744YJ, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To measure the infectivity of pseudovirus variants on target cells expressing different levels of human ACE2, serial dilutions (from 2 μg to 24.7 ng) of the human ACE2 expressor plasmid (Addgene, Watertown, MA (Cat# 1786)) were transfected into 293T cells in 12-well plates using 1 mg/ml PEI.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Approximately 3 x 104 target cells (Vero-E6 or 293T-ACE2 cells) per well were then added.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">METHOD DETAILS: Plasmid constructs: The codon-optimized SARS-CoV-2 spike (S) gene (Sino Biological, Wayne, PA) encoding the S glycoprotein lacking 18 amino acids at the carboxyl terminus was cloned into the pCMV3 vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV3</div><div>suggested: RRID:Addgene_161029)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then, 7.5 μg of SARS-CoV-2 S glycoprotein expressor plasmid and 7.5 μg pHIV-1NL4-3ΔEnv-NanoLuc reporter construct were cotransfected into the HEK293T cells using Polyethylenimine (Polysciences).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHIV-1NL4-3ΔEnv-NanoLuc</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">S, S1, and S2 band intensities from unsaturated Western blots were calculated using ImageJ Software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The concentrations of huACE2-Fc that achieved an OD450 of 0.8 and and the serum endopoint dilution that achieved an OD450 value > 3-fold over background were calculated by fitting the data in five-parameter dose-response curves in GraphPad Prism 9 (GraphPad Software Inc.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a protocol registration statement.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.26.21268358: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: This study was conducted with the approval of the Ethics Committee of Kyorin University School of Medicine (Number R02-041; May 19, 2020).<br>Consent: Informed consent was obtained from all study participants.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 anti-spike antibody assay: SARS-CoV-2 anti-spike antibody measurements were performed on serum obtained from centrifuged peripheral blood using the Elecsys Anti-SARS-CoV-2 S RUO (Roche Diagnostics International Ltd, Rotkreuz, Switzerland) on a Cobas 6000 (Roche Diagnostics) analyzer via the double-antigen sandwich enzyme-linked immunoassay method [15].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-spike</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After incubation, 100 μL of the mixture was added to the Vero cells in a 96-well plate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Percent neutralization was calculated using GraphPad Prism 8.0.2 software (GraphPad Software, California, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      This study has some limitations. The number of participants was limited, and all participants were HCWs vaccinated at a single hospital. Multicenter studies with a larger sample size are needed. In individuals with low antibody response to other viral vaccines, the mechanism by which humoral immunity is acquired after mRNA vaccination needs to be clarified through future research. In conclusion, after two doses of the BNT162b2 vaccine, both low and normal responders to previous antiviral vaccines developed adequate levels of SARS-CoV-2 anti-spike and SARS-CoV-2 neutralizing antibodies to protect against SARS-CoV-2. However, both low and normal responders had lower SARS-CoV-2 anti-spike antibody levels in the fifth month than in the first month after receiving the second dose of BNT162b2 vaccine. Therefore, a third dose of BNT162b2 vaccine should be administered to all individuals, regardless of their antibody response to previous antiviral vaccines.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.27.474251: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 60 min incubation, plate wash step was repeated and the detection antibody, goat anti-human IgG-HRP (Thermo Fisher, SG) was added at 100 μL/well for an incubation of 60 min in dark.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG-HRP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Similarly, HDX was performed for nine convalescent antibodies - LSI-CoVA-014, LSI-CoVA-015, LSI-CoVA-016, and LSI-CoVA-017 identified in this study; and CR3022, CoVA2-04, CoVA-39, 4A8, and 5A6 (previous studies).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CR3022</div><div>suggested: (Imported from the IEDB Cat# CR3022, RRID:AB_2848080)</div></div><div style="margin-bottom:8px"><div>CoVA-39</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The peptides showing protection in the presence of antibody were provided as input under attractive amino acid residues at the protein-protein interaction interface in ClusPro, using a specific module for antigen-antibody docking.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antigen-antibody docking.</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Capture ELISA: Monoclonal human IgG1 antibodies LSI-CoVA-014, LSI-CoVA-015, LSI-CoVA-016, and LSI-CoVA-017 were conjugated individually to peroxidase as per manufacturer’s protocol (Abnova, TW).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>human IgG1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Monoclonal antibodies LSI-CoVA-014, LSI-CoVA-015, LSI-CoVA-016 and LSI-CoVA-017 were tested at several concentrations ranging from 0.01 ng/mL to 10 μg/mL.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>LSI-CoVA-015</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>LSI-CoVA-016</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2-Spike construct was expressed in Spodoptera frugiperda Sf9 cells following instructions from bac-to-bac baculovirus expression system (Thermo Fisher, SG).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Sf9</div><div>suggested: CLS Cat# 604328/p700_Sf9, RRID:CVCL_0549)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmid Sars-Cov-2 Spike HexaPro (addgene) was used to transfect HEK 293 cells with polyethylenimine (PEI).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293</div><div>suggested: CLS Cat# 300192/p777_HEK293, RRID:CVCL_0045)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">At Day 1, 36 ×106 HEK293T cells were transfected with 27 μg pMDLg/pRRE (Addgene, US), 13.5 μg pRSV-Rev (Addgene, US), 27μg pTT5LnX-WHCoV-St19 (SARS-CoV2 Spike) and 54 μg pHIV-Luc-ZsGreen (Addgene, US) using Lipofectamine 3000 transfection reagent (Thermo Fisher, SG) and cultured in a 37 °C, 5% CO2 incubator.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudovirus neutralization assay (PVNT): On Day 0, CHO cell lines with stable expression of ACE2 were seeded at a density of 5 x104 cells in 100 μL of complete medium [DMEM/high glucose with sodium pyruvate (Thermo Fisher, SG), supplemented with 10% FBS (Thermo Fisher, SG), 10%</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHO</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The antibody:pseudovirus mixtures were then added to CHO-ACE2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHO-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody and antigen expression and purification: Genes coding for variable regions of antibody heavy and light chain were synthesized and cloned into vector pTT5 expression vector (National Research Council Canada, NRCC) by Twist</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pTT5</div><div>suggested: RRID:Addgene_52326)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">At Day 1, 36 ×106 HEK293T cells were transfected with 27 μg pMDLg/pRRE (Addgene, US), 13.5 μg pRSV-Rev (Addgene, US), 27μg pTT5LnX-WHCoV-St19 (SARS-CoV2 Spike) and 54 μg pHIV-Luc-ZsGreen (Addgene, US) using Lipofectamine 3000 transfection reagent (Thermo Fisher, SG) and cultured in a 37 °C, 5% CO2 incubator.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pMDLg/pRRE</div><div>suggested: RRID:Addgene_12251)</div></div><div style="margin-bottom:8px"><div>pRSV-Rev</div><div>suggested: RRID:Addgene_12253)</div></div><div style="margin-bottom:8px"><div>pHIV-Luc-ZsGreen</div><div>suggested: RRID:Addgene_39196)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">GraphPad Prism was used for plots and one-way ANOVA statistical analysis.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Homology modelling of single Fab arm: Homology models of Fab arms of LSI-CoVA-014, LSI-CoVA-015, LSI-CoVA-016, and LSI-CoVA-017 were modelled using Modeller version 9.21 (43).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Modeller</div><div>suggested: (MODELLER, RRID:SCR_008395)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Position specific iterative - BLAST was used to identify the template structures with high sequence identity and structures available at PDB were chosen. 7K8R, 6DWZ, 6DF2, and 7JXE were used as template structures to model peptides spanning heavy chain and light chain of LSI-CoVA-014, LSI-CoVA-015, LSI-CoVA-016, and LSI-CoVA-017 respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BLAST</div><div>suggested: (BLASTX, RRID:SCR_001653)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Hetero dimers containing heavy and light chain for respective antibodies were complexed by aligning to the respective template structures in PyMol (Schrodiner Inc, USA)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMol</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The epitope sites on RBD and NTD identified using HDXMS for each antibody were chosen to perform a biased docking using ClusPro 2.0 webserver (</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ClusPro</div><div>suggested: (ClusPro, RRID:SCR_018248)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A total of 20 Fab:RBD/NTD complexes from four different Fab arms were modelled using CHARMM-GUI and simulated in GROMACS package version 2018.4 (50).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GROMACS</div><div>suggested: (GROMACS, RRID:SCR_014565)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.26.474192: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HRP-conjugated secondary antibodies against the T7-tag were diluted at 1:5,000 or 1:75,00 in the blocking buffer and incubated for 1 hour at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>T7-tag</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A validated SARS-CoV-2 antibody-negative human serum control and a validated NIBSC SARS-CoV-2 plasma control were obtained from the National Institute for Biological Standards and Control, UK) and an uninfected cells control were also used to ensure that virus neutralization by antibodies was specific.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Control, UK</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A 96-well ELISA plate (R&D system) was coated with the RBD protein or the HEK-293T cell lysate at an amount of approximately 3-5 ng per well in a coating buffer (15 mM sodium carbonate, 35 mM sodium bicarbonate, pH 9.6) overnight at 4°C, with subsequent blockage with a blocking buffer (DPBS, v/v 0.05% Tween 20, 5% milk) at room temperature for 2 hours.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudotyped SARS-CoV-2 neutralization assay: The 293T-hsACE2 stable cell line (Cat# C-HA101, Lot# TA060720C) and pseudotyped SARS-CoV-2 (Wuhan-Hu-1 strain, D614G, Alpha, Beta, Lambda, Delta and Omicron) particles with luciferase reporters were purchased from the Integral Molecular.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T-hsACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The Nb–virus mixes (220 μl total) were incubated at 37°C for 1 h, after which they were added dropwise onto confluent Vero E6 cell (ATCC® CRL-1586™, for Munich) or Vero E6-TMPRSS2-T2A-ACE2 cells (BEI cat# NR- 54970, for Delta) monolayers in the six-well plates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Vero E6-TMPRSS2-T2A-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The monomeric Nbs 2-31 and 2-45 were also cloned into a pET-22b(+) vector at the BamHI and XhoI sites for periplasmic expression.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pET-22b(+)</div><div>suggested: RRID:Addgene_12651)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The PCR fragment was then inserted into the 2-45 pET-21b(+) vector at the same restriction sites to produce the heterodimer 2-45-(GGGGS)3-2-31.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pET-21b(+)</div><div>suggested: RRID:Addgene_112204)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Crystallographic analysis of psNbs with RBD: The receptor-binding domain (RBD) of the SARS-CoV-2 spike (S) protein (GenBank: QHD43416.1), used in the crystallographic study, was cloned into a customized pFastBac vector (69), and fused with an N-terminal gp67 signal peptide and C-terminal His6 tag (70).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pFastBac</div><div>suggested: RRID:Addgene_1925)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The MS data obtained from different RBD-specific VHH isolations were analyzed by AugurLlama to identify high-affinity Nbs for each RBD (15).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>AugurLlama</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were processed by Prism 9 (GraphPad) to fit into a 4PL curve and to calculate the logIC50 (half-maximal inhibitory concentration).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Automated data collection was carried out using serialEM (46) at a nominal magnification of 64,000x with a physical pixel size of 1.329 Å/pixel (0.6645 Å/pixel at super-resolution).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>serialEM</div><div>suggested: (SerialEM, RRID:SCR_017293)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Image processing was performed on-the-fly using CryoSPARC Live version 3.2 (47–49).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CryoSPARC</div><div>suggested: (cryoSPARC, RRID:SCR_016501)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Models were manually corrected in Coot (version 9.6.0) between rounds of read-space refinement in Phenix.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Coot</div><div>suggested: (Coot, RRID:SCR_014222)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Maps colored by local resolution were generated using RELION 3.1 (57).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RELION</div><div>suggested: (RELION, RRID:SCR_016274)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Iterative model building and refinement were carried out in COOT (74) and PHENIX (75), respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PHENIX</div><div>suggested: (Phenix, RRID:SCR_014224)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antigens were clustered at 70% sequence identity with a minimum length coverage of 15% using CD-HIT (78), the Bio.align pairwise sequence alignment module and CATH domain identifiers.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD-HIT</div><div>suggested: (CD-HIT, RRID:SCR_007105)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody hit rate calculation: We constructed a multiple sequence alignment for each antigen cluster using MAFFT (79) and selected a representative structure with highest structure coverage and resolution.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MAFFT</div><div>suggested: (MAFFT, RRID:SCR_011811)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Conservation scores range from 0 to ln(20) = 2.99, higher is more conserved.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Conservation</div><div>suggested: (Conservation, RRID:SCR_016064)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The simulation was run starting from the RBD structure (PDB 6lzg) using Gromacs 2020 version with the CHARMM36m force field (82).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gromacs</div><div>suggested: (GROMACS, RRID:SCR_014565)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sequences were aligned by MUSCLE (83) with default parameters.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MUSCLE</div><div>suggested: (MUSCLE, RRID:SCR_011812)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The phylogenetic tree was then constructed by the MEGA (84) using the maximized likelihood estimation method.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MEGA</div><div>suggested: (Mega BLAST, RRID:SCR_011920)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.26.21268380: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: The study was approved by the University of Cape Town Human Research Ethics Committee (ref: HREC 190/2020, 207/2020 and 209/2020) and the University of the Witwatersrand Human Research Ethics Committee (Medical) (ref.<br>Consent: Written informed consent was obtained from all participants.<br>Field Sample Permit: Isolation of PBMC: Blood was collected in heparin tubes and processed within 4 hours of collection.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All stimulations were performed in the presence of Brefeldin A (10 µg/mL, Sigma-Aldrich, St Louis, MO, USA) and co-stimulatory antibodies against CD28 (clone 28.2) and CD49d (clone L25) (1 µg/mL each; BD Biosciences, San Jose, CA, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD28</div><div>suggested: (BD Biosciences Cat# 347690, RRID:AB_647457)</div></div><div style="margin-bottom:8px"><div>CD49d</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were infected with 100 μL of the virus–antibody mixtures for 1 h, then 100 μL of a 1X RPMI 1640 (Sigma-Aldrich, R6504), 1.5% carboxymethylcellulose (Sigma-Aldrich, C4888) overlay was added without removing the inoculum.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>R6504</div><div>suggested: (Fitzgerald Industries International Cat# 10R-6504, RRID:AB_11190346)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Foci were stained with a rabbit anti-spike monoclonal antibody (BS-R2B12, GenScript A02058) at 0.5 μg/mL in a permeabilization buffer containing 0.1% saponin (Sigma-Aldrich), 0.1% BSA (Sigma-Aldrich) and 0.05% Tween-20 (Sigma-Aldrich) in PBS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-spike</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Secondary goat anti-rabbit horseradish peroxidase (Abcam ab205718) antibody was added at 1 μg/mL and incubated for 2 h at room temperature with shaking.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: (Abcam Cat# ab205718, RRID:AB_2819160)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">CB6 and CA1 monoclonal antibodies were used as controls.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CB6</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CA1</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">H1299-E3 cells were plated in a 96-well plate (Corning) at 30,000 cells per well 1 day pre-infection.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>H1299-E3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 pseudotyped lentiviruses were prepared by co-transfecting the HEK 293T cell line with the SARS-CoV-2 614G spike (D614G) or SARS-CoV-2 Beta spike (L18F, D80A, D215G, K417N, E484K, N501Y, A701V, 242-244 del</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293T</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 spike WGS and phylogenetic analysis: Whole genome sequencing (WGS) of SARS-CoV-2 was performed from nasopharyngeal swabs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>WGS</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Raw reads from the Illumina COVIDSeq protocol were assembled using the Exatype NGS SARS-CoV-2 pipeline v1.6.1, (https://sars-cov-2.exatype.com/).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: (BioLegend Cat# 946101, RRID:AB_2892515)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Samples were acquired on a BD Fortessa flow cytometer and analyzed using FlowJo (v10.8</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Statistical analyses were performed in Prism (v9; GraphPad Software Inc, San Diego, CA, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.28.474244: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: All animal procedures (including surgery, anesthesia, and euthanasia, as applicable) used in the current study were submitted to the Institutional Animal Care and Use Committee of the CIPHE approved by the French authorities (CETEA DSV – APAFIS#26484-2020062213431976 v6).<br>IRB: Ethics approval was given on February 5, 2020, by the French Ethics Committee CPP-Ile-de-France VI (ID RCB: 2020-A00256-33).<br>Consent: The study was conducted with the understanding and consent of each participant or their surrogate covering the sampling, storage, and use of biological samples.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Vaccination and infection of hCD40/K18-hACE2 transgenic mice: Mice of 8 to 12 weeks of age of both sexes received two intraperitoneal injections of the CD40.CoV2 vaccine (10 µg) plus polyinosinic-polycytidylic acid (Poly-IC; Oncovir) (50 µg) or poly(IC) alone three weeks apart.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Materials availability: The CD40.CoV2 vaccine generated in this study was deposited in GenBank: anti-human CD40 12E12 antibody IgG4 H chain (GenBank ID: AJD85779.1 residues 20-467) fused to SARS_CoV_2RBD (GenBank ID: UEP92470.1 residues 17-240) followed by EPEA (C-tag) and the anti-human CD40 12E12 antibody kappa L chain (GenBank ID: AJD85780.1 residues 21-236) fused sequentially to a linker (GenBank ID: AJD85777.1 residues 699-725), nucleocapsid phosphoprotein, partial [Severe acute respiratory syndrome coronavirus 2] (GenBank ID: QWE63393.1 residues 95-230), linker residues AR, Chain A, Spike protein S1 [Severe acute respiratory syndrome coronavirus 2] (GenBank ID: 7M8J_A residues 113-237), linker residues TR, and Sequence 12 from patent US 8518410</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C-tag</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">[IgG] Kits, MesoScale Discovery, Rockville, MD, USA) were used on all available plasma samples to measure plasma IgG antibodies to SARS-CoV-2, SARS-CoV, MERS-CoV, and HCoVs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>plasma IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody concentrations were quantified using a reference standard (ACE2 Calibration Reagent) and are expressed as units/mL (one unit per mL concentration of ACE2 Calibration Reagent corresponds to neutralizing activity of 1 µg/mL monoclonal antibody to SARS-CoV-2 Spike protein).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2 Spike protein) .</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The flow cytometry panel included a viability marker, CD3, CD4, and CD8 to determine the T-cell lineage, and IFN-γ, TNF, and IL-2 antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD3</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD4</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD8</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>TNF</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IL-2 antibodies</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IL-2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Infectious stocks were grown by inoculating Vero E6 cells and collecting supernatants upon observation of the cytopathic effect.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Heterozygous K18-hACE C57BL/6J mice (strain: 2B6.Cg-Tg (K18-ACE2)2Prlmn/J) were obtained from The Jackson Laboratory.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57BL/6J</div><div>suggested: RRID:MGI:3589388)</div></div><div style="margin-bottom:8px"><div>2B6.Cg-Tg ( K18-ACE2)2Prlmn/J</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For the AIM assay, PBMCs were stimulated in vitro with various concentrations of the CD40.CoV2 vaccine or an equimolar combination of 15-mer overlapping peptide pools covering the full-length sequence of vaccine antigens (vS1 + vS2 + vRBD + vN2) referred to as vOLPmix.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>vS1 + vS2 + vRBD + vN2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Distributions were plotted using SPICE version 5.22, downloaded from http://exon.niaid.nih.gov/spice (Roederer et al., 2011)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SPICE</div><div>suggested: (SPICE, RRID:SCR_016603)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Graphpad Prism software version 8 was used for nonparametric statistics and plots, as described in the figure legends.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Graphpad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Our study had several limitations. These included the absence of characterization of cross-neutralizing antibodies in vaccinated mice against the B.1.1.529 Omicron variant, which emerged during the writing of this manuscript. However, we could expect that our vaccine would elicit T-cell responses against N epitopes because of the high homology (100%) between vaccine sequences and this VOC. Due to the limited availability of hCD40/K18-hACE2 mice, we did not evaluate various VOC challenges in mice. Finally we favored the analysis of T cell responses using samples from recovered individuals instead of in vivo preclinical models. Although these responses may be dependent on the “clinical history” of patients and their HLA haplotypes, they are less biased than those that would be observed in an animal model. Our results show that the in-vitro vaccine responses are directed against all vaccine proteins, which confirmed the broad HLA coverage of the vaccine sequences. In conclusion, it is becoming urgent to develop a “pan-sarbecovirus vaccine”. The development of a new protein-based vaccine with expected improved tolerability suitable for people with specific vulnerabilities and children would extend the portfolio of current vaccines and be instrumental in controlling the circulation of the virus and the emergence of new variants. By selecting a narrow range of immunodominant epitopes, presented by a wide variety of HLA alleles and less prone to genetic variations across sarbecoviru...

      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04842682</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Dose Escalation Trial of CD40.HIVRI.Env Vaccine Combined or …</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04262921</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">French COVID Cohort</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.28.474359: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Six to 12-weeks old Syrian hamsters (Envigo RMS, Venray, Netherlands) were randomized for age- and sex-matched groups.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">H&E stained slices were subjected to histopathologic analyses on blinded samples.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells: Vero (African green monkey kidney; ATCC# CCL-81) and Vero clone E6 (ATCC# CRL-1586) cells were purchased from ATCC (Manassas, VA, USA) and cultured in Dulbecco’s modified Eagle’s medium (DMEM, Sigma Aldrich, Steinheim, Germany) supplemented with 10% Fetal bovine serum (FBS; Sigma Aldrich) and 2 mM L-glutamine (L-Gln, Sigma Aldrich).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero clone E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Stocks were generated by infection of Vero cells at an MOI = 0.03, and viruses in P3 or P4 were used for vaccination experiments.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: CLS Cat# 605372/p622_VERO, RRID:CVCL_0059)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 isolate MUC-IMB1 (Böhmer et al., 2020) was used in passage 3 on Vero-E6 cells after isolation from the patient as described before (Hörner et al., 2020).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Subsequently, the virus-serum mixture was added to 1 x104 Vero or Vero E6 cells seeded 3 h before in 96 well plates (Thermo Fisher Scientific, Ulm, Germany).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells: Vero (African green monkey kidney; ATCC# CCL-81) and Vero clone E6 (ATCC# CRL-1586) cells were purchased from ATCC (Manassas, VA, USA) and cultured in Dulbecco’s modified Eagle’s medium (DMEM, Sigma Aldrich, Steinheim, Germany) supplemented with 10% Fetal bovine serum (FBS; Sigma Aldrich) and 2 mM L-glutamine (L-Gln, Sigma Aldrich).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FBS; Sigma Aldrich</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Reactions were run in 96-well plates (Bio-Rad Laboratories, Hercules, CA) using CFX96 qPCR cycler (Bio-Rad Laboratories) and 5 μl RNA in a total reaction volume of 25 μl in triplicates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Bio-Rad Laboratories</div><div>suggested: (Bio-Rad Laboratories, RRID:SCR_008426)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were analysed using CellRanger v5.0 (10X Genomics) using hamster and SARS-CoV-2 genome scaffolds, and the R packages Seurat v4.0</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Seurat</div><div>suggested: (SEURAT, RRID:SCR_007322)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">(Hao et al., 2021) and DoRothEA v3.12 (Holland et al., 2020) were used for cell clustering, annotation, and transcription factor activity analysis.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>DoRothEA</div><div>suggested: (Scayle, RRID:SCR_019064)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Gene set variation analysis (GSVA) was performed using the GSVA R package (Hänzelmann et al., 2013) and gene set enrichment analysis was performed using the clusterProfiler R package (Wu et al., 2021).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>clusterProfiler</div><div>suggested: (clusterProfiler, RRID:SCR_016884)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code and data.


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      As already pointed out by DiPiazza et al, drawing conclusions from animal models and extending these observations to the immunological situation in humans may be a difficult task (DiPiazza et al., 2021), considering the limitations of the system, especially in the absence of experience with vaccines targeting SARS-CoV and MERS-CoV and evidence for VAERD of all vaccine concepts including whole-inactivated viruses in humans. However, we were able to replicate VAERD induced by a protein based COVID-19 vaccine candidate with a very similar phenotype in a second animal model, Syrian hamsters, using an unmodified low-passage virus isolate. Therefore, our data strongly support the idea to monitor vaccinated human patients that experience a break-through infection closely. In any case, while our experimental vaccines mimic, but are not the same as the authorized vaccines, these and previously published data by diPiazza et al. point at considerably few concerns for vaccines developed to trigger TH1-biased responses such as viral vector platform-based vaccines and mRNA vaccines. Moreover, even if VAERD as observed in our model should occur in human patients, this immunopathology would be treatable by dexamethasone, which revealed to be an effective medication for severe courses of COVID-19, anyway (Tomazini et al., 2020; Horby et al., 2021). This would be good news also for putative VAERD being mistakenly diagnosed as a variant of the usual forms of severe COVID-19 in a naïve patient. ...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

  2. Dec 2021
    1. El púlsar binario PSR J0737 como banco de pruebas de la relatividad general Por Francisco R. Villatoro, el 16 diciembre, 2021. Categoría(s): Astronomía • Ciencia • Física • Noticias • Physics • Relatividad • Science ✎ 3

      l púlsar binario PSR J0737 como banco de pruebas de la relatividad general Por Francisco R. Villatoro, el 16 diciembre, 2021. Categoría(s): Astronomía • Ciencia • Física • Noticias • Physics • Relatividad • Science ✎ 3

      Hulse y Taylor recibieron el Premio Nobel de Física en 1993 por su estudio del púlsar binario PSR B1913+16 (el primero que se descubrió en 1974), que observó de forma indirecta la emisión de ondas gravitacionales. Se publica en Physical Review X un análisis similar del púlsar binario PSR J0737−3039A/B, descubierto en 2003. El púlsar binario PSR J0737 es un banco de pruebas único para el estudio de la relatividad general ya que está situado a solo dos mil años luz de la Tierra, ambas estrellas de neutrones se observan como púlsares y su inclinación orbital es muy próxima a 90 °, luego se puede observar cómo el espaciotiempo curvo del plano orbital modifica los pulsos emitidos. Las observaciones durante 16 años de la precesión del periastro siguen la fórmula de la emisión gravitacional cuadripolar de Einstein con un error menor del 0.013 % (el resultado obtenido tras 2.5 años de observaciones tenía un error del 0.05 % y se publicó en 2006 en Science). Sin lugar a dudas un púlsar binario que habrá que seguir durante las próximas décadas para mejorar estas estimaciones.

      Además de probar la fórmula cuadripolar de Einstein, se ha probado el retraso debido al efecto de Shapiro (en un espaciotiempo curvo las señales de radio viajan durante más tiempo y las observamos retrasadas). También se han realizado otras pruebas de la relatividad que hasta ahora no se habían podido realizar con otros púlsares binarios. Por ejemplo, se ha medido la deformación relativista de la órbita (debido al acoplamiento relativista entre el espín (rotación de las estrellas de neutrones) y el momento angular de su órbita). En estas pruebas los resultados tienen mucha mayor incertidumbre, pero en todos los casos son compatibles con las predicciones de la relatividad general de Einstein. Esta teoría, a la que muchos físicos quieren matar cuanto antes, además de muy bella es muy robusta y promete reinar en la física durante muchas décadas.

      El artículo es M. Kramer, I. H. Stairs, …, G. Theureau, «Strong-field Gravity Tests with the Double Pulsar,» Physical Review X 11: 04150 (13 Dec 2021), doi: https://doi.org/10.1103/PhysRevX.11.041050, arXiv:2112.06795[astro-ph.HE] (13 Dec 2021); más información divulgativa en Lijing Shao, «General Relativity Withstands Double Pulsar’s Scrutiny,» Physics 14: 173 (13 Dec 2021) [web].

      Una manera de destacar la excepcionalidad del púlsar binario PSR J0737 es compararlo con el famoso PSR B1913, que ha sido estudiado durante 35 años. Esta figura muestra la precesión del periastro de la órbita; la diferencia en la densidad de puntos entre 0 y −20 es notable. Así se explica que el nuevo resultado para PSR J0737 tras 16 años tenga un error menor del 0.013 %, cuando para PSR B1913 solo se alcanzó el 0.2 %; por cierto, para las fusiones de agujeros negros observadas por LIGO-Virgo el error típico ronda el 20 %. No le he dicho, pero supongo que sabrás que el periastro de una órbita elíptica es el punto donde la distancia entre ambos cuerpos es mínima; se llama perihelio cuando uno de los cuerpos es el Sol y perigeo cuando es la Tierra. El fenómeno que mide esta figura es análogo a la precesión del perihelio de la órbita de Mercurio, que Einstein usó como guía hacia la formulación correcta de su teoría de la gravitación.

      ASTROFÍSICACIENCIAEXPERIMENTOFÍSICANOTICIASPÚLSARTEORÍA DE LA RELATIVIDAD GENERAL

      3 Comentarios Mario dice: 17 diciembre, 2021 a las 5:10 pm Francis Hay una frase que no entiendo, favor revisar: «…,luego sus señales se observa cómo el espaciotiempo curvo del plano orbital modificada la señal que observamos». Atte Mario

      RESPONDER Francisco R. Villatoro dice: 17 diciembre, 2021 a las 9:15 pm Gracias, Mario.

      RESPONDER Mario dice: 19 diciembre, 2021 a las 10:07 pm Francis, entiendo que por el efecto shapiro las señales de radio se ven retrasadas; pero para notar tal retraso tiene que haber una referencia. Cuál es esa referencia?

      RESPONDER Deja un comentario

    1. SciScore for 10.1101/2021.12.24.474084: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: Facility and ethics statements: All procedures associated with SARS-CoV-2 live virus were approved by the Animal experiment Committee Laboratory Animal Center, Beijing Institute of Microbiology and Epidemiology with an approval number of IACUC-IME-2021-022 and performed in Biosafety Level 3 (BSL-3) laboratories in strict accordance with the recommendations in the Guide for Care and Use of Laboratory Animals.<br>Consent: All volunteers were provided informed written consent form and the whole study was conducted in accordance with the requirements of Good Clinical Practice of China.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Briefly, group of 8-month-old female BALB/c mice were infected with 1×104 PFU of SARS-CoV-2 Beta variant strain, then infected mice were treated intraperitoneally with a single dose of different antibodies or antibody cocktails at 1 hour after infection.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Finally, a MD production runs of 100 ns were performed starting from random initial velocities and applying periodic boundary conditions.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The heat-treated samples or monoclonal antibodies (mAbs) were subject to seral dilution from 1: 4 or 50 ng/μL with DMEM in two-fold steps and mixed with a virus suspension containing 100 TCID50 at 36.5°C for 2h, after which, the mixtures were added to wells seeded with confluence Vero cells and incubated at 36.5°C for another 5 days in a humidified 5% CO2 cell incubator.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The transfected 293T cells were infected with VSV G pseudotyped virus (G*ΔG-VSV) at a multiplicity of infection (MOI) of 4.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: KCB Cat# KCB 200744YJ, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After that, the mixtures were added to Huh-7 cells and placed back for incubation for another 24 hours.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Huh-7</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For protein expression, the plasmids of these proteins were transiently transfected into HEK293 F cells grown in suspension at 37 °C in an incubator supplied with 8% CO2, rotating at 130 rpm.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then the clones were transiently transfected into mammalian HEK293F cells and incubated for 5 days in a 5% CO2 rotating incubator at 37°C for antibody expression, which were further purified using protein A.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293F</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viral stock and cell lines: SARS-CoV-2 wild-type strain CN01 was originally isolated from a patient during the early phase of COVID-19 endemic in China.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, group of 8-month-old female BALB/c mice were infected with 1×104 PFU of SARS-CoV-2 Beta variant strain, then infected mice were treated intraperitoneally with a single dose of different antibodies or antibody cocktails at 1 hour after infection.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/c</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The area under the curve (AUC) of each mAb were determined using Prism V8.0 (GraphPad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Automated single particle data acquisition was carried out by SerialEM, with a calibrated magnification of 22,500 yielding a final pixel size of 1.07 Å.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SerialEM</div><div>suggested: (SerialEM, RRID:SCR_017293)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The defocus value of each image was calculated by Gctf.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gctf</div><div>suggested: (GCTF, RRID:SCR_016500)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then, 1,302,103, 756,508, 2,332,045 and 2,320,416 particles of the S-XGv265-complex, S-XGv282-complex, S-XGv289-complex and S-XGv347-complex, respectively were picked and extracted for reference-free 2D alignment by cryoSPARC 32, based of which, 422,083, 190,154, 837,832 and 614,852 particles were selected and applied for 3D classification by Relion3.0 for S-XGv265-complex, S-XGv282-complex, S-XGv289-complex and S-XGv347-complex, respectively with no symmetry imposed to produce the potential conformations for the complexes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>cryoSPARC</div><div>suggested: (cryoSPARC, RRID:SCR_016501)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Model fitting and refinement: The atomic models of the complexes were generated by first fitting the chains of the native apo SARS-CoV-2 S trimer (PDB number of 6VYB) and Fabs (PDB number of 7LSS and 7CZW for XGv265, 5MES and 5VAG for XGv282, 6UDA and 7MEG for XGv289 as well as 7E3K for XGv347) into the cyo-EM densities of the final S-Fab-complexes described above by Chimera, followed by manually adjustment and correction according to the protein sequences and densities in Coot, as well as real space refinement using Phenix.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Coot</div><div>suggested: (Coot, RRID:SCR_014222)</div></div><div style="margin-bottom:8px"><div>Phenix</div><div>suggested: (Phenix, RRID:SCR_014224)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Average structure of the four complexes were generated using the last 10 ns frames and ΔG between the antibodies and RBD was estimated in ROSETTA by InterfaceAnalyzer.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ROSETTA</div><div>suggested: (Rosetta, RRID:SCR_015701)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.24.474081: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: All experimental work was conducted under the authority of a UK Home Office approved project licence that had been subject to local ethical review at UKHSA Porton Down by the Animal Welfare and Ethical Review Body (AWERB) as required by the Home Office Animals (Scientific Procedures) Act 1986.<br>Euthanasia Agents: Prior to challenge animals were sedated by isoflurane.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Experimental Design: Before the start of the experiment, animals were randomly assigned to challenge groups to minimise bias.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody dilutions were discarded, cells washed with PBS and incubated with 50μl/well goat anti-rabbit IgG HRP (Invitrogen, G-21234</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit IgG</div><div>suggested: (Thermo Fisher Scientific Cat# G-21234, RRID:AB_2536530)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were incubated for 1 h with primary/detection SARS-CoV-2 anti-RBD rabbit polyclonal antibody (Sinobiologicals) and then 1 h with secondary anti-rabbit HRP-conjugate antibody (Invitrogen).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-RBD</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Spike protein was included at saturation levels and coupling confirmed by the binding of IgG from a COVID-19 convalescent donor known to have high levels of anti-spike protein IgG. Heat-inactivated NIBSC Anti-SARS-CoV-2 Antibody Diagnostic Calibrant (</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-spike protein IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Anti-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Beads were next washed twice with 200 μl wash buffer and resuspended in 100 μl FITC-conjugated rabbit anti-human C3c polyclonal antibody (Abcam) diluted 1:500 in BB and incubated in the dark at 25°C for 20 min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human C3c</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viruses and Cells: SARS-CoV-2 Australia/VIC01/202035 was generously provided by The Doherty Institute, Melbourne, Australia at P1 after primary growth in Vero/hSLAM cells and subsequently passaged twice at UKHSA Porton in Vero/hSLAM cells [ECACC 04091501].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero/hSLAM</div><div>suggested: ECACC Cat# 04091501, RRID:CVCL_L037)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Virus titre of the P1 stock was determined by focus forming assay on Vero/E6 cells [ECACC 85020206].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero/E6</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Serum/virus mixtures were then incubated on a VeroE6 cell monolayer (ECACC) for 1 h at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In addition, Vero/hSLAM cultures were supplemented with 0.4 mg/ml of geneticin (Invitrogen) to maintain stable integration of pCAG-hSLAM and expression of the human signalling lymphocytic activation molecule (hSLAM).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAG-hSLAM</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Whole genome sequencing was performed, on the P1 stock, using SISPA amplification on both Nanopore and Illumina technologies as described previously48.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Nanopore</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Foci were visualised using TrueBlue™ Peroxidase Substrate (Sera Care) and counted using an ImmunoSpot S6 Ultra-V analyser and BioSpot software (CTL).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BioSpot</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Titres were determined by curve fitting data to a 4PL curve in GraphPad Prism 9 and accepting only data which produced an R2 value of >0.95.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.23.21268005: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">The upper reference limit (URL) of hs-TNI defined as the 99th percentile of hs-TNI distribution in a reference population was 15.5 ng/l for females, and 34 ng/l for males respectively.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Manual validation of a random sample of 10% of the dataset was completed.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Laboratory methods: Serum hs-TnI levels were assessed by a high-sensitivity cardiac troponin I microparticle chemiluminescent immunoassay (ARCHITECT STAT, hs-TNI, Abbott) on the fully automated Abbott ARCHITECT analyser (Abbott ARCHITECT STAT high sensitive troponin-I.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Abbott</div><div>suggested: (Abbott, RRID:SCR_010477)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      There are some limitations to our findings. First, our sample was a small retrospective analysis of patients with COVID-19 requiring hospitalization. Second, within this cohort of patients, a significant proportion (approximately 20%)did not have blood troponin levelsmeasured and were excluded from the analysis. Furthermore, there were differences in timing of sampling of blood troponin between patients during their hospital stay.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.22.473478: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">CELLS AND VACCINE: All experiments used a previously described research cell bank of T-REx-293 human embryonic kidney (HEK) cells stably expressing the tetracycline repressor protein (ThermoFisher) (4).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK</div><div>suggested: CLS Cat# 300192/p777_HEK293, RRID:CVCL_0045)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Initial T-REx-293 cell density was 0.5 to 2 × 106 viable cells/mL in a working volume of or 3 L.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>T-REx-293</div><div>suggested: RRID:CVCL_D585)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Residual host-cell DNA was quantified using the previously reported qPCR method, with a lower limit of quantification of 100 pg/mL for intact HEK293 cell DNA (4).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293</div><div>suggested: CLS Cat# 300192/p777_HEK293, RRID:CVCL_0045)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. 6.Laboratory of Virology, Division of Intramural Research, National Institute of Allergy 23and Infectious Diseases, National Institute of Health, Hamilton, MT, USA 247.Laboratory of Persistence Viral Diseases, Rocky Mountain Laboratories, National 25Institute of Allergy and Infectious Diseases, National Institute of Health, Hamilton, MT, 26USA 278.Vaccine Research Center, National Institute of Allergy and Infectious Diseases, National 28Institutes of Health, Bethesda, MD, USA 299.National Institute of Dental and Craniofacial Research, National Institutes of Health, 30Bethesda, MD, USA 3110.University of Maryland School of Medicine, Baltimore, MD, USA 3211.Postdoctoral Research Associate Training Program, National Institute of General Medical 33Sciences, National Institutes of Health, Bethesda, MD, USA 3412.R Adams Cowley Shock Trauma Center, Department of Medicine and Program in 35Trauma, University of Maryland School of Medicine, Baltimore, MD, USA 3613.R Adams Cowley Shock Trauma Center, Department of Surgery and Program in Trauma, 37University of Maryland School of Medicine, Baltimore, MD, USA 3814.Department of Medicine, Division of Infectious Disease, University of Maryland School 39of Medicine, Baltimore, MD, USA 4015.Institute of Human Virology, University of Maryland School of Medicine, Baltimore, 41MD, USA 4216.Department of Surgery, Division of Cardiac Surgery, University of Maryland School of 43Medicine, Baltimore, MD, USA 4417.Department of Medicine, Division of Pulmonary and Critical Care Medicine, University 45of Maryland School of Medicine, Baltimore, MD, USA 4618.Hospitalist Department, TidalHealth Peninsula Regional, Salisbury, MD, USA 4719.Division of Critical Care Medicine, Department of Medicine, University of Maryland St. 48Joseph Medical Center, Towson, MD, USA 4920.Medical Virology Section, Laboratory of Infectious Diseases, National Institute of 50Allergy and Infectious Diseases, National Institutes of Health, Bethesda MD 51^See Acknowledgements 52*Corresponding author. Email: chertowd@cc.nih.gov 535455565758596061626364656667COVID-19 is known to cause multi-organ dysfunction1-3 in acute infection, with 68prolonged symptoms experienced by some patients, termed Post-Acute Sequelae of SARS-69CoV-2 (PASC)4-5. However, the burden of infection outside the respiratory tract and time 70to viral clearance is not well characterized, particularly in the brain3,6-14. We performed 71complete autopsies on 44 patients with COVID-19 to map and quantify SARS-CoV-2 72distribution, replication, and cell-type specificity across the human body, including brain, 73from acute infection through over seven months following symptom onset. We show that 74SARS-CoV-2 is widely distributed, even among patients who died with asymptomatic to 75mild COVID-19, and that virus replication is present in multiple pulmonary and 76extrapulmonary tissues early in infection. Further, we detected persistent SARS-CoV-2 77RNA in multiple anatomic sites, including regions throughout the brain, for up to 230 days 78following symptom onset. Despite extensive distribution of SARS-CoV-2 in the body, we 79observed a paucity of inflammation or direct viral cytopathology outside of the lungs. Our 80data prove that SARS-CoV-2 causes systemic infection and can persist in the body for 81months. 82Main text:83 Infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the 84causative agent of coronavirus disease 2019 (COVID-19), has well described pulmonary and 85extrapulmonary manifestations1-3, including multiorgan failure and shock among severe and fatal 86cases. Some survivors experience Post-Acute Sequelae of SARS-CoV-2 (PASC) – also known as 87Long COVID—with cardiovascular, pulmonary, and neurological manifestations with or without 88functional impairment4-5. While autopsy studies of fatal COVID-19 cases support the ability of 89SARS-CoV-2 to infect multiple organs3,7-12, extra-pulmonary organs often lack histopathological 90evidence of direct virally-mediated injury or inflammation10-14. The paradox of extra-pulmonary 91infection without injury or inflammation raises many pathogen- and host-related questions. 92These questions include, but are not limited to: What is the burden of infection within versus 93outside of the respiratory tract? What cell types are infected across extra-pulmonary tissues, and 94do they support SARS-CoV-2 infection and replication? In the absence of cellular injury and 95inflammation in extra-pulmonary tissues, does SARS-CoV-2 persist, and if so, over what 96interval? Does SARS-CoV-2 evolve as it spreads to and persists in different anatomical 97compartments? 98To inform these pathogen-focused questions and to evaluate for the presence or absence 99of associated histopathology in matched tissue specimens, we performed extensive autopsies on 100a diverse population of 44 individuals who died from or with COVID-19 up to 230 days 101following initial symptom onset. Our approach focused on timely, systematic, and 102comprehensive tissue sampling and preservation of adjacent tissue samples for complementary 103analyses. We performed droplet digital polymerase chain reaction (ddPCR) for sensitive 104detection and quantification of SARS-CoV-2 gene targets in all tissue samples collected. To 105elucidate SARS-CoV-2 cell-type specificity and validate ddPCR findings, we performed in situ106hybridization (ISH) broadly across sampled tissues. Immunohistochemistry (IHC) was used to 107further validate cell-type specificity in the brain where controversy remains on the regional 108distribution and cellular tropism of SARS-CoV-2 infection. In all samples where SARS-CoV-2 109RNA was detected by ddPCR, we performed qRT-PCR to detect subgenomic (sg)RNA, an assay 110suggestive of recent virus replication15. We confirmed the presence of replication-competent 111SARS-CoV-2 in extrapulmonary tissues by virus isolation in cell culture. Lastly, in six 112individuals, we measured the diversity and anatomic distribution of intra-individual SARS-CoV-1132 variants using high-throughput, single-genome amplification and sequencing (HT-SGS). 114We categorized autopsy cases of SARS-CoV-2 infection as “early” (n=17), “mid” 115(n=13), or “late” (n=14) by illness day (D) at the time of death, being ≤D14, D15-D30, or ≥D31, 116respectively. We defined persistence as presence of SARS-CoV-2 RNA among late cases. Due to 117the extensive tissue collection, we analyzed and described the results in terms of grouped tissue 118categories as the following: respiratory tract; cardiovascular; lymphoid; gastrointestinal; renal 119and endocrine; reproductive; muscle, skin, adipose, & peripheral nerves; and brain. 120121Autopsy cohort overview 122Between April 26, 2020 and March 2, 2021, we performed autopsies on 44 PCR-123confirmed cases (Extended Data Fig. 1). SARS-CoV-2 seroconversion was detected in 38 of 124these cases (Supplementary Data 1); three early cases (P27, P36, P37) had not seroconverted and 125perimortem plasma was unavailable for the other three cases (P3, P4, P15). Extensive sampling 126of the brain was accomplished in 11 of the 44 cases (Fig. 1). The cohort was 29.5% female with 127a mean age of 59.2 years and was diverse across race and ethnicity (Extended Data Table 1). 12895.5% of patients had at least one comorbidity, with hypertension (54.5%), obesity (52.3%), and 129chronic respiratory disease (34.1%) being most common. Patients presented to the hospital a 130mean of 9.4 days following symptom onset and were hospitalized a mean of 26.4 days. Overall, 131the mean interval from symptom onset to death was 35.2 days and the mean postmortem interval 132was 26.2 hours. 81.8% of patients required intubation with invasive mechanical ventilation, 13322.7% received extracorporeal membrane oxygenation (ECMO) support, and 40.9% required 134renal replacement therapy. Vasopressors, systemic steroids, systemic anticoagulation, and 135antibiotics were commonly administered (Extended Data Table 1). Individual patient-level 136demographic and clinical information can be found in Extended Data Table 2. 137138Widespread infection and persistence 139SARS-CoV-2 RNA was detected in all 44 cases and across 79 of 85 anatomical locations 140and body fluids sampled (Extended Data Fig. 2, Supplementary Data 1). The highest burden of 141SARS-CoV-2 RNA (i.e., >100,000 N gene copies/ng RNA input) was detected in the respiratory 142tract of early cases (Figure 1), but we detected at least 100 N gene copies/ng RNA input from 143every tissue group besides reproductive tissues from multiple individuals among early cases. The 144mean SARS-CoV-2 N gene copies/ng RNA detected from tissues in each grouping among early 145cases are as follows: 9,210.10 across respiratory tissues; 38.75 across cardiovascular tissues; 14630.01 across lymphoid tissues; 24.68 across gastrointestinal tissues; 12.76 across renal and 147endocrine tissues; 0.36 across reproductive tissues; 27.50 across muscle, peripheral nerve, 148adipose, and skin tissues; 57.40 across ocular tissues; and 32.93 across brain tissues (Extended 149Data Table 3). 150With a few exceptions, the overall burden of SARS-CoV-2 RNA decreased by a log or 151more across tissue categories among mid cases, and further decreased among late cases. 152However, several mid and late cases had high levels (≥5 N gene copies/ng RNA input) detected 153among multiple tissues (Extended Data Fig. 2). Further, persistence of low-level SARS-CoV-2 154RNA (0.0004 to <0.5 N gene copies/ng RNA input) was frequently detected across multiple 155tissue categories among all late cases, despite being undetectable in plasma (Extended Data Fig. 1562, Supplementary Data 1). Notably, SARS-CoV-2 RNA was detected in the brains of all six late 157cases and across most locations evaluated in the brain in five of these six, including P42 who 158died at D230 (Fig. 1). 159Overall, SARS-CoV-2 RNA was detected in respiratory tissue of 43/44 cases (97.7%); 160cardiovascular tissue of 35/44 cases (79.5%); lymphoid tissue of 38/44 cases (86.4%); 161gastrointestinal tissue of 32/44 (72.7%); renal and endocrine tissue of 28/44 cases (63.6%); 162reproductive tissue in 17/40 cases (42.5%); muscle, skin, adipose, and peripheral nervous tissue 163in 30/44 cases (68.2%); ocular tissue and humors of 22/28 cases (57.9%); and brain tissue in 16410/11 cases (90.9%) (Extended Data Table 3). 165We additionally detected SARS-CoV-2 sgRNA across all tissue categories, 166predominately among early cases (14/17, 82.4%), as well as in plasma, pleural fluid, and vitreous 167humor (Fig. 1, Extended Data Fig. 2, Supplementary Data 1). sgRNA was also detected in at 168least one tissue of 61.5% of mid cases and 42.9% of late cases, including across three tissue 169categories in a case at D99 (P20). 170We isolated SARS-CoV-2 in cell culture from multiple pulmonary and extrapulmonary 171tissues, including lung, bronchus, sinus turbinate, heart, mediastinal lymph node, small intestine, 172and adrenal gland from early cases up to D7 (P19, P27, P32, P37; Supplementary Data 1). 173174Intra-individual viral variant diversity 175We used HT-SGS to analyze SARS-CoV-2 spike gene variant sequences from a total of 17646 tissues in six individuals. In five individuals from the early group, predominant spike 177sequences were largely identical across tissues. In P27, P19, and P18, no non-synonymous virus 178genetic diversity was detected in pulmonary and extrapulmonary sites despite a high depth of 179single-molecule sampling (Extended Data Fig. 3). Thus, virus populations that were relatively 180homogeneous had disseminated in these individuals without coding changes in spike. However, 181we also noted important patterns of intra-individual virus diversity in several patients from the 182early group. In P27, although all 4,525 inferred spike amino acid sequences were identical, two 183virus haplotypes, each with a single synonymous substitution, were preferentially detected in 184extrapulmonary sites including right and left ventricles and mediastinal LN. In P38, we observed 185clear virus genetic differences between the lung lobes and the brain, with a D80F residue found 186in 31/31 pulmonary but 0/490 brain sequences and a G1219V residue that was restricted to brain 187minor variants. A similar distinction was observed between sequences from dura mater and other 188sites in P36, albeit at very low sampling depth (n = 2 sequences) from dura mater. Overall, these 189findings suggested no need for alterations in receptor utilization to permit extrapulmonary 190dissemination of SARS-CoV-2, while also revealing genetic compartmentalization between 191viruses in the lung lobes and those in extrapulmonary sites, including the brain. 192193ISH reveals SARS-CoV-2 cellular tropism 194We validated our ddPCR results across all tissue categories via ISH for SARS-CoV-2 195spike RNA across selected early, mid, and late cases (Supplementary Data 3). Overall, we 196detected SARS-CoV-2 RNA via ISH in 36 distinct cell types across all sampled organs 197(Extended Data Table 4, Supplementary Data 3). Spike RNA was detected throughout the 198respiratory tract in early cases, as well as within the sinus turbinate, trachea, lungs, from late 199cases (i.e., P33, P20, P42). 200The heart contained spike RNA within myocytes, endothelium, and smooth muscle of 201vessels of both early (P18, P19) and late (P3 & P42) cases. The pericardium demonstrated a 202positive signal for spike RNA within fibroblasts of the stroma. Intimal cells of the aorta were 203additionally found to contain spike RNA. Mononuclear leukocytes within the lymph node, 204spleen, and appendix of an early case (P19) contained spike RNA, as did colonic epithelium (Fig 2052). 206Epithelial cells along the intestinal tract in early cases (P16, P18, P19) contained viral 207RNA, as well as stratified squamous epithelium of the esophagus. Mononuclear leukocytes were 208again visualized with SARS-CoV-2 RNA in lymphoid aggregates and the interstitium of the 209small and large intestine, with infected cells still present in the colon of late cases (P33, P42). 210Kupffer cells, hepatocytes, and bile duct epithelium within the liver were additionally found to 211contain spike RNA. 212Within the kidney, spike RNA could be visualized within parietal epithelium of 213Bowman’s capsule, collecting duct cells, distal tubule cells, and glomerular endothelium. The 214adrenal glands contained spike RNA within endocrine cells. Endocrine follicular cells of the 215thyroid and glandular cells of the pancreas were also positive for spike RNA (Fig. 2). Among 216reproductive organs, spike RNA was visualized within Leydig and Sertoli cells of the testis, 217germ cells within the testicular tubules, endometrial gland epithelium, endometrial stromal cells, 218uterine smooth muscle cells, and stromal cells of the post-menopause ovary (Fig. 2). 219Myocytes within skeletal muscle contained spike RNA in both early (P18) and late (P20) 220cases. In addition to the organ-specific cell type infection of SARS-CoV-2, endothelium, 221muscularis of atrial vessels, and Schwann cells were identified as infected throughout the body, 222and were similarly positive across early and late cases. 223Spike RNA was found in neurons, glia and ependyma, as well as endothelium of vessels 224across all lobes of the brain of early, mid, and late cases. Within the cerebellum specifically, 225neurons, Purkinje cells, and endothelium of vasculature also contained spike protein via IHC 226(Fig. 3). 227228COVID-19 histological findings 229The histopathology findings from our cohort were similar to those reported in other case 230series (Extended Data Fig. 4). All but five cases were considered to have died from COVID-19 231(Extended Data Table 5), and, of these, 37 (94.5%) had either acute pneumonia or diffuse 232alveolar damage at the time of death (Supplementary Data 2). Phases of diffuse alveolar damage 233showed clear temporal associations, with the exudative phase seen mainly within the first three 234weeks of infection and the fibrosing phase not seen until after a month of infection (Extended 235Data Fig. 5). Pulmonary thromboembolic complications, which were also likely related to 236SARS-CoV-2 infection, with or without infarction, were noted in 10 (23%) cases. Another 237finding likely related to SARS-CoV-2 infection included myocardial infiltrates in four cases, 238including one case of significant myocarditis16 (P3). Some of the cases of microscopic ischemia 239appeared to be associated with fibrin-platelet microthrombi, and may therefore be related to 240COVID-19 thrombotic complications. Within the lymph nodes and spleen, we observed 241lymphodepletion and both follicular and paracortical hyperplasia. 242Outside the lungs, histological changes were mainly related to complications of therapy 243or preexisting co-morbidities: mainly obesity, diabetes, and hypertension. Five cases had old 244ischemic myocardial scars and three had coronary artery bypass grafts in place. Given the 245prevalence of diabetes and obesity in our cohort, it was not surprising to find diabetic 246nephropathy (10 cases, 23%) or steatohepatitis (5 cases, 12%). One case was known to have 247chronic hepatitis C with cirrhosis, but the other cases of advanced hepatic fibrosis were likely 248related to fatty liver disease, even if diagnostic features of steatohepatitis were not present. 249Hepatic necrosis (13 cases, 30%) and changes consistent with acute kidney injury (17 cases, 25039%) were likely related to hypoxic-ischemic injury in these very ill patients. 251In the examination of the 11 brains, we found few histopathologic changes, despite the 252evidence of substantial viral burden.Vascular congestion was an unusual finding that had an 253unclear etiology and could be related to the hemodynamic changes incurred with infection. 254Global hypoxic/ischemic change was seen in two cases, one of which was a juvenile (P36) with a 255seizure disorder who was found to be SARS-CoV-2 positive on hospital admission, but who 256likely died of seizure complications unrelated to viral infection. 257258Discussion 259Here we provide the most comprehensive analysis to date of SARS-CoV-2 cellular 260tropism, quantification, and persistence across the body and brain, in a diverse autopsy cohort 261collected throughout the first year of the pandemic in the United States. Our focus on short post-262mortem intervals, comprehensive approach to tissue collection, and preservation techniques –263RNAlater and flash freezing of fresh tissue – allowed us to detect and quantify viral levels with 264high sensitivity by ddPCR and ISH, as well as culture virus, which are notable differences 265compared to other studies. 266We show SARS-CoV-2 disseminates across the human body and brain early in infection 267at high levels, and provide evidence of virus replication at multiple extrapulmonary sites during 268the first week following symptom onset. We detected sgRNA in at least one tissue in over half of 269cases (14/27) beyond D14, suggesting that prolonged viral replication may occur in extra-270pulmonary tissues as late as D99. While others have questioned if extrapulmonary viral presence 271is due to either residual blood within the tissue8,17 or cross-contamination from the lungs during 272tissue procurement8, our data rule out both theories. Only 12 cases had detectable SARS-CoV-2 273RNA in a perimortem plasma sample, and of these only two early cases also had SARS-CoV-2 274sgRNA in the plasma, which occurred at Ct levels higher than nearly all of their tissues with 275sgRNA. Therefore, residual blood contamination cannot account forRNA levels within tissues. 276Furthermore, blood contamination would not account for the SARS-CoV-2 sgRNA or virus 277isolated from tissues. Contamination of additional tissues during procurement, is likewise ruled 278out by ISH demonstrating widespread SARS-CoV-2 cellular tropism across the sampled organs, 279by IHC detecting viral protein in the brain, and by several cases of virus genetic 280compartmentalization in which spike variant sequences that were abundant in extrapulmonary 281tissues were rare or undetected in lung samples. 282Using both ddPCR and sgRNA analysis to inform our selection of tissue for virus 283isolation and ISH staining allow us to describe a number of novel findings. Others6,8-12,17 have 284previously reported SARS-CoV-2 RNA within the heart, lymph node, small intestine, and 285adrenal gland. We demonstrate conclusively that SARS-CoV-2 is capable of infecting and 286replicating within these tissues. Current literature has also reported absent or controversial 287expression of ACE2 and/or TMPRSS2 in several extrapulmonary tissues, such as the colon, 288lymphoid tissues, and ocular tissues, calling into question if these tissues can become infected by 289SARS-CoV-21-3. However, we observed high levels of SARS-CoV-2 RNA and evidence of 290replication within these organs, as well as SARS-CoV-2 RNA via ISH in colonic mucosal 291epithelium and mononuclear leukocytes within the spleen, thoracic cavity lymph nodes, and GI 292lymphoid aggregates. We believe these ISH positive cells represent either infection or 293phagocytized virus in resident macrophages. Further, we isolated virus from a mediastinal lymph 294node and ocular tissue from two early cases (P19, P32). 295Our use of a single-copy sequencing approach for the SARS-CoV-2 spike allowed us to 296demonstrate homogeneous virus populations in many tissues, while also revealing informative 297virus variants in others. Low intra-individual diversity of SARS-CoV-2 sequences has been 298observed frequently in previous studies18-20, and likely relates to the intrinsic mutation rate of the 299virus as well as lack of early immune pressure to drive virus evolution in new infections. It is 300important to note that our HT-SGS approach has both a high accuracy and a high sensitivity for 301minor variants within each sample, making findings of low virus diversity highly reliable21. The 302virus genetic compartmentalization that we observed between pulmonary and extrapulmonary 303sites in several individuals supports independent replication of the virus at these sites, rather than 304spillover from one site to another. Importantly, lack of compartmentalization between these sites 305in other individuals does not rule out independent virus replication, as independently replicating 306populations may share identical sequences if overall diversity is very low. It was also interesting 307to note several cases where brain-derived virus spike sequences showed non-synonymous 308differences relative to sequences from other tissues. These differences may indicate differential 309selective pressure on spike by antiviral antibodies in brain versus other sites, though further 310studies will be needed to confirm this speculation. 311Our results collectively show while that the highest burden of SARS-CoV-2 is in the 312airways and lung, the virus can disseminate early during infection and infect cells throughout the 313entire body, including widely throughout the brain. While others have posited this viral 314dissemination occurs through cell trafficking11 due to a reported failure to culture virus from 315blood3,22, our data support an early viremic phase, which seeds the virus throughout the body 316following pulmonary infection. Recent work by Jacobs et al.22 in which SARS-CoV-2 virions 317were pelleted and imaged from COVID-19 patient plasma, supports this mechanism of viral 318dissemination. Although our cohort is primarily made up of severe cases of COVID-19, two 319early cases had mild respiratory symptoms (P28; fatal pulmonary embolism occurred at home) or 320no symptoms (P36; diagnosed upon hospitalization for ultimately fatal complications of a 321comorbidity), yet still had SARS-CoV-2 RNA widely detected across the body, including brain, 322with detection of sgRNA in multiple compartments. Our findings, therefore, suggest viremia 323leading to body-wide dissemination, including across the blood-brain barrier, and viral 324replication can occur early in COVID-19, even in asymptomatic or mild cases. Further, P36 was 325a juvenile with no evidence of multisystem inflammatory syndrome in children, suggesting 326infected children without severe COVID-19 can also experience systemic infection with SARS-327CoV-2. 328Finally, a major contribution of our work is a greater understanding of the duration and 329locations at which SARS-CoV-2 can persist. While the respiratory tract was the most common 330location in which SARS-CoV-2 RNA tends to linger, ≥50% of late cases also had persistence in 331the myocardium, thoracic cavity lymph nodes, tongue, peripheral nerves, ocular tissue, and in all 332sampled areas of the brain, except the dura mater. Interestingly, despite having much lower 333levels of SARS-CoV-2 in early cases compared to respiratory tissues, we found similar levels 334between pulmonary and the extrapulmonary tissue categories in late cases. This less efficient 335viral clearance in extrapulmonary tissues is perhaps related to a less robust innate and adaptive 336immune response outside the respiratory tract. 337We detected sgRNA in tissue of over 60% of the cohort. While less definitive than viral 338culture23,24, multiple studies have shown that sgRNA levels correlate with acute infection and can 339be detected in respiratory samples of immunocompromised patients experiencing prolonged 340infection24. These data coupled with ISH suggest that SARS-CoV-2 can replicate within tissue 341for over 3 months after infection in some individuals, with RNA failing to clear from multiple 342compartments for up to D230. This persistence of viral RNA and sgRNA may represent infection 343with defective virus, which has been described in persistent infection with measles virus –344another single-strand enveloped RNA virus—in cases of subacute sclerosing panencephalitis25. 345The mechanisms contributing to PASC are still being investigated; however, ongoing 346systemic and local inflammatory responses have been proposed to play a role5. Our data provide 347evidence for delayed viral clearance, but do not support significant inflammation outside of the 348respiratory tract even among patients who died months after symptom onset. Understanding the 349mechanisms by which SARS-CoV-2 persists and the cellular and subcellular host responses to 350viral persistence promises to improve the understanding and clinical management of PASC. 351352353354355356357358359360361362Main References: 3631.Bourgonje, A. R. et al. Angiotensin-converting enzyme 2 (ACE2), SARS-CoV-2 and the 364pathophysiology of coronavirus disease 2019 (COVID-19). J Pathol. 251(3), 228-248 365(2020).https://doi.org/10.1002/path.5471. 3662.Salamanna, F., Maglio, M., Landini. M. P., & Fini, M. Body Localization of ACE-2: On 367the Trail of the Keyhole of SARS-CoV-2. Front Med (Lausanne). 7, 594495 (2021). 368https://doi.org/10.3389/fmed.2020.594495. 3693.Sridhar, S., & Nicholls, J. Pathophysiology of infection with SARS-CoV-2-What is 370known and what remains a mystery. Respirology. 26(7), 652-665 (2021). 371https://doi.org/10.1111/resp.14091. 3724.Al-Aly, Z., Xie, Y., & Bowe, B. High-dimensional characterization of post-acute 373sequelae of COVID-19. Nature. 594(7862), 259-264 (2021). 374https://doi.org/10.1038/s41586-021-03553-9. 3755.Crook, H., Raza, S., Nowell, J., Young, M., & Edison, P. Long covid-mechanisms, risk 376factors, and management. BMJ. 374, n1648 (2021). https://doi.org/10.1136/bmj.n1648. 3776.Puelles, V. G., et al. Multiorgan and Renal Tropism of SARS-CoV-2. N Engl J Med. 378383(6), 590-592 (2020). https://doi.org/10.1056/NEJMc2011400. 3797.Martines, R. B., et al. Pathology and Pathogenesis of SARS-CoV-2 Associated with Fatal 380Coronavirus Disease, United States. Emerg Infect Dis. 26(9), 2005-2015 (2020). 381https://doi.org/10.3201/eid2609.202095. 3828.Bhatnagar, J., et al. Evidence of Severe Acute Respiratory Syndrome Coronavirus 2 383Replication and Tropism in the Lungs, Airways, and Vascular Endothelium of Patients 384With Fatal Coronavirus Disease 2019: An Autopsy Case Series. J Infect Dis. 223(5), 752-385764 (2021). https://doi.org/10.1093/infdis/jiab039. 3869.Dorward, D. A., et al. Tissue-Specific Immunopathology in Fatal COVID-19. Am J 387Respir Crit Care Med. 203(2),192-201 (2021). https://doi.org/10.1164/rccm.202008-3883265OC. 38910.Schurink, B., et al. Viral presence and immunopathology in patients with lethal COVID-39019: a prospective autopsy cohort study. Lancet Microbe. 1(7), e290-e299 (2020). 391https://doi.org/10.1016/S2666-5247(20)30144-0. 39211.Yao, X.H., et al. A cohort autopsy study defines COVID-19 systemic pathogenesis. Cell 393Res. 31(8), 836-846 (2021). https://doi.org/10.1038/s41422-021-00523-8. 39412.Remmelink, M., et al. Unspecific post-mortem findings despite multiorgan viral spread in 395COVID-19 patients. Crit Care. 24(10), 495 (2020). https://doi.org/10.1186/s13054-020-39603218-5. 39713.Mukerji, S. S., & Solomon, I. H. What can we learn from brain autopsies in COVID-19? 398Neurosci Lett. 742, 135528 (2021). https://doi.org/10.1016/j.neulet.2020.135528. 39914.Matschke, J., et al. Neuropathology of patients with COVID-19 in Germany: a post-400mortem case series. Lancet Neurol. 19(11), 919-929 (2020). 401https://doi.org/10.1016/S1474-4422(20)30308-2. 40215.Speranza, E., et al. Single-cell RNA sequencing reveals SARS-CoV-2 infection dynamics 403in lungs of African green monkeys. Sci Transl Med. 13(578), eabe8146 (2021).404https://doi.org/10.1126/scitranslmed.abe8146 40516.Vannella, K. M., et al. Evidence of SARS-CoV-2-specific T-cell-mediated myocarditis in 406a MIS-A case. Front Imunol. Accepted (manuscript ID: 779026). 40717.Desai, N., et al. Temporal and spatial heterogeneity of host response to SARS-CoV-2 408pulmonary infection. Nat Commun. 11(1), 6319 (2020).https://doi.org/10.1038/s41467-409020-20139-7. 41018.Tonkin-Hill, G., et al. Patterns of within-host genetic diversity in SARS-CoV-2. Elife. 10, 411e66857 (2021). https://doi.org/10.7554/eLife.66857. 41219.Lythgoe, K. A., et al. SARS-CoV-2 within-host diversity and transmission. Science. 413372(6539), eabg0821 (2021). https://doi.org/10.1126/science.abg0821. 41420.Valesano, A. L., et al. Temporal dynamics of SARS-CoV-2 mutation accumulation 415within and across infected hosts. PLoS Pathog. 17(4), e1009499 (2021). 416https://doi.org/10.1371/journal.ppat.1009499. 41721.Ko, S. H., et al. High-throughput, single-copy sequencing reveals SARS-CoV-2 spike 418variants coincident with mounting humoral immunity during acute COVID-19. PLoS 419Pathog. 17(4), e1009431 (2021). https://doi.org/10.1371/journal.ppat.1009431. 42022.Jacobs, J. L., et al. SARS-CoV-2 Viremia is Associated with COVID-19 Severity and 421Predicts Clinical Outcomes. Clin Infect Dis. 10, ciab686 (2021). 422https://doi.org/10.1093/cid/ciab686. 42323.Alexandersen, S., Chamings, A., & Bhatta, T. R. SARS-CoV-2 genomic and subgenomic 424RNAs in diagnostic samples are not an indicator of active replication. Nat Commun. 42511(1), 6059 (2020). https://doi.org/10.1038/s41467-020-19883-7. 42624.Binnicker, M. J. Can Testing Predict SARS-CoV-2 Infectivity? The Potential for Certain 427Methods To Be Surrogates for Replication-Competent Virus. J Clin Microbiol. 59(11), 428e0046921 (2021). https://doi.org/10.1128/JCM.00469-21. 42925.Sidhu, M. S., et al. Defective measles virus in human subacute sclerosing panencephalitis 430brain. Virology. 202(20), 631-641 (1994). https://doi.org/10.1006/viro.1994.1384. 431432433434435436437Fig. 1 Distribution, quantification, and replication of SARS-Cov-2 across the human body 438and brain. The heat map depicts the highest mean quantification of SARS-CoV-2 RNA (N) via 439ddPCR present within the tissues of eleven COVID-19 autopsy patients who underwent whole 440body and brain sampling. Patients are aligned from shortest to longest duration of illness (DOI) 441prior to death, listed at the bottom of the figure, and grouped into early (≤14 days), mid (15-30 442days), and late (≥31 days) DOI. Tissues are grouped by tissue category beginning with the 443respiratory tract at the top and central nervous system at the bottom. Viral RNA levels range 444from 0.002 to 500,000 N gene copies per ng of RNA input, depicted as a gradient from dark blue 445at the lowest level to dark red at the highest level. Tissues that were also positive for sgRNA via 446real-time RT-PCR are shaded with black vertical bars. L/left, LN/lymph node, NA/not acquired, 447R/right, SC/spinal cord. 448449450451452453454455456457458459460Fig. 2 RNA in situ (RNAscope) detection of SARS-CoV-2 in extrapulmonary tissues. 461SARS-CoV-2 virus is localized to the Golgi and endoplasmic, peri-nuclear in appearance, in the 462following organs and cell types (500 X magnifications): A) Thyroid, demonstrating presence of 463virus within follicular cells. B) Esophagus, demonstrating the presence of virus within the 464stratified squamous epithelium (*), as well as signal in capillaries within the stroma (#). C. 465Spleen, demonstrating the presence of mononuclear lymphoid cells within the white pulp. D) 466Appendix, demonstrating the presence of virus in both colonic epithelium (*) and mononuclear 467lymphoid cells in the stroma (#). E) Adrenal demonstrates virus within endocrine secretory cells 468of the adrenal gland. F) Ovary demonstrates the presence of virus in stromal cells of the ovary in 469a post-menopausal ovary. G) Testis demonstrates the presence of virus in both Sertoli cells (*) 470and maturing germ cells within the seminiferous tubules of the testis (#). H) Endometrium 471demonstrates the presence of virus within endometrial gland epithelium (*) and stromal cells (#), 472in a pre-menopausal endometrial sample. 473474475Fig. 3 SARS-CoV-2 protein expression in human cerebellum. Low magnification 476visualization of no-primary control (A) and primary-added adjacent (B) cerebellar sections 477labeled for SARS-CoV-2 (green) and NeuN (magenta) demonstrate viral-specific protein 478expression within the tissue. The locations of the molecular layer (ML), granular layer (GL), and 479white matter (WM) are indicated in (A) and also correspond to (B). Higher magnification images 480demonstrate cell type-specific infection (C-E). Both NeuN positive neurons (yellow arrows) and 481other unidentified cells (white arrows) are associated with viral protein in the GL (C). Purkinje 482cells adjacent to the ML are infected (D, white arrow). In rare instances, blood vessels adjacent 483to the GL and WM were associated with viral protein (E, white arrow). The scale bars in A is 484also associated with B. All immunofluorescent images were obtained by confocal microscopy. 485486487488489490491492493494495496497498499500501502503504505506Methods: 507Autopsies 508Autopsies were performed and tissues were collected as previously described26 in the National 509Cancer Institute’s Laboratory of Pathology at the National Institutes of Health Clinical Center 510following consent of the legal next of kin. 511512Measurement of IgG and IgM antibodies against Nucleocapsid and Spike protein of SARS-513CoV-2 514Fluid-phase luciferase immunoprecipitation systems (LIPS) assays were used to study IgG and 515IgM antibody response to SARS-CoV-2. For IgG LIPS measurements, Renilla luciferase-516nucleocapsid and Gaussia luciferase-spike protein extracts were employed with protein A/G 517beads (Protein A/G UltraLink Resin, Thermo Fisher Scientific) as the IgG capture reagent as 518previously described with microtiter filter plates27. For IgM measurements, anti-human IgM goat 519agarose beads (Sigma) were substituted as the capture reagent using both the microfilter plate 520and microtube format28. The IgM immunoprecipitation assays performed in 1.5 ml microfuge 521tube format containing 1 l sera or plasma, Renilla luciferase-nucleocapsid (10 million light unit 522input per tube) or Gaussia luciferase-spike protein (40 million light input per tube) and buffer A 523(20 mM Tris, pH 7.5, 150 mM NaCl, 5 mM MgCl2, 0.1% Triton X-100) to a total volume of 100 524l. After mixing, the tubes were incubated at room temp for 1 hour. Next 10 l of the anti-human 525IgM agarose bead suspension was added to each tube for additional 60 minutes and tubes were 526placed on a rotating wheel at 4o C. The samples were then washed by brief centrifugation to 527collect the bead pellet at room temperature 3 times with 1.5 ml Buffer A and once with 1.5 ml of 528PBS. After the final wash, the beads were mixed with coelenterazine substrate (100 l) and light 529units measured in a tube luminometer. Known seronegative and seropositive samples for IgG and 530IgM antibodies against nucleocapsid and spike proteins were used for assigning seropositive cut-531off values and for standardization. 532533 SARS-CoV-2 RNA quantification of tissues and body fluids 534Total RNA was extracted from RNAlater (Invitrogen)-preserved tissues and body fluids 535collected at autopsy using the RNeasy Mini, RNeasy Fibrous Tissue Mini, RNeasy Lipid Tissue 536Mini Kit, and QIAamp Viral RNA Mini Kits (Qiagen) according to the manufacturer’s protocols. 537Upstream tissue processing and subsequent RNA quantification have been previously 538described26. The QX200 AutoDG Droplet Digital PCR System (Bio-Rad) was used to detect and 539quantify SARS-CoV-2 RNA in technical replicates of 5.5 uL RNA for fluids and up to 550 ng 540RNA for tissues as previously described26. Results were then normalized to copies of N1, N2, 541and RP per mL of sample input for fluids and per ng of RNA concentration input for tissues. For 542samples to be considered positive for SARS-CoV-2 N1 or N2 genes, they needed to mean the 543manufacturer’s limit of detection of ≥0.1 copies/μ L and ≥2 positive droplets per well. Over 60 544control autopsy tissues from uninfected patients, representing all organs collected for COVID-19 545autopsy cases, were used to validate the manufacturer’s EUA published LOD for nasopharyngeal 546swabs for tissues (Extended Data Table 8). ddPCR data for P316 as well as a portion of tissues 547from the oral cavity26 have been previously reported. 548549sgRNA analysis of ddPCR positive tissues 550Tissues that tested positive for one or both SARS-CoV-2 N gene targets via ddPCR had RNA 551submitted for sgRNA analysis. Briefly, five μ l RNA was used in a one-step real-time RT-PCR 552assay to sgRNA (forward primer 5’- CGATCTCTTGTAGATCTGTTCTC-3'; reverse primer 5’- 553ATATTGCAGCAGTACGCACACA-3'; probe 5’-FAM-554ACACTAGCCATCCTTACTGCGCTTCG-ZEN-IBHQ-3')29 using the Rotor-Gene probe kit 555(Qiagen) according to instructions of the manufacturer. In each run, standard dilutions of counted 556RNA standards were run in parallel to calculate copy numbers in the samples. The limit of 557detection for this assay was determined to be <40 Cq (Supplemental Data 1) using 40 control 558autopsy tissues from uninfected patients, representing all organs collected for COVID-19 559autopsy cases. 560561Viral isolation from select postmortem tissues 562Select tissues with high viral RNA levels via ddPCR and sgRNA PCR measuring at or below a 56330 Cq underwent virus isolation to prove the presence of infectious virus. Virus isolation was 564performed on tissues by homogenizing the tissue in 1ml DMEM and inoculating Vero E6 cells in 565a 24-well plate with 250 μ l of cleared homogenate and a 1:10 dilution thereof. Plates were 566centrifuged for 30 minutes at 1000 rpm and incubated for 30 minutes at 37°C and 5% CO2. The 567inoculum was then removed and replaced with 500 μ l DMEM containing 2% FBS, 50 U/ml 568penicillin and 50 μg/ml streptomycin. Six days after inoculation, cytopathic effect (CPE) was 569scored. A blind passage of samples where no CPE was present, was performed according to the 570same method. Supernatants from plates with CPE present were analyzed via PCR for SARS-571CoV-2 to rule out other causes of CPE. 572573Virus Sequencing Methods 574Patients with duration of illness ≤7 d (P27, P19) and 8-14 d (P18) with multiple body site 575tissues containing sgRNA levels ≤31 Cq value were selected for high throughput, single-genome 576amplification and sequencing (HT-SGS) as previously described21. Presence of variants of 577SARS-CoV-2 were analyzed within and between tissues. 578579SARS-CoV-2 RNA in situ hybridization 580Chromogenic in situ detection was performed using the manual RNAScope 2.5 HD assay (Cat# 581322310, Advanced Cell Diagnostics, Hayward, CA) with a modified pretreatment protocol.582Briefly, formalin-fixed and paraffin-embedded (FFPE) tissue sections were cut at 7 μm, air dried 583overnight, and baked for 2 hrs at 60ºC. The FFPE tissue sections were deparaffinized, 584dehydrated, and then treated with pretreat 1 for 10 min at room temperature. The slides were 585boiled with pretreatment reagent for 15 min, digested with protease at 40ºC for 10 min, then 586hybridized for 2 hours at 40oC with probe-V-nCov2019-S (Cat# 848561, Advanced Cell 587Diagnostics). In addition, probe-Hs-PPIB (Cat# 313901, Advanced Cell Diagnostics) and probe-588dapB (Cat# 310043, Advanced Cell Diagnostics) were used as a positive and negative control, 589respectively. Subsequent amplification was done according to the original protocol. Detection of 590specific probe binding sites were visualized with RNAScope 2.5 HD Reagent kit-brown 591chromogenic labels (Advanced Cell Diagnostics). The slides were counterstained with 592hematoxylin and cover-slipped. 593594SARS-CoV-2 immunohistochemistry 595FFPE cerebellar sections were deparaffinized, rehydrated and subject to 0.01M Citrate buffer 596antigen retrieval for 20min at 120°C. Slides were incubated in 0.1% TritonX100 in PBS for 59730min, washed extensively with PBS and fresh True Black Plus® solution (1:40, Cat#23014, 598Biotium) applied for 7min. Following PBS wash, blocking serum (5% normal donkey 599serum/0.3M glycine) was applied for 30min. Primary antibodies against SARS-CoV-2 NP1 600(1:250, custom made) and NeuN (1:200, Cat#MAB377, Chemicon) were diluted in blocking 601serum and applied to slides overnight at 4°C. Species-specific secondary conjugates (1:500, 602Cat#A32790 and #A32744, ThermoFisher) were applied for 1hr at RT. Hoescht 33342 applied 603for 10min (1:2000, Cat#H3570, ThermoFisher) labeled nuclei. Slides were cover-slipped with 604Prolong Gold (Cat#P36930, ThermoFisher). 605606Data Availability 607The datasets that support the findings of this study are available in Supplementary Data 1, 2 and 6083. Sequence data described in this manuscript have been deposited (database accession numbers 609XXXX). The bioinformatic pipeline for HT-SGS data analysis has been deposited 610(https://github.com/niaid/UMI-pacbio-pipeline). ISH images from our cohort as well as positive 611and negative controls are available in Supplementary Data 3, which is available at 612https://halo.cancer.gov, Authentication method: NIH, username: halocancernci@gmail.com, 613password: covid19N!H. 614615Methods References: 61626.Huang, N., et al. SARS-CoV-2 infection of the oral cavity and saliva. Nat Med. 27, 892–617903 (2021). https://doi.org/10.1038/s41591-021-01296-8. 61827.Burbelo, P. D., et al. Sensitivity in Detection of Antibodies to Nucleocapsid and Spike 619Proteins of Severe Acute Respiratory Syndrome Coronavirus 2 in Patients With 620Coronavirus Disease 2019. J Infect Dis. 222(2), 206-213 (2020). 621https://doi.org/10.1093/infdis/jiaa273. 62228.Burbelo, P. D., Goldman, R., & Mattson, T. L. A simplified immunoprecipitation method 623for quantitatively measuring antibody responses in clinical sera samples by using 624mammalian-produced Renilla luciferase-antigen fusion proteins. BMC Biotechnol. 5, 22 625(2005). https://doi.org/10.1186/1472-6750-5-22. 62629.Wölfel R., et al. Virological assessment of hospitalized patients with COVID-19. Nature. 627581(7809), 465-469 (2020). https://doi.org/10.1038/s41586-020-2196-x. 628629Acknowledgements: 630This study was funded and supported by the Intramural Research Program of the National 631Institutes of Health, Clinical Center, National Institute of Dental and Craniofacial Research, and 632National Institute of Allergy and Infectious Diseases. 633This research was made possible through the NIH Medical Research Scholars Program, a 634public-private partnership supported jointly by the NIH and contributions to the Foundation for 635the NIH from the Doris Duke Charitable Foundation, Genentech, the American Association for 636Dental Research, and the Colgate-Palmolive Company. 637638NIH COVID-19 Autopsy Consortium 639Daniel S. Chertow1,2, Kevin M. Vannella1,2, Sydney R. Stein1,2, Marcos J. Ramos-Benitez1,2,4, 640Andrew P. Platt1,2, James M. Dickey1,2, Ashley L. Babyak1,2, Luis J. Perez Valencia1,2, Sabrina 641C. Ramelli3, Shelly J. Curran3, Mary E. Richert3, David E. Kleiner5, Stephen M. Hewitt5, Martha 642Quezado5, Willie J. Young5, Sarah P. Young5, Billel Gasmi5, Michelly Sampaio De Melo5, 643Sabina Desar5, Saber Tadros5, Nadia Nasir5, Xueting Jin5, Sharika Rajan5, Esra Dikoglu5, Neval 644Ozkaya5, Kris Ylaya5, Joon-Yong Chung5, Stefania Pittaluga5, Grace Smith5, Elizabeth R. 645Emanuel6, Brian L. Kelsall6, Justin A. Olivera7, Megan Blawas7, Robert A. Star7, Alison 646Grazioli8, Nicole Hays9, Madeleine Purcell9, Shreya Singireddy9, Jocelyn Wu9, Katherine Raja9, 647Ryan Curto9, Jean E. Chung10, Amy J. Borth10, Kimberly A. Bowers10, Anne M. Weichold10, 648Paula A. Minor10, Mir Ahmad N. Moshref10, Emily E. Kelly10, Mohammad M. Sajadi11,12, Kapil 649K. Saharia11,12, Daniel L. Herr13, Thomas M. Scalea14, Douglas Tran15, Ronson J. Madathil15, 650Siamak Dahi15, Kristopher B. Deatrick15, Eric M. Krause16, Joseph Rabin17, Joseph A. Herrold18, 651Ali Tabatabai18, Eric S. Hochberg18, Christopher R. Cornachione18, Andrea R. Levine18, Justin E. 652Richards19, John Elder20, Allen P. Burke20, Michael A. Mazzeffi21, Robert H. Christenson22, 653Zackary A. Chancer23, Mustafa Abdulmahdi24, Sabrina Sopha24, Tyler Goldberg24, Shahabuddin 654Soherwardi25, Yashvir Sangwan26, Michael T. McCurdy27,12, Kristen Sudano27, Diane Blume27, 655Bethany Radin27, Madhat Arnouk27, James W. Eagan Jr28, Robert Palermo29, Anthony D. 656Harris30 657658Affiliations: 6591.Emerging Pathogens Section, Department of Critical Care Medicine, Clinical Center, 660National Institutes of Health, Bethesda, MD, USA 6612.Laboratory of Immunoregulation, National Institute of Allergy and Infectious Diseases, 662Bethesda, MD, USA 6633.Critical Care Medicine Department, Clinical Center, National Institutes of Health, 664Bethesda, MD, USA 6654.Postdoctoral Research Associate Training Program, National Institute of General Medical 666Sciences, National Institutes of Health, Bethesda, MD, USA 6675.Laboratory of Pathology, Center for Cancer Research, National Cancer Institute, National 668Institutes of Health, Bethesda, MD, USA 6696.Mucosal Immunobiology Section, Laboratory of Molecular Immunology, National 670Institute of Allergy and Infectious Diseases, National Institutes of Health, Bethesda, MD, 671USA 6727.Renal Diagnostics and Therapeutics Unit, Kidney Diseases Branch, National Institute of 673Diabetes and Digestive and Kidney Diseases, National Institutes of Health, Bethesda, 674MD, USA 6758.Kidney Disease Section, Kidney Diseases Branch, National Institute of Diabetes and 676Digestive and Kidney Diseases, National Institutes of Health, Bethesda, MD, USA 6779.University of Maryland School of Medicine, Baltimore, MD, USA 67810.University of Maryland Medical Center, Baltimore, MD, USA 67911.Institute of Human Virology, University of Maryland School of Medicine, Baltimore, 680MD, USA 68112.Department of Medicine, Division of Pulmonary and Critical Care Medicine, University 682of Maryland School of Medicine, Baltimore, MD, USA 68313.R Adams Cowley Shock Trauma Center, Department of Medicine and Program in 684Trauma, University of Maryland School of Medicine, Baltimore, MD, USA 68514.Department of Shock Trauma Critical Care, University of Maryland School of Medicine, 686Baltimore, MD, USA 68715.Department of Surgery, Division of Cardiac Surgery, University of Maryland School of 688Medicine, Baltimore, MD, USA 68916.Department of Surgery, Division of Thoracic Surgery, University of Maryland School of 690Medicine, Baltimore, MD, USA 69117.R Adams Cowley Shock Trauma Center, Department of Surgery and Program in Trauma, 692University of Maryland School of Medicine, Baltimore, MD, USA 69318.Department of Medicine, Division of Infectious Disease, University of Maryland School 694of Medicine, Baltimore, MD, USA 69519.Department of Anesthesiology, Division of Critical Care Medicine, University of 696Maryland School of Medicine, Baltimore, MD, USA 69720.Department of Autopsy and Thoracic Pathology, University of Maryland School of 698Medicine, Baltimore, MD, USA 69921.Department of Anesthesiology and Critical Care Medicine, George Washington School 700of Medicine and Health Sciences, Washington, DC USA 70122.Department of Laboratory Science, University of Maryland School of Medicine, 702Baltimore, MD, USA 70323.Department of Anesthesiology, University of Southern California Keck School of 704Medicine, Los Angeles, CA, USA 70524.Critical Care Medicine, University of Maryland Baltimore Washington Medical Center, 706Glen Burnie, MD, USA 70725.Hospitalist Department, TidalHealth Peninsula Regional, Salisbury, MD, USA 70826.Department of Interventional Pulmonology, TidalHealth Peninsula Regional, Salisbury, 709MD, USA 71027.Division of Critical Care Medicine, Department of Medicine, University of Maryland St. 711Joseph Medical Center, Towson, MD, USA 71228.Department of Pathology, University of Maryland, St. Joseph Medical Center, Towson, 713MD, USA 71429.Department of Pathology, Greater Baltimore Medical Center, Townson, MD, USA 71530.Department of Epidemiology and Public Health, University of Maryland School of 716Medicine, Baltimore, MD, USA 717718Author Contributions 719DSC, KMV, SRS, MJRB, ALB, LJPV, AG, DLH, SMH & DEK contributed to the study design 720and protocols for autopsy procurement. APP, JMD, MER, AG, NH, MP, SS, JW, KR, RC, JEC, 721AJB, KAB, AMW, PAM, MANM, EEK, MMS, KKS, DLH, TMS, DT, RJM, SD, KBD, EMK, 722JR, JAH, AT, ESH, CRC, ARL, JER, JE, APB, MAM, RHC, ZAC, MA, SS, TG, SS, YS, MTM, 723KS, DB, BR, MA, JWE Jr, RP, and ADH provided care for, recruited, collected samples from, 724and/or procured medical records for the patients in this study. DEK, SMH, MQ, WJY, SPY, BG, 725MSDM, SD, ST, NN, XJ, SR, ED, NO, KY, JYC, SP, and GS conducted the autopsies and/or 726histological and ISH analysis. SRS, MJRB, APP, JMD, ALB, LJPV, SCR, SJC, ERE, BLK, 727JAO, MB, and RAS assisted with procurement and preservation of autopsy specimens. SRS with 728assistance from SCR and JMD performed RNA extraction, ddPCR, and data analysis. MS, CKY, 729VJM, and EDW performed and analyzed data for sgRNA RT-PCR. CWW and KEP conducted 730IHC on cerebellum. PDB and JIC measured antibody responses to SARS-CoV-2 in perimortem 731plasma samples. SHK, FB, and EAB performed viral sequencing. SRS drafted the manuscript 732with critical input from DSC, KMV, SMH, DEK, SCR, APP, MJRB, EDW, VJM, AG, DLH, 733KKS, MMS MTM, PDB, JIC, CWW, KEP, and SJC. All authors approved the submitted version 734of the manuscript. 735Competing Interests: 736The authors declare no competing or conflict of interest. 737Additional Information: 738Supplementary information is available for this paper. 739Correspondence and requests for materials should be addressed to DSC. 740741742743744745746747748749Extended Data Fig. 1 Autopsy procurement relative to Maryland COVID-19 cases, March 75019th, 2020 to March 9th, 2021. Daily COVID-19 reported cases for Maryland (light blue bars) 751with 7-day average (dark blue line) with timing of autopsies (red arrows). 752753754755756757758759760761762763Extended Data Fig. 2 Distribution, quantification, and replication of SARS-CoV-2 across the 764body and brain over time. The heat map depicts the highest average quantification of SARS-765CoV-2 RNA (N) via ddPCR present within all sampled tissues of 44 autopsy cases. Patients are 766aligned from shortest to longest duration of illness (DOI) prior to death, listed at the bottom of 767the figure, and grouped into early (0-14 d), mid (15-30 d), and late (≥31 d) DOI. Tissues are 768grouped by body system beginning with the respiratory tract at the top and CNS at the bottom. 769Viral RNA levels range from 0.0004 to 500,000 copies per ng of RNA input, depicted as a 770gradient from dark blue at the lowest level to dark red at the highest level. Tissues that were also 771positive for sgRNA via real-time RT-PCR are shaded with black vertical bars. 772773774775776777778779780781782783784785786787Extended Data Figure 3: Analysis of SARS-CoV-2 genetic diversity across body 788compartments in patients. (a) P18, (b) P19, (c) P27, (d) P33, (e) P36, (f) P38. Haplotype 789diagrams (left) show SARS-CoV-2 spike single genome sequences detected in multiple organs. 790Spike NH2-terminal domain (NTD), receptor-binding domain (RBD), and furin cleavage site (F) 791regions are shaded grey, and remaining regions of the spike are shaded white. Ticks with 792different colors indicate mutations relative to the WA-1 reference sequence; green indicates non-793synonymous differences from WA-1 detected in all sequences in the individual; blue indicates 794synonymous mutations detected variably within the individual, and pink indicates non-795synonymous mutations detected variably within the individual. Bar graphs (right) show the 796percentage of all single genome sequences in the sample matching each haplotype. 797798799800801802803804805806807808809810811Extended Data Fig. 4 Representative findings in patients in the COVID-19 cohort. A. Lung, 812Subject P22. Exudative phase diffuse alveolar damage with hyaline membranes and mild 813interstitial inflammation (H&E, 100x). B. Lung, Subject P26. Proliferative phase diffuse alveolar 814damage and sparse inflammation. (H&E, 200x). C. Lung, Subject P22. Organizing thrombus in 815medium sized pulmonary artery. (H&E, 40x). D. Lung, Subject P28. Diffuse pulmonary 816hemorrhage. (H&E, 100x). E. Heart, Subject P3. Active lymphocytic myocarditis with 817cardiomyocyte necrosis. (H&E, 400x). F. Heart, Subject P38. Microscopic focus of bland 818myocardial contraction band necrosis. (H&E, 400x). G. Liver, Subject P41. Steatohepatitis with 819mild steatosis and scattered ballooned hepatocytes. (H&E, 400x), H. Liver, Subject P41. Focal 820bridging fibrosis involving central hepatic veins. (Masson trichrome, 40x). I. Kidney, Subject 821P16. Nodular glomerulosclerosis. (Masson trichrome, 600x). J. Spleen, Subject P16. Preservation 822of white pulp and congestion (H&E, 40x) K. Spleen, Subject P14. Lymphoid depletion of white 823pulp with proteinaceous material and red pulp congestion. (H&E, 100x) L. Spleen, Subject P34. 824Relative preservation of white pulp with extramedullary hematopoiesis (inset) in red pulp (H&E, 825200x) M. Lymph node, Subject P25. Follicular hyperplasia with well-defined follicles. (H&E, ) 826N. Lymph node, Subject P25. Marked plasmacytosis in the medullary cord. (H&E, 400x) O. 827Lymph node, Subject P25. Marked plasmacytosis and sinus histiocytosis. (H&E, 400x) P. Brain, 828Subject P35, Focal subarachnoid and intraparenchymal hemorrhage. (H&E, 40x) Q. Brain, 829Subject P44, Vascular congestion. (H&E, 40x) R. Brain, Subject P43, Intravascular platelet 830aggregates. (anti-CD61 stain, 100x) 831832833834835836837838Extended Data Fig. 5 Temporal association of diffuse alveolar damage in patients dying 839from COVID-19. Number of autopsy cases with stages of diffuse alveolar damage via 840histopathologic analysis by duration of illness. Early time points mainly show the initial 841exudative phase of diffuse alveolar damage, while patients dying after prolonged illness are more 842likely to show organizing or fibrosing stages. 843844845846Extended Data Table 1 Autopsy cohort demographics, comorbidities, and clinical 847intervention summary. (a) Summary of demographics and known comorbidities for autopsy 848cases. (b) Summary of illness course and clinical care for autopsy cases. Data compiled from 849available patient medical records. ECMO/extracorporeal membrane oxygenation. 850851852853854Extended Data Table 2 Individual case demographics and clinical summary. Data obtained 855from available medical records. AF/atrial fibrillation, AVAPS/average volume-assured pressure 856support, BiPAP/bilevel positive airway pressure, CAD/coronary artery disease, CHF/congestive 857heart failure, CKD/chronic kidney disease, CML/chronic myeloid leukemia, COPD/chronic 858obstructive pulmonary disease, DAD/diffuse alveolar damage, DM/diabetes mellitus, DVT/deep 859vein thrombosis, ECMO/extracorporeal membrane oxygenation, ESRD/end-stage renal disease, 860HLD/hyperlipidemia, HTN/hypertension, Hx/historical, ILD/interstitial lung disease, LV/left 861ventricular, MS/multiple sclerosis, PE/pulmonary embolism, PVD/peripheral vascular disease, 862PH/pulmonary hypertension, s/p/status post. 863864865Extended Data Table 3 Summary of SARS-CoV-2 RNA and sgRNA by tissue category over 866time. (a) Summary of the average nucleocapsid gene copies/ng RNA across cases by tissue 867category and duration of illness (days). (b) Summary of the number and percentage of cases with 868SARS-CoV-2 RNA detected via droplet digital (dd)PCR by tissue category for all cases and by 869tissue and duration of illness (days). The number and percentage of tissues positive for ddPCR 870that were additionally positive for subgenomic (sg)RNA PCR is listed in the right most column. 871*A tissue positive via ddPCR was not tested via sgRNA PCR. CNS/central nervous system, 872LN/lymph node. 873874875Extended Data Table 4 SARS-CoV-2 cellular tropism. Summary of cell types that were 876identified as SARS-CoV-2 positive by ISH, and the corresponding anatomic sites in which this 877was observed. 878Cell TypeLocationsBile duct epitheliumLiverChondrocytesBronchial cartilage ringsCollecting duct epitheliumKidneyDistal tubule epitheliumKidneyEndocrine cells of adrenalAdrenal glandEndocrine cells of thyroidThyroidEndotheliumVasculature, allEpendymaBrain Exocrine cells of pancreasPancreasFibroblast-like cellsPericardium, heart, trachea, bronchusGerm cellsTestisGlandular epithelumUterus GliaBrain, all locationsHepatocytesLiverHyaline MembraneLungInterstitial cells of endometriumUterusIntimal cellsAortaKupffer cellsLiverLeydig cellsTestisMononuclear leukocytesLung, spleen, lymph nodes, lymphoid aggregates of GIMucosal epitheliumSmall intestine, colonMucus secreting epithelium, salivary typeSalivary glands, trachea, bronchusMyocytes, CardiacHeartMyocytes, StriatedPsoas muscleMyocytes, SmoothUterus, GINeuronsBrain, all locationsParietal cells Kidney, Bowman's capsulePneumocytes, type I & IILungPurkinje cellCerebellumSchwann cellsNerves, allSertoli cellsTestisStratified epithelium (& basal layer)Trachea, esophagusStromal cellsPericardium, uterus, ovaryVascular smooth muscleArteries, all879Extended Data Table 5 Histopathologic findings of COVID-19 autopsy cases. Summary of 880histopathologic findings across organ system across 44 autopsy cases. Central nervous system 881findings are reported for the 11 cases in which consent for sampling was obtained. 1Includes one 882case in which the COVID lungs were transplanted and data from explanted lungs used in table. 8832Individual lung weights were missing in 4 cases. 3Findings missing on 1 case due to extreme 884autolysis. 4Weight missing on one case. 5Lymph node findings missing in 4 cases 885
    1. SciScore for 10.1101/2021.12.21.473594: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: The corresponding animal experiments have been approved by the Animal Committee of Wuhan University.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Immunization of mice: Female K18-hACE2 transgenic mice were obtained from GemPharmatech Co.,</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines: The A549-hACE2, Caco-2, Vero E6 cell lines were obtained from ATCC and maintained in Dulbecco’s modified Eagle’s medium (DMEM; Gibco) supplemented with 10% fetal bovine serum (FBS).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Forty-eight hours post-transfection, 500 μl pseudotyped VSV-ΔG bearing VSV-G protein was used to infect Vero E6 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Neutralization assays: The day before neutralization assays, the BHK21-hACE2 cells were seeded into 96-well culture plates at an appropriate density.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK21-hACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then, the CHO-K1 cells were transfected with the Swt, S6, or S15 plasmids by Bio-Rad Gene Pulser Xcell system, respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHO-K1</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Immunization of mice: Female K18-hACE2 transgenic mice were obtained from GemPharmatech Co.,</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>K18-hACE2</div><div>suggested: RRID:IMSR_GPT:T037657)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The K18-hACE2 or BALB/C mice aged 6–7 weeks were immunized twice by intramuscular injection (100 μL in each of the left and right quadriceps femoris muscles per mouse) at 2 weeks apart.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/C</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmid and Site-directed mutagenesis: The DNA sequences of human codon-optimized S proteins from SARS-COV-2 variants (B.1.1.7, GISAID: EPI-ISL-601443; B.1.351, GISAID: EPI_ISL_678597; P.1, GISAID: EPI_ISL_906075; B. 1.525, GISAID: EPI_ISL_1093472; B.1.2, GISAID: EPI_ISL_2000505; B. 1.617.1 GISAID: EPI_ISL_1660428 S1; B.1.627.2, GISAID: EPI_ISL_2029113; C.37, GISAID: EPI_ISL_3023383; B.1.1.529, GISAID:EPI_ISL_7162071) and S protein mutations were commercially synthesized or generated by overlapping-PCR based mutagenesis using pCAGGS-SARS-CoV-2-S-C9 (gifted from Dr. Wenhui Li, National Institute of Biological Science, Beijing, China) as a template and cloned into pCAGGS vector with C-terminal 18 aa truncation to improve VSV pseudotyping efficiency (47).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAGGS-SARS-CoV-2-S-C9</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pCAGGS</div><div>suggested: RRID:Addgene_127347)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To produce pseudotyped VSV-ΔG-Luc bearing SARS-CoV-2 spike protein (pseudo-SARS-CoV-2), Vero E6 cells were seeded in 10-cm dishes and transfected simultaneously with 15 μg SARS-CoV-2-S-Δ18 plasmid using Lipofectamine 2000 (</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2-S-Δ18</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The sequences were synthesized and constructed between Hind III and Not I site into GS-KS001 plasmid (Quacell biotechnology).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GS-KS001</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The 50 % neutralization dilution titer (NT50) and Geometric Mean Titers (GMT) with NT50 were calculated by GraphPad Prism 7 (GraphPad Software, Inc.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Immunization of mice: Female K18-hACE2 transgenic mice were obtained from GemPharmatech Co.,</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GemPharmatech</div><div>suggested: (GemPharmatech, RRID:SCR_017239)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The structural figures were obtained using the PyMOL Molecular Graphics System, Version 1.0.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMOL</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">MAFFT (v7.487) was used to align each peptide sequence to the reference sequence (Wuhan-Hu-1/2019), and the mutation information was parsed using a custom python script.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MAFFT</div><div>suggested: (MAFFT, RRID:SCR_011811)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.20.473447: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The reaction mixtures were analyzed by immunoblotting with a specific anti-S-protein monoclonal antibody (mAb) (NovusBio, Littleton, CO).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-S-protein</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 infection and In-Cell ELISA: The African green monkey kidney-derived Vero cells (ATCC CCL-81TM) were seeded into 96-well flat-bottom plates (1×104 cells, 80 μl/well) in Dulbecco’s Modified Eagle’s medium (DMEM), high glucose, with GlutaMAX and sodium pyruvate (Gibco/Thermo Fisher Scientific, Waltham, MA USA) supplemented with 10% fetal calf serum (FCS, Biowest, Nuaillé, France), 1% MEM non-essential amino acids solution, 100 U/mL penicillin and 100 μg/mL streptomycin (all latter from Gibco/Thermo Fisher Scientific).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: RRID:CVCL_ZW93)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The sequences of the 19-amino-acids-long synthetic peptides were as follows: GRRRSVQWCAVSQPEATKC (the N-terminal pLF1, residues 1-19), EDAIWNLLRQAQEKFGKDK (the middle pLF2, residues 264-282), NLKKCSTSPLLEACEFLRK (the C-terminal pLF3, residues 674-692), and NFRTKSCPLELAKELKLCS (pCTR, a scrambled variant of pLF3).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLF1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pCTR</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pLF3</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.21.473668: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: Toxicology: Animal experimental procedures were reviewed and approved by the University of Illinois Institutional Animal Care and Use Committee (</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Toxicity of each peptide was assessed in 5 female and 5 male CD-1 IGS mice (8 weeks old).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Animals with sex- and age-matched littermates were randomly included in experiments.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Animal experiments were carried out in a blinded fashion whenever feasible.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">For the number of animals needed to achieve statistically significant results, we conducted a priori power analysis.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After this, cells were stained with antibodies including CD45-EF450 (1:2000, eBioscience #48-0451-82) and CD31-APC (1:100, eBioscience #17-0311-82) for 45 minutes at 4°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD45-EF450</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD31-APC</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-SARS-CoV-2 Monoclonal Antibodies: Sequences for monoclonal antibodies that had received Emergency Use Authorization from the U.S. Food and Drug Administration were pulled from the KEGG database (Accession No. REGN10933, D11938; REGN10987, D11939; VIR-7831, D12014; LY-CoV555, D11936).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-SARS-CoV-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>D12014; LY-CoV555, D11936</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>LY-CoV555</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The SARS-CoV-2 were propagated in Vero E6 cells (CRL-1586; American Type Culture Collection).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK293T cells were grown to 80% confluency before transfection with pCMV3-SARS-CoV-2-spike (Sino Biological) using Lipofectamine®3000 (Invitrogen).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell culture: The 2019n-CoV/USA_WA1/2019 isolate as well as the P.1 variant of SARS-CoV-2 and ACE-2 expressing A549 cell lines were obtained from BEI Resources.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>A549</div><div>suggested: NCI-DTP Cat# A549, RRID:CVCL_0023)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero E6 (CRL-1586; American Type Culture Collection) Vero CCL81 (American Type Culture Collection),</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero CCL81</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Assessment of ACE2 mutants: Expi293F cells transfected with pCEP4-myc-ACE2 plasmids were collected 24 h post-transfection (600 × g, 60 s), washed with ice-cold Dulbecco’s phosphate buffered saline (PBS) containing 0.2% bovine serum albumin (BSA), and stained with 1:50 RBD-sfGFP expression medium (prepared as previously described 22 and 1:250 anti-myc Alexa 647 (clone 9B11, Cell Signaling Technology) in PBS-BSA.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Expi293F</div><div>suggested: RRID:CVCL_D615)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Hemizygous K18-hACE mice with c57BL/6J background (strain#034860: B6.Cg-Tg(K18-ACE2)2Prlmn/J) were purchased from The Jackson Laboratory.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>K18-hACE</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>B6.Cg-Tg(K18-ACE2)2Prlmn/J</div><div>suggested: RRID:IMSR_JAX:034860)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For in vivo studies, 10 mg/kg sACE22.v2.4-IgG1 (wt), sACE22.v2.4-IgG1 and control peptide buffer were intravenously administrated into K-18 hACE-2 mice for 30 minutes prior to SARS-CoV-2 pseudo-entry virus (106 pfu) i.p. injection for 1 dpi.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>hACE-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pharmacokinetics: 8-week-old CD-1 IGS mice (3 female and 3 male per time point) were IV administered protein solutions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD-1 IGS</div><div>suggested: RRID:MGI:5461217)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To characterize different routes side-by-side, peptides were administered to C57BL/6 mice, 3 males per time point.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57BL/6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK293T cells were grown to 80% confluency before transfection with pCMV3-SARS-CoV-2-spike (Sino Biological) using Lipofectamine®3000 (Invitrogen).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV3-SARS-CoV-2-spike</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">8his-tagged monomeric sACE2 (ACE2 a.a. 1-615; pcDNA3-sACE2(WT)-8his, Addgene No. 149268, and pcDNA3-sACE2v2.4-8his, Addgene No. 149664), and human IgG1-Fc fused dimeric sACE22 (ACE2 a.a. 1-732; pcDNA3-sACE2-WT(732)-IgG1,</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3-sACE2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pcDNA3-sACE2v2.4-8his</div><div>suggested: RRID:Addgene_149664)</div></div><div style="margin-bottom:8px"><div>pcDNA3-sACE2-WT(732)-IgG1</div><div>suggested: RRID:Addgene_154104)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Addgene No. 154104, and pcDNA3-sACE2v2.4(732)-IgG1, Addgene No. 154106) are previously described.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3-sACE2v2.4</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Human codon-optimized S (GenBank No. YP_009724390.1) was subcloned into pCEP4 (Invitrogen) from pUC57-2019-nCoV-S(Human) (distributed by Molecular Cloud on behalf of Haisheng Yu, Chinese Academy of Medical Sciences) with a N-terminal HA leader (MKTIIALSYIFCLVFA), myc-tag (EQKLISEEDL), and linker (GSPGGA) upstream of the mature polypeptide (a.a. V16-T1273).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCEP4</div><div>suggested: RRID:Addgene_16479)</div></div><div style="margin-bottom:8px"><div>pUC57-2019-nCoV-S(Human</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Assessment of ACE2 mutants: Expi293F cells transfected with pCEP4-myc-ACE2 plasmids were collected 24 h post-transfection (600 × g, 60 s), washed with ice-cold Dulbecco’s phosphate buffered saline (PBS) containing 0.2% bovine serum albumin (BSA), and stained with 1:50 RBD-sfGFP expression medium (prepared as previously described 22 and 1:250 anti-myc Alexa 647 (clone 9B11, Cell Signaling Technology) in PBS-BSA.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCEP4-myc-ACE2</div><div>suggested: RRID:Addgene_141185)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In vitro binding assays to S variants: Expi293F cells were transfected with pCEP4-myc-S plasmids as described above.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCEP4-myc-S</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">H and L chains were cloned with CD5 leader sequences into pcDNA3.1(+) and expressed in Expi293F cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Images were taken with a Zeiss microscope and analyzed by Zen software (Zeiss)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Zen</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For sACE22.v2.4 without any tags or fusion partner (corresponding to ACE2 residues 19-732, protein provided by Orthogonal Biologics, Inc.), mice were IV administered (tail vein, 0.5 mg/kg) protein twice daily for 5 consecutive days (days 0-4) and sacrificed day 7.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Orthogonal Biologics</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mutations were introduced using PyMOL (https://pymol.org/2/) and the systems were solvated using TIP3P water and 150 mM NaCl using PACKMOL 71.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMOL</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Protein residues and glycosylation sites were parameterized using AMBER ff14SB 72 and GLYCAM06 73 force fields.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>AMBER</div><div>suggested: (AMBER, RRID:SCR_016151)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-SARS-CoV-2 Monoclonal Antibodies: Sequences for monoclonal antibodies that had received Emergency Use Authorization from the U.S. Food and Drug Administration were pulled from the KEGG database (Accession No. REGN10933, D11938; REGN10987, D11939; VIR-7831, D12014; LY-CoV555, D11936).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>KEGG</div><div>suggested: (KEGG, RRID:SCR_012773)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code and data.


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Another limitation is our focus on intravenous delivery, whereas intratracheal or inhalation delivery may be more readily applied in patients, especially in the outpatient setting. It would be useful in future studies to use varying doses and delivery route combinations for defined disease stages to identify the optimal combination prior to initiating human efficacy trials. Finally, we chose to fuse the ACE2 peptide to an unmodified Fc from IgG1 (isoallotype nG1m1), whereas others have considered fusions to Fc mutants or IgG4 to dampen interactions with FcγR subtypes that might contribute to inflammation24, 68. We instead reasoned that IgG1 effector functions will be necessary for optimum in vivo protection. In summary, we show for the first time that an engineered decoy ACE2 peptide demonstrating much higher affinity for the SARS-CoV-2 Spike protein is efficacious in vivo against multiple SARS-CoV-2 variants. This peptide prevented viral entry into cells and the peptide’s efficacy against a variant of concern prevented lung endothelial injury and ARDS and significantly reduced mortality. The results show the potential of this engineered peptide to treat COVID-19 patients and others with inadequate antibody titer to protect against emerging, more virulent SARS-CoV-2 variants.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.21.473774: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: The study protocol was approved by the Human Research Ethics Committees of the Northern Sydney Local Health District, the University of New South Wales, NSW Australia (ETH00520), CALHN Human Research Ethics Committee, Adelaide, Australia<br>Consent: Written informed consent was obtained from all participants before enrolment.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Archival serum or plasma collected from 25 healthy donors prior to the pandemic with an age range of 24-73 years, and a male to female ratio of 1:2.4 was used as controls.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Expression of surface Fc-receptors was assessed by flow cytometry using monoclonal antibodies (mAbs) against Fcγ receptor RI (CD64)-FITC, FcγRIII (CD16)-PE, CD14-PerCP</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD64)-FITC</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Endpoint titre and Isotyping of anti-SARS-CoV-2 Spike and anti-RBD antibodies in sera of patients with SARS-CoV-2 infection: Anti-SARS-CoV-2 Spike and RBD IgG antibody in sera was quantified using a modified direct ELISA [27].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>RBD IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For the endpoint titre of total anti-Spike or anti-RBD antibodies, 50μL of horseradish peroxidase (HRP)-conjugated mouse anti-human detection antibody added per well (Jackson ImmunoResearch, USA) (1:5000 dilution in 5% skim milk).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Spike</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-RBD</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human detection</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For isotyping of the anti-Spike or anti-RBD antibodies, 50μL/well of HRP-conjugated immunoglobulin subtype or IgG subclass specific detection antibodies were added.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgG subclass specific detection antibodies</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">These include 1:6000 dilution of anti-total human IgG (Jackson Immunoresearch), 1:3000 dilution of anti-human IgA (α-chain-specific) (Sigma) or 1:3000 dilution of anti-human IgM (μ-chain-specific) (Sigma) antibody subtypes and 1:6000 dilution of anti-human IgG1, IgG2, IgG3 or IgG4 (Southern Biotech, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-total human IgG</div><div>suggested: (Cell Signaling Technology Cat# 13123, RRID:AB_2617178)</div></div><div style="margin-bottom:8px"><div>anti-human IgA ( α-chain-specific ) ( Sigma )</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human IgM ( μ-chain-specific ) ( Sigma )</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human IgG1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgG2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgG3</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgG4</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To assess whether the uptake of the microbeads opsonised with the plasma of patients with acute disease was via Fc-receptor (antibody-dependent), and other heat labile opsonins such as complements (eg C3b), either the Fc-receptors on the THP-1 cells were pre-blocked using the universal Fc receptor blocking agent (Miltenyi, USA) [23], or the plasma heat inactivated at 56°C for 30 minutes, as described [28].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antibody-dependent) ,</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Surface plasmon resonance: Surface plasmon resonance (SPR) was performed using a Biacore T200 (Cytiva, USA) to determine the binding characteristics of the anti-Spike polyclonal antibodies in patient plasma to SARS-CoV-2 Spike antigen.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2 Spike antigen .</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Friedman’s test with pairwise Dunn’s tests were used to compare the repeated measures of Spike p-score, Spike and RBD end point titre, neutralisation titre and antibody affinity across the timepoints V1, V2 and V3.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>V3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To rank the variables of statistical importance that associated with Spike p-score (dependent variable), multiple linear regression analysis was performed using disease severity, age, gender, DPS, anti-Spike/RBD endpoint antibody titre, anti-Spike/RBD antibody subtypes and neutralisation titre as independent variables.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Spike/RBD</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To assess whether the uptake of the microbeads opsonised with the plasma of patients with acute disease was via Fc-receptor (antibody-dependent), and other heat labile opsonins such as complements (eg C3b), either the Fc-receptors on the THP-1 cells were pre-blocked using the universal Fc receptor blocking agent (Miltenyi, USA) [23], or the plasma heat inactivated at 56°C for 30 minutes, as described [28].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>THP-1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Retroviral SARS-CoV-2 Spike pseudovirus were generated in 293T cells by co-transfecting expression plasmids containing SARS-CoV-2 Spike and MLV gag/pol and luciferase vectors using Calphos transfection kit (Takara Bio, USA) as described [20].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: KCB Cat# KCB 200744YJ, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, pseudovirus were incubated for one hour with heat inactivated (56 °C for 30 minutes) patient serum prior to infecting 293T-ACE2 cells (kindly provided by A/Prof Jesse Bloom) by a two hour spinoculated at 800xg in 96-well white flat bottom plates in triplicates (Sigma-Aldrich, USA)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Biotinylated recombinant SARS-CoV-2 Spike and RBD proteins: SARS-CoV-2 Wuhan-Hu-1 (GenPept: QJE37812) RBD protein (amino acid residues 319–541) and Spike protein (amino acid residue 15-1213) were cloned into pCEP4 mammalian expression vector containing N-terminal human Ig kappa leader sequence and C-terminal Avi-tag and His-tag (Invitrogen, USA)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCEP4</div><div>suggested: RRID:Addgene_16479)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After a two hours incubation, cells were washed once with 1mL of cold PBS containing 0.5% FBS and 0.005% of sodium azide and gentle centrifugation at 335xg for five minutes at 4°C, fixed in 400μL of 1% paraformaldehyde and kept at 4°C in the dark until acquisition of data using BD FACSCalibur™ Flow cytometer.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BD FACSCalibur™</div><div>suggested: (BD FACSCalibur Flow Cytometry System, RRID:SCR_000401)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A total of 2×104 events were acquired and the proportions of cells that phagocytosed the beads (% of cells that took up the beads) and their fluorescent intensities (amounts of beads taken up per cell) were analysed using BD FlowJo version 10.5.0 software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All the images were Airyscan processed with Zen Black Edition (Zeiss Software).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Zen</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Relative Luminescence Unit (RLU) in cell lysates was measured using CLARIOstar microplate reader (BMG Labtech, Australia), percentage neutralisation of Spike pseudovirus determined and the fifty percent inhibitory (ID50) calculated using non-linear regression model (GraphPad Prism version 9.0) [29]</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Kinetic constants, including association constant (Ka), equilibrium constant (KD) (affinity) and dissociation constant (Ka) (avidity), were calculated using BIAcore evaluation software version 4.1 [30].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BIAcore</div><div>suggested: (Biacore T100 System, RRID:SCR_019679)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: All data were analysed with Prism Software (version 9.0, GraphPad, USA)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.20.21268134: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: The study was reviewed and approved by the Mount Sinai Hospital Institutional Review Board (IRB-20-03374).<br>Consent: All participants signed written consent forms prior to sample and data collection.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">The B.1.1.529 isolate USA/NY-MSHSPSP-PV44488/2021 represents one of the first cases diagnosed in New York State (female, age bracket: 30-40 years, mild COVID-19 symptoms, vaccinated and boosted) in late November 2021.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">All samples were analyzed in a blinded manner.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 2-hour incubation, plates were washed three times with PBS-T and 50 μl/well of the pre-diluted secondary antibody anti-human IgG (Fab-specific) horseradish peroxidase (HRP) antibody (produced in goat; Sigma-Aldrich, Cat# A0293, RRID: AB_257875) diluted 1:3,000 in PBS-T containing 1% milk powder were added.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG</div><div>detected: (Sigma-Aldrich Cat# A0293, RRID:AB_257875)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">During this time the primary antibody was biotinylated according to manufacturer protocol (Thermo Scientific EZ-Link NHS-PEG4-Biotin).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NHS-PEG4-Biotin</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Blocking solution was removed and 100 μl/well of biotinylated mAb 1C7C723, a mouse anti-SARS nucleoprotein monoclonal antibody generated at the Center for Therapeutic Antibody Development at The Icahn School of Medicine at Mount Sinai ISMMS (Millipore Sigma, Cat# ZMS1075) at a concentration of 1μg/ml in PBS, 1% BSA was added for 1 hour at RT.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">FreeStyle™ 293-F cells (Gibco, #R79007) were cultured in ESF-SFM medium (Expression Systems, cat. no. 98-001) supplemented with 100 U/ml penicillin and 100 μg/ml streptomycin (Gibco, #15140122).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293-F</div><div>suggested: RRID:CVCL_6642)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Supplemental Table 3 summarizes the amino acid substitutions, insertions and deletions in the spike region of each of the three viral isolates Viruses were grown by adding 200ul of viral transport media from the nasopharyngeal swabs to Vero-E6-TMPRSS2 cells in culture media supplemented with 0.5 μg/ml amphotericin B (Gibco, # 15290-018).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6-TMPRSS2</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The proteins were cloned into a mammalian expression vector, pCAGGS as described earlier19,20 and purified after transient transfections with each respective plasmid.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAGGS</div><div>suggested: RRID:Addgene_127347)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">21,22 The NTD protein constructs (residues 1-306) were cloned into pVRC8400 expression vector between SalI and NotI endonuclease restriction sites yielding an NTD with an human rhinovirus (HRV) 3C protease-cleavable C-terminal hexahistidine and a streptavidin-binding protein tags.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pVRC8400</div><div>suggested: RRID:Addgene_63163)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Analysis was performed using Prism 7 software (GraphPad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.16.473063: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: Mouse work was approved by the QIMR Berghofer Medical Research Institute animal ethics committee (P3600, A2003-607).<br>Euthanasia Agents: For intrapulmonary inoculations, mice were anesthetized using isoflurane.<br>Field Sample Permit: All infectious SARS-CoV-2 work was conducted in a dedicated suite in a biosafety level-3 (PC3) facility at the QIMR Berghofer MRI (Australian Department of Agriculture, Water and the Environment certification Q2326 and Office of the Gene Technology Regulator certification 3445).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Mouse intrapulmonary SARS-CoV-2 infection: Female C57BL/6J mice (∼ 6 months old at the time of infection) were purchased from Animal Resources Centre (Canning Vale, WA, Australia).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Contamination: Cells were routinely checked for mycoplasma (MycoAlert Mycoplasma Detection Kit MycoAlert, Lonza) and FCS was assayed for endotoxin contamination before purchase (55).</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Immunohistochemistry for SARS-CoV-2 antigen was undertaken using mouse anti-SARS-CoV-2 spike monoclonal antibody 1E8 (Hobson-Peters et al. in preparation) as described previously (2).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines and SARS-CoV-2 culture: Vero E6 (C1008, ECACC, Wiltshire, England; obtained via Sigma Aldrich, St. Louis, MO, USA), Lenti-X 293T (Takara Bio), AE17 (a gift from Dr Delia Nelson, Faculty of Health Sciences, Curtin Medical School), NIH-3T3 (American Type Culture Collection, ATCC, CRL-1658), LLC-PK1 (a gift from Prof. Roy Hall, UQ), A549 (ATCC CCL-185) and HeLa (ATCC-CLL 2) cells were cultured in medium comprising DMEM for Lenti-X 293T and A549 cells, M199 for LLC-PK1 cells or RPMI1640 for all others (Gibco) supplemented with 10% fetal calf serum (FCS), penicillin (100□IU/ml)/streptomycin (100□μg/ml) (Gibco/Life Technologies) and L-glutamine (2 mM) (Life Technologies).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NIH-3T3</div><div>suggested: ATCC Cat# CRL-1658, RRID:CVCL_0594)</div></div><div style="margin-bottom:8px"><div>HeLa</div><div>suggested: RRID:CVCL_JQ54)</div></div><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>LLC-PK1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">100 µl of serially diluted samples were added to Vero E6 cells and the plates cultured for 5 days at 37°C and 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After one passage in HEK293T-mACE2 cells, supernatant was used to infect new HEK293T-mACE2 cells for 2 hrs, then inoculum was removed and cells were washed 3 times with PBS and media replaced.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T-mACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For growth kinetics experiments, HEK293T, HEK293T-hACE2 and HEK293T-mACE2, NIH-3T3, AE17, A549, HeLa or LLC-PK1 cells were infected with SARS-CoV-2 (QLD02, MA1, MA2, Alpha or Beta) at MOI 0.1 for 1 hr at 37°C, cells were washed with PBS and media replaced.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Analysis of RNA-Seq data from cell lines: Raw data (fastq files) from RNA-Seq of HEK293T, HeLa, 3T3, A549, A549 + influenza, Caco2 and Calu3 cells was obtained from the Sequence Read Archive (SRA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco2</div><div>suggested: CLS Cat# 300137/p1665_CaCo-2, RRID:CVCL_0025)</div></div><div style="margin-bottom:8px"><div>Calu3</div><div>suggested: BCRJ Cat# 0264, RRID:CVCL_0609)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Suspension cell infection and crystal violet statining: HEK293T or HEK293T-hACE2 cells were detached using trypsin (ThermoFisher scientific), TrypLE (ThermoFisher scientific), citric saline (135 mM KCl, 15 mM sodium citrate), or by mechanically detaching in culture media using a serological pipette.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>HEK293T-hACE2</div><div>suggested: RRID:CVCL_A7UK)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines and SARS-CoV-2 culture: Vero E6 (C1008, ECACC, Wiltshire, England; obtained via Sigma Aldrich, St. Louis, MO, USA), Lenti-X 293T (Takara Bio), AE17 (a gift from Dr Delia Nelson, Faculty of Health Sciences, Curtin Medical School), NIH-3T3 (American Type Culture Collection, ATCC, CRL-1658), LLC-PK1 (a gift from Prof. Roy Hall, UQ), A549 (ATCC CCL-185) and HeLa (ATCC-CLL 2) cells were cultured in medium comprising DMEM for Lenti-X 293T and A549 cells, M199 for LLC-PK1 cells or RPMI1640 for all others (Gibco) supplemented with 10% fetal calf serum (FCS), penicillin (100□IU/ml)/streptomycin (100□μg/ml) (Gibco/Life Technologies) and L-glutamine (2 mM) (Life Technologies).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2 culture: Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">K18-hACE2 mice (strain B6.Cg-Tg(K18-ACE2)2Prlmn/J, JAX Stock No: 034860) (57) were purchased from The Jackson Laboratory, USA, and bred and maintained in-house at QIMRB as heterozygotes by crossing with C57BL/6J mice.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>K18-hACE2</div><div>suggested: RRID:IMSR_GPT:T037657)</div></div><div style="margin-bottom:8px"><div>B6.Cg-Tg(K18-ACE2)2Prlmn/J</div><div>suggested: RRID:IMSR_JAX:034860)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">mACE2-hACE2 mice were created by Phenomics Australia/Monash Genome Modification Platform, and bred and maintained in-house at QIMRB as heterozygotes by crossing with C57BL/6J mice.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57BL/6J</div><div>suggested: RRID:IMSR_JAX:000664)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 passaging in hACE2 and mACE2 co-cultures: Lentivirus encoding hACE2, mACE2 or mACE2-N31K/H353K was produced in HEK293T cells by plasmid transfection and was used to transduce HEK293T cells, as described previously (2).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>hACE2</div><div>suggested: RRID:Addgene_1786)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The quality of raw sequencing reads was assessed using FastQC (58) (v0.11.80), and trimmed using Cutadapt (59) (v2.3) to remove adapter sequences and low-quality bases.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FastQC</div><div>suggested: (FastQC, RRID:SCR_014583)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SAMtools mpileup was used to produce a consensus sequence from mapped reads (62).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SAMtools</div><div>suggested: (SAMTOOLS, RRID:SCR_002105)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Analysis of RNA-Seq data from cell lines: Raw data (fastq files) from RNA-Seq of HEK293T, HeLa, 3T3, A549, A549 + influenza, Caco2 and Calu3 cells was obtained from the Sequence Read Archive (SRA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Sequence Read Archive</div><div>suggested: (DDBJ Sequence Read Archive, RRID:SCR_001370)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2-3 samples from the control experimental groups from at least two studies per cell line were analyzed as follows: Fastq files were trimmed of adapter sequences using Cutadapt, mapped to the human reference genome GRCh38 or the mouse reference genome GRCm39 using STAR aligner and TPM normalized gene counts were generated using RSEM.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Cutadapt</div><div>suggested: (cutadapt, RRID:SCR_011841)</div></div><div style="margin-bottom:8px"><div>STAR</div><div>suggested: (STAR, RRID:SCR_004463)</div></div><div style="margin-bottom:8px"><div>RSEM</div><div>suggested: (RSEM, RRID:SCR_013027)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">PyMOL v4.60 (Schrodinger) was used for mutagenesis of the crystal structure of SARS-CoV-2 spike bound with ACE2 from the protein data bank (7DF4) (64).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMOL</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Slides were scanned using Aperio AT Turbo (Aperio, Vista, CA USA) and analyzed using Aperio ImageScope software (LeicaBiosystems, Mt Waverley, Australia) (v10) and the Positive Pixel Count v9 algorithm.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageScope</div><div>suggested: (ImageScope, RRID:SCR_014311)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Automatic quantitation of white space was undertaken using QuPath v0.2.3 (65).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>QuPath</div><div>suggested: (QuPath, RRID:SCR_018257)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistics: Statistical analyses of experimental data were performed using IBM SPSS Statistics for Windows, Version 19.0 (IBM Corp., Armonk, NY, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SPSS</div><div>suggested: (SPSS, RRID:SCR_002865)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      A potential limitation of these mouse adapted SARS-CoV-2 viruses is deletion of the QTQTN furin cleavage site flanking sequence, which impairs S1/S2 cleavage by furin (47). Prior S1/S2 cleavage is required for S2’ cleavage by transmembrane protease serine 2 (TMPRSS2) at the cell surface, which is important for entry in TMPRSS2 positive cells. The QTQTN deletion commonly arises after virus propagation in TMPRSS2 negative cell lines (such as Vero E6 and HEK293T), although this deletion is also evident in some human clinical samples (47). This deletion improves cleavage by Cathepsin L, which substitutes for TMPRSS2 by cleaving S2’ in endosomes and releasing viral RNA into the cytoplasm (48). Other studies have shown that deletion of the furin cleavage site attenuates replication in hamsters and K18-hACE mice (49) and reduces transmission in ferrets (50). Our data suggests that this deletion didn’t dramatically affect mouse adapted virus replication or tropism in C57BL/6J mouse lungs compared to other studies (11), although side-by-side comparison with virus containing the same spike amino acid changes as MA1 and MA2 but maintaining furin cleavage would be needed to determine if there is any attenuation. The D614G change, which is present in all SARS-CoV-2 variants (except the ancestral Wuhan strain), also increases virus stability and entry via the cathepsin L route (48). Cathepsin L is widely expressed in human nasal and lung epithelial cells (48), thus our mouse adapted viruse...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.18.473309: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">In this first 2-cycle PCR amplification, the forward and reverse primers were attached to barcodes consists of 15 randomized nucleotides as the Unique Identifier (UID), plus four tri-nucleotides designating four different experimental conditions: TGA for A1+A1CF; CAT for A3A; GTC for A3G; and ACG for Ctrl</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, anti-HA mAb (HA.C5, Abcam, 1:3,000), and anti-α-tubulin mAb from mouse (GT114, GeneTex, 1:5,000) as primary antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-HA</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-α-tubulin</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>GT114</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cy3-labelled goat-anti-mouse mAb (PA43009, GE Healthcare, 1:3,000) was subsequently used as a secondary antibody.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>mAb</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Lentivirus was produced by lentiviral vector system pLVX-TetOne-Puro (Clon-tech) in HEK293T cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: KCB Cat# KCB 200744YJ, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The Caco-2 stable cell lines were generated by transducing with the lentivirus for 24 hrs and selected with 5 µg/ml of puromycin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For SARS-CoV-2 propagation, Vero E6-hACE2 cells were used.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6-hACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To assess the effect of APOBEC (A1+A1CF, A3A, and A3G) on SARS-CoV-2 RNA replication, the Caco-2-APOBEC stable cells (about 2× 105 cells) were plated in 12-well plates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco-2-APOBEC</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To assess the effect of APOBEC (A1+A1CF, A3A, and A3G) on SARS-CoV-2 viral progeny production, plaque assay on Vero E6-hACD2 cells was used.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6-hACD2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Lentivirus was produced by lentiviral vector system pLVX-TetOne-Puro (Clon-tech) in HEK293T cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLVX-TetOne-Puro</div><div>suggested: RRID:Addgene_124797)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The cells were then co-transfected with lentiviral packaging vectors, 1.0 μg of pdR8.91 (Gag-Pol-Tat-Rev, Addgene), 0.5 μg of pMD2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pMD2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">G (VSV-G, Addgene), and 1.7 μg of the pLVX-TetOne-Puro vector encoding the APOBEC proteins, using 20 μL of X-tremeGENE 9 transfection reagent (Sigma).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VSV-G</div><div>suggested: RRID:Addgene_138479)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">We wrote Python scripts to analyze the sequencing data.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.20.473401: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: Experiments involving animals were conducted using protocols approved by the National Research Council Canada Animal Care Committee and in accordance with the guidelines set out in the OMAFRA Animals for Research Act, R.S.O. 1990, c. A.22. b)<br>IACUC: Experiments involving animals were conducted using protocols approved by the National Research Council Canada Animal Care Committee and in accordance with the guidelines set out in the OMAFRA Animals for Research Act, R.S.O. 1990, c. A.22. b)</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">The denatured-induced unfolding of VHHs was considered to be reversible based on their small size as shown to be the case for small proteins and numerous times for VHHs 56–59, 88, 89. d) Serum stability: Three female Syrian hamsters were injected intraperitoneally (IP) with 1 mg of 1d or VHH-72 VHH-Fc diluted in 200 µL PBS.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Reactions were stopped by adding 50 µL 1 M H2SO4 to wells, and absorbance were subsequently measured at 450 nm using a Multiskan™ FC photometer (Thermo Fisher). b) Binding to cognate anti-spike glycoprotein polyclonal antibody: The four spike glycoprotein antigens were passively adsorbed as described above.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-spike glycoprotein</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After blocking with PBSC, wells were emptied, washed five times with PBST and incubated at room temperature for 1 h with 100 µL of 1 µg/mL anti-SARS-CoV-2 spike rabbit polyclonal antibody (Sino Biological, Beijing, China, Cat#40589-T62) in PBSCT.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Following 1 h incubation at room temperature, wells were washed 10 times with PBST and incubated with HRP-conjugated polyclonal goat anti-llama IgG heavy and light chain antibody (Bethyl Laboratories, Montgomery, TX, Cat#A160-100P) for 1 h at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-llama IgG heavy and light chain</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To determine the presence of antibodies that block the binding of S to ACE2 (surrogate for neutralization) in the immune sera of llamas, 400 ng of chemically biotinylated SARS-CoV-2 S was mixed with 1 × 105 Vero E6 cells in the presence of 2-fold dilutions of sera (pre immune, day 21 and day 28 sera) in a final volume of 150 µL.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then plates were washed 10 times with PBST and binding of VHHs to S1-Fc was detected with rabbit anti-6xHis Tag antibody HRP Conjugate (Bethyl Laboratories, Cat#A190-114P), diluted at 10 ng/mL in PBST and added at 100 µL/well.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-6xHis</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 1 h incubation at room temperature, strips were washed 10 times with PBST and the binding of VHH-Fcs to denatured S was probed by incubating strips with 1 mL of 100 ng/mL anti-human Ig Fc antibody-peroxidase conjugate (Jackson ImmunoResearch, Cat#016-030-084) at room temperature for 1 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human Ig Fc antibody-peroxidase conjugate</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 1 h incubation at room temperature, plates were washed 10 times with PBST and the ACE2-Fc binding was detected using 1 µg/mL goat anti-human IgG (Fc specific) HRP conjugate antibody (Sigma, Cat#A0170) in 100 µL PBSCT.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: (Sigma-Aldrich Cat# A0170, RRID:AB_257868)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Immune cell infiltrate was detected using rabbit polyclonal antibodies against CD3 (1:500, Dako, Cat#A0452), and Iba-1 (ionized calcium binding adaptor protein, 1:5000, Dako, Cat#019-19741)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD3</div><div>suggested: (Agilent Cat# A0452, RRID:AB_2335677)</div></div><div style="margin-bottom:8px"><div>Iba-1 ( ionized calcium binding adaptor protein</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mouse anti-SARS-CoV-2 N monoclonal antibody (1:5000, R&D Systems, Cat#MAB10474) was used for the detection of SARS-CoV-2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Mouse anti-SARS-CoV-2 N monoclonal antibody</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 N</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Conversely, a binding response was seen during the second injection for VHHs that did not compete with ACE2. c) ACE2 competition assay by flow cytometry: Experiments were performed as described in 4.3c, except that biotinylated S/Vero E6 cells were mixed with VHHs or VHH-Fcs instead of sera.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>S/Vero E6</div><div>suggested: RRID:CVCL_JX48)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudotyped and live virus neutralization assays: a) Pseudotyped virus neutralization assays: (i) Generation of SARS-CoV-2 spike pseudotyped lentiviral particles (LVP): HEK293T cells were plated in a 100-mm tissue culture dish and transfected the next day at about 75% confluency with a combination of a lentiviral transfer vector encoding eGFPLuc (addgene#119816), the packaging plasmid psPAX2 (addgene#12260), and a plasmid encoding the viral glycoprotein of interest SARS-CoV-2 Spike-ΔS1/S2-Δ20 expressed in pcDNA3.1+.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The pellet was then resuspended in PBS buffer at 1/10 of the original supernatant volume with gentle up-and-down pipetting, aliquoted and stored at −80°C. (ii) Viral neutralization assays: HEK293T-hACE2 cell line (BEI Resources, Manassas, VA, Cat#NR-52511) were seeded in poly-L-Lysine (PLL)-coated white, clear bottom 384-wells plate (NUNC, Thermo Fisher) at a density of 9,000 cells/well in 45 µL of media (DMEM without phenol red supplemented with 5% [v/v] FBS) and incubated for 24 h at 37°C, 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T-hACE2</div><div>suggested: RRID:CVCL_A7UK)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Quantitative microneutralization assay was performed on Vero E6 cells with SARS-CoV-2 strains hCOV-19/Canada/ON-VIDO-01/2020, NR-53565; hCOV- 19/England/204820464/2020, NR-54000; or hCOV-19/South Africa/KRISP-EC-K005321 /2020, NR-54008.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Virus titer was determined by plaque assay on Vero cells. b) Immunohistochemistry: Lungs were immersed in 10% neutral buffered formalin and fixed for 1 week at room temperature and then transferred into 70% ethanol.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">VH/VHH genes were amplified using semi-nested PCR and cloned into the phagemid vector pMED1, followed by transformation of E. coli TG1 (Lucigen, Middleton, WI, Cat#60502-02) to construct two libraries with sizes of 1 × 107 and 2 × 107 independent transformants for Green and Red, respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pMED1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Expression and purification of VHHs and VHH-Fcs: a) Expression and validation of VHHs: Positive VHHs were cloned into a modified pET expression vector (pMRo.BAP.H6) for their production in BL21(DE3) E.coli as monomeric soluble protein 84.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pET</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pMRo.BAP.H6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For the VHH-72 benchmark 29, the sequence of the VHH was synthesized as a GeneBlock (Integrated DNA Technologies, Coralville, IA) flanked by SfiI sites for cloning into pMRo.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pMRo</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Production of VHHs in mammalian cells in fusion with human IgG1 Fc (VHH-Fcs): Codon-optimized genes for bivalent VHH-Fcs were synthesized and cloned into pTT5 (GenScript; Piscataway, NJ.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pTT5</div><div>suggested: RRID:Addgene_52326)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudotyped and live virus neutralization assays: a) Pseudotyped virus neutralization assays: (i) Generation of SARS-CoV-2 spike pseudotyped lentiviral particles (LVP): HEK293T cells were plated in a 100-mm tissue culture dish and transfected the next day at about 75% confluency with a combination of a lentiviral transfer vector encoding eGFPLuc (addgene#119816), the packaging plasmid psPAX2 (addgene#12260), and a plasmid encoding the viral glycoprotein of interest SARS-CoV-2 Spike-ΔS1/S2-Δ20 expressed in pcDNA3.1+.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>psPAX2</div><div>suggested: RRID:Addgene_12260)</div></div><div style="margin-bottom:8px"><div>pcDNA3.1+</div><div>suggested: RRID:Addgene_117272)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After a final wash, cells were resuspended in 100 µL PBSB and data were acquired on a CytoFLEX S flow cytometer (Beckman Coulter, Brea, CA) and analyzed by FlowJo software (FlowJo LLC, v10.6.2</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Proteins were buffer exchanged using Amicon® Ultra-15 Centrifugal Filter Units (Millipore-Sigma</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Millipore-Sigma</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">IC50 was determined from non-linear regression [Inhibitor] vs. response, Variable slope (four parameters) using GraphPad Prism version 9 (La Jolla, CA). 4.11.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.16.472155: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Mouse studies: Ethical approval: All the experimental procedures were performed in accordance with the guide for the use of laboratory animals of the University of Sao Paulo and approved by the institutional ethics committee under the protocol number 105/2021. SARS-CoV-2: SARS-CoV-2 was isolated from a COVID-19 positive-tested patient.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">SARS-CoV-2 experimental infection and treatments: Female K18-hACE2 mice, aged 8 weeks, were infected with 2×104 PFU of SARS-CoV-2 (in 40 μL) by intranasal route.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">A total of 10 photomicrographs in 40X magnification per animal were randomly obtained using a microscope Novel (Novel L3000 LED, China) coupled to a HDI camera for images capture.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Expression and purification of Spike RBD of SARS-CoV-2: A codon-optimized gene encoding for SARS-CoV-2 (331 to 528 amino acids, QIS60558.1) was expressed in Expi293 cells (Thermo Fisher Scientific) with human serum albumin secretion signal sequence and fusion tags (6xHistidine tag, Halo tag, and TwinStrep tag) as described before 1.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Expi293</div><div>suggested: RRID:CVCL_D615)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HUVEC single cell donor (Lonza, cat#C2517A) cells were transduced at room temperature with ACE2 using a BacMam viral vector at a concentration of 2e9 VG/ml (Montana Molecular #C1120G Pseudo SARS-CoV-2 D614G Green Reporter) followed by incubation at 36°C for 24 hours.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HUVEC</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-Cov-2 tested in A549-ACE2 cells: A549-ACE2 cells were plated in Corning black walled clear bottom 96 well plates 24 hours before infection for confluency.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549-ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-Cov-2 tested in Calu-3 cells: Calu-3 (ATCC, HTB-55) cells were pretreated with test compounds for 2 hours prior to continuous infection with SARS-CoV-2 (isolate USA WA1/2020) at a MOI=0.5.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: ATCC Cat# HTB-55, RRID:CVCL_0609)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Supernatant from the Caco-2 cells are collected on day 3 post-infection and titrated on Vero 76 cells for virus titer as before.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Vero 76</div><div>suggested: KCLB Cat# 21587, RRID:CVCL_0603)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HCoV 229E antiviral assay: HCoV 229E, (a gift from Ralph Baric, UNC, Chapel Hill) was propagated on Huh-7 cells and titers were determined by TCID50 assay on Huh-7 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Huh-7</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The virus was propagated and titrated in Vero E6 cells in a biosafety level 3 laboratory (BSL3) at the Ribeirao Preto Medical school (Ribeirao Preto, Brazil).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Penicillin 10,000 U/mL; Streptomycin10,000 μ Vero cells in DMEM (FBS 2%) incubated at 37 °C with 5% CO2 for 48 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">K18-hACE2 mice: To evaluate the effects of vandetanib in vivo, we infected the K18-hACE2 humanized mice (B6.Cg-Tg(K18-ACE2)2Prlmn/J)7, 8, 9.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>B6.Cg-Tg(K18-ACE2)2Prlmn/J)7</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">K18-hACE2 mice were obtained from The Jackson Laboratory and were breed in the Centro de Criação de Animais Especiais</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>K18-hACE2</div><div>suggested: RRID:IMSR_GPT:T037657)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">MHV-A59 with nano-Luciferase: The MHV-A59 G plasmid was engineered to replace most of the coding sequence for orf4a and 4b with nano-luciferase (nLuc).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>The MHV-A59 G</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A sequence verified G-nLuc plasmid was used with MHV-A59 wild type A, B, C, D, E and F plasmids to recover virus expressing nLuc, using our previously described molecule clone (Systematic assembly of a full-length infectious cDNA of mouse hepatitis virus strain A59 4.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>G-nLuc</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The total septal area and total area were analyzed with the aid of the Pro Plus 7 software (Media Cybernetics, Inc., MD, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Pro Plus</div><div>suggested: (Image-Pro Plus, RRID:SCR_016879)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr style="background-color:#FF0000"><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT0427541464</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Trial number did not resolve on clinicaltrials.gov. Is the number correct?</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NA</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.17.473223: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: Surviving subjects signed informed consent to participate in this study while samples and metadata from subjects who died or were incapacitated were de-identified and included in this study.<br>IRB: The study protocol was approved by the Institutional Review Board of New York University. Cell Culture and lentivirus production: A549 cells were purchased from ATCC.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Authentication: Wells were fixed by submerging in 10% formalin for 24 h and washed three times with PBS before analysis by immunofluorescence.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were permeabilized with 0.1% Triton-X 100, blocked with 1% BSA/PBS and stained for SARS-CoV-2 N mouse monoclonal SARS-CoV-2 anti-N antibody 1C7 (1:1000, kind gift of Thomas Moran) overnight at 4°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-N</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cultures were stained with anti-SARS nucleocapsid protein antibody which cross reacts with SARS-CoV-2 N (1:1000, cat. no. 200-401-A50; Rockland) and goat-anti-rabbit Alexa Fluor 488 and DAPI.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS nucleocapsid protein</div><div>suggested: (LSBio (LifeSpan Cat# LS-C75706-1000, RRID:AB_10636665)</div></div><div style="margin-bottom:8px"><div>Alexa Fluor 488</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Flow Cytometry: Exosomes pellets were stained with 100μl of an antibody cocktail in 1X PBS (Corning) containing anti-CD9 (human HI9a, mouse MZ3), anti-CD63 (human H5C6, mouse NVG-2), anti-CD81 antibodies (human 5a6, mouse Eat-2) from Biolegend, and anti-human ACE2 (R&D Biosystems cat no. FABAF9332R) at 1:100 for 1hr at 4°C, rocking.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-CD9</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-CD63</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-CD81</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Grids were permeabilized and blocked with 0.1% Saponin/1% cold-water fish skin gelatin (Perm buffer) for 10 min and first stained with anti-human CD63 (Abcam, ab59479) antibody (1:10) in Perm buffer for 1.5hr.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human CD63</div><div>suggested: (Abcam Cat# ab59479, RRID:AB_940915)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Grids were washed 6x with PBS with 0.1% Saponin for 2 min, and then incubated with 18nm gold conjugated anti-mouse antibody (18nm colloidal gold AffiniPure goat anti-mouse IgG (H+L), Jackson ImmunoResearch Laboratories, Inc., West Grove, PA), in Perm buffer for 30min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>30min</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The grids were incubated with anti-NP antibody (1:100) in perm buffer for 1.5 hr followed by anti-mouse Fab’ nanogold (1:250</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-NP</div><div>suggested: (LSBio (LifeSpan Cat# LS-C145152-100, RRID:AB_10972206)</div></div><div style="margin-bottom:8px"><div>anti-mouse</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A549ACE2 cells were generated using lentiviral transduction of a human ACE2 cDNA expressing plasmid (backbone: pLV-EF1a-IRES-Puro (Addgene 85132) as previously described [31].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">1mL lentivirus was used to transduce A549 cells using Polybrene (Millipore).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549</div><div>suggested: NCI-DTP Cat# A549, RRID:CVCL_0023)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Confluent Vero cells were then infected with this exosome-virus mixture.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: CLS Cat# 605372/p622_VERO, RRID:CVCL_0059)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The third wash was collected and stored at −80°C for titration by plaque assay on Vero E6 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A549ACE2 cells were generated using lentiviral transduction of a human ACE2 cDNA expressing plasmid (backbone: pLV-EF1a-IRES-Puro (Addgene 85132) as previously described [31].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLV-EF1a-IRES-Puro</div><div>suggested: RRID:Addgene_85132)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">TLR7+ A549 were generated by lentiviral transduction of pcDNA3-TLR7-YFP (a gift from Doug Golenbock (Addgene plasmid # 13022; http://n2t.net/addgene:13022; RRID:Addgene_13022)).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_13022)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">psPAX2 was a gift from Didier Trono (Addgene plasmid # 12260)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>psPAX2</div><div>suggested: RRID:Addgene_12260)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Micrographs were collected using Leginon [58, 59] at a dose rate of 11.21 e-/Å2/s with a total exposure of 3.50 seconds, for an accumulated dose of 39.23 e-/Å2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Leginon</div><div>suggested: (Leginon, RRID:SCR_016731)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Frames were aligned using Motioncor2 [60].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Motioncor2</div><div>suggested: (MotionCor2, RRID:SCR_016499)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Tilt series were collected using SerialEM [61] at a dose rate of 11.21 e-/Å2/s with a total exposure of 0.25 second for an accumulated dose of 2.79 e-/Å2 per tilted image.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SerialEM</div><div>suggested: (SerialEM, RRID:SCR_017293)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Tilt series processing: Frames were aligned using Warp [62], binned to the physical pixel size of 1.408 Å, and constructed into a tilt series stack for further processing.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Warp</div><div>suggested: (Warp, RRID:SCR_018071)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Denoised tomograms were inspected using IMOD [65] and clipped to appropriate size.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IMOD</div><div>suggested: (IMOD, RRID:SCR_003297)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Movies were made from selected tomograms using ImageJ.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical Analyses: Statistical analyses were performed using GraphPad Prism 9.0 (GraphPad Software, San Diego, California USA; https://www.graphpad.com/).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.15.472838: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: All animal experiments were approved by the Animal Experiments Committee of LUMC and performed according to the recommendations and guidelines set by LUMC and by the Dutch Experiments on Animals Act.<br>Euthanasia Agents: K18-hACE2 transgenic mice were anaesthetized with isoflurane gas and intranasally infected with 5 × 103 plaque forming units (PFU) of SARS-CoV-2 in a total volume of 50 μl DMEM.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">At the start of the experiments, male and female mice were 6-8 weeks old.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antigen-binding ELISA: ELISAs were performed to determine antibody titers in sera.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Antigen-binding ELISA</div><div>suggested: (Ling-Chu Hung / Animal Health Research Institute, Council of Agriculture, Executive Yuan, Taiwan Cat# 12-Hung-03 m& 20 ORF3 7D3, RRID:AB_2827541)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were again washed and then incubated with 1:4000 dilution of horse radish peroxidase (HRP) conjugated antimouse IgG secondary antibody (SouthernBiotech, cat. 1030-05) and incubated for 1h at RT.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antimouse IgG</div><div>suggested: (Roche Cat# 760-500, RRID:AB_2753116)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Flow cytometry: Fluorescently labelled antibodies against the following mouse antigens were used: CD3 (clone 145-2C11, BD Biosciences),</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mass cytometry and analysis: Metal-conjugated antibodies were either purchased from Fluidigm or were generated by conjugation of lanthanide metal isotopes to anti-mouse antibodies using the Maxpar X8 Polymer method according to the manufacturer’s protocol (Fluidigm).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-PE and anti-APC were added and incubated for 45 minutes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-PE</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Thereupon, 2 × 104 Vero-E6 (ATCC CRL-1586) cells that were seeded in 96-well plates were inoculated with serum and virus.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mice: Wild-type C57BL/6 mice were obtained from Charles River Laboratories, Jackson Laboratory or Janvier Labs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57BL/6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The K18-hACE2 transgenic mice, expressing the human ACE2 receptor (hACE2) under control of the cytokeratin 18 (K18) promoter (41), were obtained from the Jackson Laboratory (B6.Cg-Tg(K18-ACE2)2Prlmn/J), and bred in-house.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>B6.Cg-Tg(K18-ACE2)2Prlmn/J)</div><div>suggested: RRID:IMSR_JAX:034860)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">K18-hACE2 transgenic mice were anaesthetized with isoflurane gas and intranasally infected with 5 × 103 plaque forming units (PFU) of SARS-CoV-2 in a total volume of 50 μl DMEM.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>K18-hACE2</div><div>suggested: RRID:IMSR_GPT:T037657)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Adoptive T cell transfers: Spleens of OT-I Hobit reporter × ROSA26-eYFP LT mice were isolated and subsequently CD8+ T cells were isolated by negative selection using MicroBeads (130-104-075, Miltenyi Biotec) according to the manufacturer’s protocol.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ROSA26-eYFP LT</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Subsequently, MHC class I tetramer-specific CD8+ T cells were selected in FlowJo for subsequent analysis.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Using FlowSOM, 14 clusters were identified per analysis.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowSOM</div><div>suggested: (FlowSOM, RRID:SCR_016899)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Statistical analyses were performed using Cytofast or GraphPad Prism (La Jolla, CA, Unites States).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      1. General Statements

      We thank the reviewers for their helpful comments. We believe that we will be able to address all of their concerns and suggestions. We have highlighted our responses in the revision plan and the changes we have already made to the manuscript in blue text. For figures where we have added data or analyses at the request of reviewers, we have highlighted the corresponding text in the figure legends.

      2. Description of the planned revisions

      Reviewer #1

      2- In Figure 4, the two mutations appear to have statistically differential effects on Rab5 and Rab7 puncta even though the data mean and distribution seem very similar. Interestingly, in each case the non-significant effect is associated with a smaller sample size. Given that the overall sample sizes used are rather small for such highly variable data, this could easily cause a statistical anomaly due to sampling bias. The sample size should be made uniform across all genotypes and should ideally be at least doubled.

      We will repeat this staining to increase the n to at least double this number, and adjust our conclusions if need be, in the revised manuscript..

      3- Perhaps the most important issue related to Figure 6 where the authors find that there is no sterol accumulation at 96h APF in the Vps50 mutant. However, even that the dendritic phenotype is slower to appear in this mutant compared to the Vps54, are the authors sure that the accumulation is not just slower? This should be examined using the same temporal sequence used for Vps54 shown in Future 6 C. In addition, the fact that sterol accumulation returns to normal in the Vps54 mutant at 1 day, supports the notion of a delay phenotype (see point 1 above). These issues should be experimentally addressed to see if the data fully support the initial conclusions, or if the conclusions should be modified to suggest differential contribution of the two complexes to the process being studied and to a developmental delay phenotype.

      We had included the filipin staining for Vps50KO/KO at 1 day in Figure S4 A (which did not show a significant difference from control). We did not collect data for this genotype at 72hrs APF because the dendritic length phenotype didn’t appear until later, and so we did not include Vps50KO/KO in the full time-course in Fig 6 C. We will collect additional data so that we can include Vps50KO/KO at all timepoints in this figure in the revised manuscript.

      . Reviewer #2

      It is stated that loss of VPS50 and VPS54 only causes dendrite morphogenesis defects. However, the corresponding supplemental figure S2c (which is not referenced in the text), is not suited to address this question. Axonal arborization, in particular terminal arbors, are not visible in samples where multiple/all c4da axons are labeled simultaneously (Fig. S2c). Analogous to the dendrite analysis of c4da neurons single cell resolution is essential to examine this in a meaningful way. Likely, however, c4da neurons may not be a good choice to address this question.

      We should be able to get single cell resolution of the c4da axon terminals using MARCM. We already have two of the knockout lines recombined with FRTs (Vps53 and Vps54) for this analysis and we will make the third recombinant line so that we can use MARCM for all three lines to examine single-cell axon morphology, as suggested.

      Overall, I am concerned whether the data shown here can be generalized. The cd4a neurons are rather extreme cell types due to their very large dendritic compartment. It seems quite possible that many other neurons may not have a comparable sensitivity to the supply of lipids/sterols. This type of question can only be addressed if other types of neurons/dendrites are examined. Are class 2 or class 3 da neurons showing any defects in VPS mutants?

      Given that we see the phenotype emerge during the pupal stage, we want to analyze neurons that persist from the larval to adult stages. However, not all of the dendritic arborization neurons survive into adulthood- class I and II persist, while class III die during metamorphosis (Shimono et al., 2009). As we do not have adequate tools to for studying the class II neurons, we will examine dendrite morphology of the class I neurons in larvae and adults in our knockout lines. We would be happy to look at class III neurons at the reviewers request, but our analysis will necessarily be limited to the larval stage.

      Reviewer #3

      • Some of the experiments include multiple genotypes and so it would be important to show all in all figures. For example, figure 4B,D show four groups but figure 4F, presumably from the same set of animals, shows only three. Addition of the rescue genotype to 4F is particularly important here so should be shown. The same concern is valid for figure 5, where puncta number and area must be available.

      The data from Fig. 4 F (using a genetically encoded marker for lysosomes, UAS-spin-RFP) are not from the same samples as Fig. 4 B and D (staining). We did not include the rescue for Fig 4. F because the lysosome marker, the rescue transgenes and the neuronal membrane marker are all on the third chromosome. We will build additional fly stocks so that we can include the rescue in experiments looking at lysosome morphology.

      • This concern is amplified by the images in figure 6 of the filipin staining, that are more obviously perinuclear. However, the two sets of images in 6A and 6D, where co-staining with Golgin245 is shown, look very different. Improved images are required and it may be helpful to use supplementary information to show additional examples of the staining.

      The images in Fig. 6 A are maximum projections of z stacks while Fig. 6 D shows single confocal planes, making it easier to see the perinuclear Golgi ring. Because other reviewers wanted some additional experiments related to Fig. 6 that we plan to incorporate into this figure in the revised manuscript, we will address this comment in a future revision and include additional images in the supplement.

      • For the lipid regulation experiments in figure 7, please use an orthogonal approach to show that the Osbp and fwd RNAi had the expected effects on lipid accumulation.

      In addition to sterol, Osbp and fwd both affect levels of PI4P at the Golgi. We have obtained a transgenic PI4P sensor that we can use to show the effect of these manipulations on this lipid as well.

      3. Description of the revisions that have already been incorporated in the transferred manuscript

      Reviewer #1 While the data presented clearly support a role for GARP in regulating sterol levels to support dendritic growth, they do not inter current for suffice to exclude a role for EARP as important analyses to allow such a clear cut conclusion are either insufficient or missing. If the authors wish to maintain this claim - as suggested by the title of the manuscript - further analyses are essential.

      We don’t mean to argue the EARP complex doesn’t contribute to dendrite development at all – we do show it contributes to development in Fig 3, and as we discuss in the text.. We want to argue that the GARP and EARP complexes contribute to dendrite development by distinct mechanisms. Losing the GARP complex inhibits dendrite development by means of sterol accumulation at the TGN, which is what we are trying to highlight with our title. The reduced dendrite growth that we observe in EARP deficient neurons must occur by some other as yet unknown means. We apologize for the confusion and have reworded the title to read “Sterol accumulates at the trans-Golgi in GARP complex deficient neurons during dendrite remodeling.”

      1- Figure 3E shows that whereas both Vps50 and Vps54 mutations reduce dendritic complexity, the Vps54 phenotype appears earlier (96h APF). Furthermore, at 7 days dendrites appear to grow again but at a slower rate than controls. This begs the question of whether these mutations are causing a delay rather than a block in the regrowth after pruning and whether the growth will eventually be normal a few days later or whether it will stop at some point.

      We have included data for an additional adult timepoint (21 days) in the new Fig. 3 E. We also included graphs in which we show the statistics for each genotype over time (new Fig. S2 D-F), and discuss this analysis in the text (lines 186-195). We have also included a table of the p-values for each comparison in the Supplemental Materials (Table S2). From this analysis, we conclude that there is not a developmental delay in the knockouts, but rather a decrease in growth during the 72-96hrs APF and 1-7 day windows when the control neurons grow. We are unable to draw conclusions about the rate of growth as we analyzed neurons from different samples at each developmental timepoint, and not the same neurons over time.

      Reviewer #2

      It would be important to know, whether the dendrite morphogenesis defect is indeed a developmental patterning defect or rather a "scaling" defect due to the fact that da neurons increase their size (but not necessarily their projection pattern) during larval maturation.

      We have analyzed the larval data for coverage index – neuron area/hemisegment (receptive field) area as defined in (Parrish et al., 2009) to determine if there is a scaling defect at this stage in development. We do not observe a defect in scaling (Fig. S2 C) and discussed in lines 175-182.

      Reviewer #3

      • The statistical analyses generally look appropriate but it would be critical to clarify what N means in every case. For example in figure 2 the authors state n=8 without clarifying if this is n=8 animals or n=8 neurons. N should always be the number of animals, but then the n of independent cells counted should also be indicated. Typically, one would either pre-average per genotype or use a mixed model that includes N of animals and n of cells (or similar).

      For experiments analyzing dendrite morphology, n represents the number of neurons, as we have clarified in our figure legends. As per another reviewer’s request, we will increase the n for the organelle and filipin staining in our planned revision and specify fly and cell number at that time.

      • Please add details of how experiments were blinded to genotype

      The researcher was blinded to genotype during analysis. We have included that detail in our Methods section (line 566).

      • Some of the experiments include multiple genotypes and so it would be important to show all in all figures. For example, figure 4B,D show four groups but figure 4F, presumably from the same set of animals, shows only three. Addition of the rescue genotype to 4F is particularly important here so should be shown. The same concern is valid for figure 5, where puncta number and area must be available.

      We address the first portion of this comment in section 2, for additional experiments involving generating new fly lines. We have included data on puncta area, and mean fluorescence intensity for Rab5 and Rab7 in the supplement (Fig S3). We had already included the data on puncta number and area in Fig 5, but we have added the data on mean fluorescence intensity as well.

      • Related to figure 5, please provide validation of the staining of the TGN. Typically, one would expect trans Golgi to be close to the nucleus with at least some extended stacks. A Golgin245 knockout would be ideal.

      The Golgi in most Drosophila cells is typically found as discrete puncta dispersed throughout the cytosol like what we see in the Golgin245 staining, as opposed to the ribbon “stack of pancake” morphology typically seen near the nucleus in mammalian cells. For reference, please see Figure 6D in (Ye et al., 2007), Figures 2,4,5 in (Rosa-Ferreira et al., 2015), and observations reviewed in (Kondylis and Rabouille, 2009).

      The Golgin245 antibody was well characterized in the paper first describing it (Riedel et al., 2016) (colocalization with other Golgi markers, decreased staining with Golgin245 RNAi), but we would be happy to repeat this validation in the c4da neurons at the reviewer’s request. There do not appear to be Golgin245 mutant or KO lines available, so we would also use the Golgin245 RNAi.

      • For figures 6F, G please show examples of staining for late endosomes and lysosome with appropriate validation.

      Because several of our planned revisions relate to Fig. 6, we will include images for Fig. 6 F and G when we remake this figure to incorporate those planned revisions. To clarify, we used the same reagents to mark late endosomes and lysosomes in both Fig. 4 and Fig. 6. Like the Golgin245 antibody, the Rab7 antibody was developed by the Munro lab and characterized in (Riedel et al., 2016) (partial colocalization with the endosomal marker Hrs and with the lysosomal marker Arl8). Spinster (aka benchwarmer) is a known lysosomal transmembrane protein that colocalizes with Lamp1 (Dermaut et al., 2005; Rong et al., 2011). The fluorescently tagged spin transgenes were developed by the Bellen lab and have been frequently used to mark lysosomes. We would be happy to carry out additional validation experiments at the reviewer’s specification.

      • The title of figure 2 is inaccurate, at least if I understand the experiment, as it does not show neuron-specific knockout but instead whole body knockout with neuron rescue. Please rephrase.

      Because of the lethality of whole body Vps53KO/KO in adult flies, we analyze MARCM clonal neurons that are Vps53KO/KO in flies that are otherwise heterozygous (Vps53KO/+). To clarify this experiment, we have changed the title of Fig. 2 from “Neuron-specific knockout of Vps53 results in smaller dendritic arbors” to “Vps53KO/KO MARCM clonal neurons have smaller dendritic arbors”.

      • Figure 8 needs examples of the TGN and late endosome morphology.

      We have included these images in Figure

      The order appears different in Fig. 4 B & D because we only included the rescue for the KO that shows a phenotype for each staining. The genotypes included in Fig. 4 B are: +/+, Vps50KO/KO, Vps50KO/KO + rescue, and Vps54KO/KO. The genotypes included in Fig. 4 D are +/+, Vps50KO/KO, Vps54KO/KO, Vps54KO/KO + rescue. We have changed the shading of the bars corresponding to these rescue genotypes throughout the manuscript to make it easier to distinguish the two rescue conditions.

      4. Description of analyses that authors prefer not to carry out

      References Cited

      Dermaut, B., K.K. Norga, A. Kania, P. Verstreken, H. Pan, Y. Zhou, P. Callaerts, and H.J. Bellen. 2005. Aberrant lysosomal carbohydrate storage accompanies endocytic defects and neurodegeneration in Drosophila benchwarmer. Journal of Cell Biology. 170:127–139. doi:10.1083/jcb.200412001.

      Kondylis, V., and C. Rabouille. 2009. The Golgi apparatus: Lessons from Drosophila. FEBS Letters. 583:3827–3838. doi:10.1016/j.febslet.2009.09.048.

      Parrish, J.Z., P. Xu, C.C. Kim, L.Y. Jan, and Y.N. Jan. 2009. The microRNA bantam Functions in Epithelial Cells to Regulate Scaling Growth of Dendrite Arbors in Drosophila Sensory Neurons. Neuron. 63:788–802. doi:10.1016/j.neuron.2009.08.006.

      Riedel, F., A.K. Gillingham, C. Rosa-Ferreira, A. Galindo, and S. Munro. 2016. An antibody toolkit for the study of membrane traffic in Drosophila melanogaster. Biology Open. 5:987–992. doi:10.1242/bio.018937.

      Rong, Y., C.K. McPhee, S. Deng, L. Huang, L. Chen, M. Liu, K. Tracy, E.H. Baehrecke, L. Yu, and M.J. Lenardo. 2011. Spinster is required for autophagic lysosome reformation and mTOR reactivation following starvation. Proceedings of the National Academy of Sciences. 108:7826–7831. doi:10.1073/pnas.1013800108.

      Rosa-Ferreira, C., C. Christis, I.L. Torres, and S. Munro. 2015. The small G protein Arl5 contributes to endosome-to-Golgi traffic by aiding the recruitment of the GARP complex to the Golgi. Biology Open. 4:474–481. doi:10.1242/bio.201410975.

      Shimono, K., A. Fujimoto, T. Tsuyama, M. Yamamoto-Kochi, M. Sato, Y. Hattori, K. Sugimura, T. Usui, K. Kimura, and T. Uemura. 2009. Multidendritic sensory neurons in the adult Drosophila abdomen: origins, dendritic morphology, and segment- and age-dependent programmed cell death. Neural Dev. 4:37. doi:10.1186/1749-8104-4-37.

      Ye, B., Y. Zhang, W. Song, S.H. Younger, L.Y. Jan, and Y.N. Jan. 2007. Growing Dendrites and Axons Differ in Their Reliance on the Secretory Pathway. Cell. 130:717–729. doi:10.1016/j.cell.2007.06.032.

    1. SciScore for 10.1101/2021.12.17.21267926: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: All participants provided written and informed consent prior to enrolment.<br>IRB: This study was prospectively registered at the German Clinical Trial Register (DRKS00021270) after approval by the Ethics Committee of the Medical Association Schleswig-Holstein.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-SARS-CoV-2-IgG antibodies: The fully automated semiquantitative anti-SARS-CoV-2-ELISA (IgG) from Euroimmun (Lübeck, Germany) was used to detect the S1 domain of the SARS-CoV-2 spike-protein.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-SARS-CoV-2-IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-SARS-CoV-2-ELISA (IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Neutralizing antibodies against SARS-CoV-2: All samples were analyzed for neutralizing anti-SARS-CoV-2 antibodies using the NeutraLISA™ SARS-CoV-2 Neutralization Antibody Detection KIT (Euroimmun, Lübeck, Germany) in accordance to the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In addition, a fully automated quantitative anti-SARS-CoV-2-assay (IgG) from Abbott (Chicago, USA) was performed.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Abbott</div><div>suggested: (Abbott, RRID:SCR_010477)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, 500 μl of heparinized blood was stimulated with SARS-CoV-2 specific peptides covering regions of the viral S1-domain.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: (BioLegend Cat# 946101, RRID:AB_2892515)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Graphics were elaborated using IBM SPSS Statistics Version 25 (IBM Co., Armonk, NY, USA) and GraphPad Prism 9.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SPSS</div><div>suggested: (SPSS, RRID:SCR_002865)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Limitation: The major limitation of this trial is its single-center design. Due to the inclusion of hospital employees, women are relatively overrepresented and other groups with a higher risk are underrepresented. Especially elderly participants, with an age over 70 years, are not included in this study. It cannot be excluded that there were asymptomatic, undetected SARS-CoV-2 infections among the participants during the 9 months after second vaccination, which may lead to a slight bias in the results. Due to the use of different methods, it was not possible to compare the absolute values of antibody concentrations, T-cell responses or neutralizing antibodies over the follow-up-period. Further evaluations of antibody response after vaccination are needed, to investigate the longitudinal persistence of antibodies and the possible need for further booster vaccinations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.14.472547: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: Animal studies: All animal work and procedures performed in this study were approved by the National Animal Disease Center (NADC) Institutional Animal Care and Use Committee for both the fawn study (protocol ARS-2020-902) and the adult deer study (protocol ARS-2020-861)</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Cell cultures with no CPE were frozen, thawed, and subjected to two additional blind passages/inoculations in Vero E6/TMPRSS2 cell cultures.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For SARS-CoV-2 detection, tissue sections were incubated with anti-mouse biotinylated secondary antibody followed by incubation with the Vectastain Elite ABC HRP reagent.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse biotinylated secondary</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then, were incubated for 45 min at rt using a rabbit polyclonal antibody (pAb) anti-ACE2 (Abcan ref # ab15348) and a mouse monoclonal antibody (mAb) anti-TMPRSS2 (Santa Cruz Biotechnology, Inc. ref # sc-515727).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-ACE2</div><div>suggested: (Abcam Cat# ab15348, RRID:AB_301861)</div></div><div style="margin-bottom:8px"><div>anti-TMPRSS2</div><div>suggested: (Santa Cruz Biotechnology Cat# sc-515727, RRID:AB_2892118)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Followed by 30 min incubation at rt with a goat anti-rabbit IgG (goat anti-rabbit IgG, Alexa Fluor® 594) and a goat anti-mouse IgG antibody (goat anti-mouse IgG, Alexa Fluor® 488).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-mouse IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells and Virus: Vero E6 (ATCC® CRL-1586™), and Vero E6/TMPRSS2 (JCRB Cell Bank, JCRB1819) were cultured in Dulbecco’s modified eagle medium (DMEM) supplemented with 10% fetal bovine serum (FBS), L-glutamine (2mM), penicillin (100 U.ml−1), streptomycin (100 μg.ml−1) and gentamycin (50 μg.ml−1) for both cell lines.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Positive samples on viral isolation were subjected to end point titrations by limiting dilution using the Vero E6/TMPRSS2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6/TMPRSS2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Following incubation of serum and virus, 50 µl of a cell suspension of Vero cells was added to each well of a 96-well plate and incubated for 48 h at 37 °C with 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 MinION whole genome sequencing (WGS) and genetic analysis: The genetic make-up of SARS-CoV-2 following replication in WTD over viral transmission was investigated by whole genome sequencing.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>WGS</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For this, nasal secretions collected on days 2 to 9 pi from inoculated and oronasal secretions on days 2 and 3 pc in contact animals were subjected to MinION-based targeted SARS-CoV-2 WGS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: (BioLegend Cat# 946101, RRID:AB_2892515)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Low frequency variants were initially called using LoFreq [42] and subsequently filtered using Variabel [43].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>LoFreq</div><div>suggested: (LoFreq, RRID:SCR_013054)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis and data plotting were performed using the GraphPad Prism software (Version 9.0.1).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Garcia-Beltran, W. F., Denis, K. J. S., Hoelzemer, A., Lam, E. C., Nitido, A. D., Sheehan, M. L., Berrios, C., Ofoman, O., Chang, C. C., Hauser, B. M., Feldman, J., Gregory, D. J., Poznansky, M. C., Schmidt, A. G., Iafrate, A. J., Naranbhai, V., & Balazs, A. B. (2021). MRNA-based COVID-19 vaccine boosters induce neutralizing immunity against SARS-CoV-2 Omicron variant (p. 2021.12.14.21267755). https://doi.org/10.1101/2021.12.14.21267755

    1. ggplotly(p) 197019801990200020104000800012000dateunemploy.cls-1 {fill: #3f4f75;} .cls-2 {fill: #80cfbe;} .cls-3 {fill: #fff;}plotly-logomark {"x":{"data":[{"x":[-915,-884,-853,-823,-792,-762,-731,-700,-671,-640,-610,-579,-549,-518,-487,-457,-426,-396,-365,-334,-306,-275,-245,-214,-184,-153,-122,-92,-61,-31,0,31,59,90,120,151,181,212,243,273,304,334,365,396,424,455,485,516,546,577,608,638,669,699,730,761,790,821,851,882,912,943,974,1004,1035,1065,1096,1127,1155,1186,1216,1247,1277,1308,1339,1369,1400,1430,1461,1492,1520,1551,1581,1612,1642,1673,1704,1734,1765,1795,1826,1857,1885,1916,1946,1977,2007,2038,2069,2099,2130,2160,2191,2222,2251,2282,2312,2343,2373,2404,2435,2465,2496,2526,2557,2588,2616,2647,2677,2708,2738,2769,2800,2830,2861,2891,2922,2953,2981,3012,3042,3073,3103,3134,3165,3195,3226,3256,3287,3318,3346,3377,3407,3438,3468,3499,3530,3560,3591,3621,3652,3683,3712,3743,3773,3804,3834,3865,3896,3926,3957,3987,4018,4049,4077,4108,4138,4169,4199,4230,4261,4291,4322,4352,4383,4414,4442,4473,4503,4534,4564,4595,4626,4656,4687,4717,4748,4779,4807,4838,4868,4899,4929,4960,4991,5021,5052,5082,5113,5144,5173,5204,5234,5265,5295,5326,5357,5387,5418,5448,5479,5510,5538,5569,5599,5630,5660,5691,5722,5752,5783,5813,5844,5875,5903,5934,5964,5995,6025,6056,6087,6117,6148,6178,6209,6240,6268,6299,6329,6360,6390,6421,6452,6482,6513,6543,6574,6605,6634,6665,6695,6726,6756,6787,6818,6848,6879,6909,6940,6971,6999,7030,7060,7091,7121,7152,7183,7213,7244,7274,7305,7336,7364,7395,7425,7456,7486,7517,7548,7578,7609,7639,7670,7701,7729,7760,7790,7821,7851,7882,7913,7943,7974,8004,8035,8066,8095,8126,8156,8187,8217,8248,8279,8309,8340,8370,8401,8432,8460,8491,8521,8552,8582,8613,8644,8674,8705,8735,8766,8797,8825,8856,8886,8917,8947,8978,9009,9039,9070,9100,9131,9162,9190,9221,9251,9282,9312,9343,9374,9404,9435,9465,9496,9527,9556,9587,9617,9648,9678,9709,9740,9770,9801,9831,9862,9893,9921,9952,9982,10013,10043,10074,10105,10135,10166,10196,10227,10258,10286,10317,10347,10378,10408,10439,10470,10500,10531,10561,10592,10623,10651,10682,10712,10743,10773,10804,10835,10865,10896,10926,10957,10988,11017,11048,11078,11109,11139,11170,11201,11231,11262,11292,11323,11354,11382,11413,11443,11474,11504,11535,11566,11596,11627,11657,11688,11719,11747,11778,11808,11839,11869,11900,11931,11961,11992,12022,12053,12084,12112,12143,12173,12204,12234,12265,12296,12326,12357,12387,12418,12449,12478,12509,12539,12570,12600,12631,12662,12692,12723,12753,12784,12815,12843,12874,12904,12935,12965,12996,13027,13057,13088,13118,13149,13180,13208,13239,13269,13300,13330,13361,13392,13422,13453,13483,13514,13545,13573,13604,13634,13665,13695,13726,13757,13787,13818,13848,13879,13910,13939,13970,14000,14031,14061,14092,14123,14153,14184,14214,14245,14276,14304,14335,14365,14396,14426,14457,14488,14518,14549,14579,14610,14641,14669,14700,14730,14761,14791,14822,14853,14883,14914,14944,14975,15006,15034,15065,15095,15126,15156,15187,15218,15248,15279,15309,15340,15371,15400,15431,15461,15492,15522,15553,15584,15614,15645,15675,15706,15737,15765,15796,15826,15857,15887,15918,15949,15979,16010,16040,16071,16102,16130,16161,16191,16222,16252,16283,16314,16344,16375,16405,16436,16467,16495,16526],"y":[2944,2945,2958,3143,3066,3018,2878,3001,2877,2709,2740,2938,2883,2768,2686,2689,2715,2685,2718,2692,2712,2758,2713,2816,2868,2856,3040,3049,2856,2884,3201,3453,3635,3797,3919,4071,4175,4256,4456,4591,4898,5076,4986,4903,4987,4959,4996,4949,5035,5134,5042,4954,5161,5154,5019,4928,5038,4959,4922,4923,4913,4939,4849,4875,4602,4543,4326,4452,4394,4459,4329,4363,4305,4305,4350,4144,4396,4489,4644,4731,4634,4618,4705,4927,5063,5022,5437,5523,6140,6636,7501,7520,7978,8210,8433,8220,8127,7928,7923,7897,7794,7744,7534,7326,7230,7330,7053,7322,7490,7518,7380,7430,7620,7545,7280,7443,7307,7059,6911,7134,6829,6925,6751,6763,6815,6386,6489,6318,6337,6180,6127,6028,6309,6080,6125,5947,6077,6228,6109,6173,6109,6069,5840,5959,5996,6320,6190,6296,6238,6325,6683,6702,6729,7358,7984,8098,8363,8281,8021,8088,8023,7718,8071,8051,7982,7869,8174,8098,7863,8036,8230,8646,9029,9267,9397,9705,9895,10244,10335,10538,10849,10881,11217,11529,11938,12051,11534,11545,11408,11268,11154,11246,10548,10623,10282,9887,9499,9331,9008,8791,8746,8762,8456,8226,8537,8519,8367,8381,8198,8358,8423,8321,8339,8395,8302,8460,8513,8196,8248,8298,8128,8138,7795,8402,8383,8364,8439,8508,8319,8135,8310,8243,8159,7883,7892,7865,7862,7542,7574,7398,7268,7261,7102,7227,7035,6936,6953,6929,6876,6601,6779,6546,6605,6843,6604,6568,6537,6518,6682,6359,6205,6468,6375,6577,6495,6511,6590,6630,6725,6667,6752,6651,6598,6797,6742,6590,6922,7188,7368,7459,7764,7901,8015,8265,8586,8439,8736,8692,8586,8666,8722,8842,8931,9198,9283,9454,9460,9415,9744,10040,9850,9787,9781,9398,9565,9557,9325,9183,9056,9110,9149,9121,8930,8763,8714,8750,8542,8477,8630,8583,8470,8331,7915,7927,7946,7933,7734,7632,7375,7230,7375,7187,7153,7645,7430,7427,7527,7484,7478,7328,7426,7423,7491,7313,7318,7415,7423,7095,7337,6882,6979,7031,7236,7253,7158,7102,7000,6873,6655,6799,6655,6608,6656,6454,6308,6476,6368,6306,6422,5941,6047,6212,6259,6179,6300,6280,6100,6032,5976,6111,5783,6004,5796,5951,6025,5838,5915,5778,5716,5653,5708,5858,5733,5481,5758,5651,5747,5853,5625,5534,5639,5634,6023,6089,6141,6271,6226,6484,6583,7042,7142,7694,8003,8258,8182,8215,8304,8599,8399,8393,8390,8304,8251,8307,8520,8640,8520,8618,8588,8842,8957,9266,9011,8896,8921,8732,8576,8317,8370,8167,8491,8170,8212,8286,8136,7990,7927,8061,7932,7934,7784,7980,7737,7672,7651,7524,7406,7345,7553,7453,7566,7279,7064,7184,7072,7120,6980,7001,7175,7091,6847,6727,6872,6762,7116,6927,6731,6850,6766,6979,7149,7067,7170,7237,7240,7645,7685,7497,7822,7637,8395,8575,8937,9438,9494,10074,10538,11286,12058,12898,13426,13853,14499,14707,14601,14814,15009,15352,15219,15098,15046,15113,15202,15325,14849,14474,14512,14648,14579,14516,15081,14348,14013,13820,13737,13957,13855,13962,13763,13818,13948,13594,13302,13093,12797,12813,12713,12646,12660,12692,12656,12471,12115,12124,12005,12298,12471,11950,11689,11760,11654,11751,11335,11279,11270,11136,10787,10404,10202,10349,10380,9702,9859,9460,9608,9599,9262,8990,9090,8717,8903,8610,8504,8526],"text":["date: 1967-07-01<br />unemploy: 2944","date: 1967-08-01<br />unemploy: 2945","date: 1967-09-01<br />unemploy: 2958","date: 1967-10-01<br />unemploy: 3143","date: 1967-11-01<br />unemploy: 3066","date: 1967-12-01<br />unemploy: 3018","date: 1968-01-01<br />unemploy: 2878","date: 1968-02-01<br />unemploy: 3001","date: 1968-03-01<br />unemploy: 2877","date: 1968-04-01<br />unemploy: 2709","date: 1968-05-01<br />unemploy: 2740","date: 1968-06-01<br />unemploy: 2938","date: 1968-07-01<br />unemploy: 2883","date: 1968-08-01<br />unemploy: 2768","date: 1968-09-01<br />unemploy: 2686","date: 1968-10-01<br />unemploy: 2689","date: 1968-11-01<br />unemploy: 2715","date: 1968-12-01<br />unemploy: 2685","date: 1969-01-01<br />unemploy: 2718","date: 1969-02-01<br />unemploy: 2692","date: 1969-03-01<br />unemploy: 2712","date: 1969-04-01<br />unemploy: 2758","date: 1969-05-01<br />unemploy: 2713","date: 1969-06-01<br />unemploy: 2816","date: 1969-07-01<br />unemploy: 2868","date: 1969-08-01<br />unemploy: 2856","date: 1969-09-01<br />unemploy: 3040","date: 1969-10-01<br />unemploy: 3049","date: 1969-11-01<br />unemploy: 2856","date: 1969-12-01<br />unemploy: 2884","date: 1970-01-01<br />unemploy: 3201","date: 1970-02-01<br />unemploy: 3453","date: 1970-03-01<br />unemploy: 3635","date: 1970-04-01<br />unemploy: 3797","date: 1970-05-01<br />unemploy: 3919","date: 1970-06-01<br />unemploy: 4071","date: 1970-07-01<br />unemploy: 4175","date: 1970-08-01<br />unemploy: 4256","date: 1970-09-01<br />unemploy: 4456","date: 1970-10-01<br />unemploy: 4591","date: 1970-11-01<br />unemploy: 4898","date: 1970-12-01<br />unemploy: 5076","date: 1971-01-01<br />unemploy: 4986","date: 1971-02-01<br />unemploy: 4903","date: 1971-03-01<br />unemploy: 4987","date: 1971-04-01<br />unemploy: 4959","date: 1971-05-01<br />unemploy: 4996","date: 1971-06-01<br />unemploy: 4949","date: 1971-07-01<br />unemploy: 5035","date: 1971-08-01<br />unemploy: 5134","date: 1971-09-01<br />unemploy: 5042","date: 1971-10-01<br />unemploy: 4954","date: 1971-11-01<br />unemploy: 5161","date: 1971-12-01<br />unemploy: 5154","date: 1972-01-01<br />unemploy: 5019","date: 1972-02-01<br />unemploy: 4928","date: 1972-03-01<br />unemploy: 5038","date: 1972-04-01<br />unemploy: 4959","date: 1972-05-01<br />unemploy: 4922","date: 1972-06-01<br />unemploy: 4923","date: 1972-07-01<br />unemploy: 4913","date: 1972-08-01<br />unemploy: 4939","date: 1972-09-01<br />unemploy: 4849","date: 1972-10-01<br />unemploy: 4875","date: 1972-11-01<br />unemploy: 4602","date: 1972-12-01<br />unemploy: 4543","date: 1973-01-01<br />unemploy: 4326","date: 1973-02-01<br />unemploy: 4452","date: 1973-03-01<br />unemploy: 4394","date: 1973-04-01<br />unemploy: 4459","date: 1973-05-01<br />unemploy: 4329","date: 1973-06-01<br />unemploy: 4363","date: 1973-07-01<br />unemploy: 4305","date: 1973-08-01<br />unemploy: 4305","date: 1973-09-01<br />unemploy: 4350","date: 1973-10-01<br />unemploy: 4144","date: 1973-11-01<br />unemploy: 4396","date: 1973-12-01<br />unemploy: 4489","date: 1974-01-01<br />unemploy: 4644","date: 1974-02-01<br />unemploy: 4731","date: 1974-03-01<br />unemploy: 4634","date: 1974-04-01<br />unemploy: 4618","date: 1974-05-01<br />unemploy: 4705","date: 1974-06-01<br />unemploy: 4927","date: 1974-07-01<br />unemploy: 5063","date: 1974-08-01<br />unemploy: 5022","date: 1974-09-01<br />unemploy: 5437","date: 1974-10-01<br />unemploy: 5523","date: 1974-11-01<br />unemploy: 6140","date: 1974-12-01<br />unemploy: 6636","date: 1975-01-01<br />unemploy: 7501","date: 1975-02-01<br />unemploy: 7520","date: 1975-03-01<br />unemploy: 7978","date: 1975-04-01<br />unemploy: 8210","date: 1975-05-01<br />unemploy: 8433","date: 1975-06-01<br />unemploy: 8220","date: 1975-07-01<br />unemploy: 8127","date: 1975-08-01<br />unemploy: 7928","date: 1975-09-01<br />unemploy: 7923","date: 1975-10-01<br />unemploy: 7897","date: 1975-11-01<br />unemploy: 7794","date: 1975-12-01<br />unemploy: 7744","date: 1976-01-01<br />unemploy: 7534","date: 1976-02-01<br />unemploy: 7326","date: 1976-03-01<br />unemploy: 7230","date: 1976-04-01<br />unemploy: 7330","date: 1976-05-01<br />unemploy: 7053","date: 1976-06-01<br />unemploy: 7322","date: 1976-07-01<br />unemploy: 7490","date: 1976-08-01<br />unemploy: 7518","date: 1976-09-01<br />unemploy: 7380","date: 1976-10-01<br />unemploy: 7430","date: 1976-11-01<br />unemploy: 7620","date: 1976-12-01<br />unemploy: 7545","date: 1977-01-01<br />unemploy: 7280","date: 1977-02-01<br />unemploy: 7443","date: 1977-03-01<br />unemploy: 7307","date: 1977-04-01<br />unemploy: 7059","date: 1977-05-01<br />unemploy: 6911","date: 1977-06-01<br />unemploy: 7134","date: 1977-07-01<br />unemploy: 6829","date: 1977-08-01<br />unemploy: 6925","date: 1977-09-01<br />unemploy: 6751","date: 1977-10-01<br />unemploy: 6763","date: 1977-11-01<br />unemploy: 6815","date: 1977-12-01<br />unemploy: 6386","date: 1978-01-01<br />unemploy: 6489","date: 1978-02-01<br />unemploy: 6318","date: 1978-03-01<br />unemploy: 6337","date: 1978-04-01<br />unemploy: 6180","date: 1978-05-01<br />unemploy: 6127","date: 1978-06-01<br />unemploy: 6028","date: 1978-07-01<br />unemploy: 6309","date: 1978-08-01<br />unemploy: 6080","date: 1978-09-01<br />unemploy: 6125","date: 1978-10-01<br />unemploy: 5947","date: 1978-11-01<br />unemploy: 6077","date: 1978-12-01<br />unemploy: 6228","date: 1979-01-01<br />unemploy: 6109","date: 1979-02-01<br />unemploy: 6173","date: 1979-03-01<br />unemploy: 6109","date: 1979-04-01<br />unemploy: 6069","date: 1979-05-01<br />unemploy: 5840","date: 1979-06-01<br />unemploy: 5959","date: 1979-07-01<br />unemploy: 5996","date: 1979-08-01<br />unemploy: 6320","date: 1979-09-01<br />unemploy: 6190","date: 1979-10-01<br />unemploy: 6296","date: 1979-11-01<br />unemploy: 6238","date: 1979-12-01<br />unemploy: 6325","date: 1980-01-01<br />unemploy: 6683","date: 1980-02-01<br />unemploy: 6702","date: 1980-03-01<br />unemploy: 6729","date: 1980-04-01<br />unemploy: 7358","date: 1980-05-01<br />unemploy: 7984","date: 1980-06-01<br />unemploy: 8098","date: 1980-07-01<br />unemploy: 8363","date: 1980-08-01<br />unemploy: 8281","date: 1980-09-01<br />unemploy: 8021","date: 1980-10-01<br />unemploy: 8088","date: 1980-11-01<br />unemploy: 8023","date: 1980-12-01<br />unemploy: 7718","date: 1981-01-01<br />unemploy: 8071","date: 1981-02-01<br />unemploy: 8051","date: 1981-03-01<br />unemploy: 7982","date: 1981-04-01<br />unemploy: 7869","date: 1981-05-01<br />unemploy: 8174","date: 1981-06-01<br />unemploy: 8098","date: 1981-07-01<br />unemploy: 7863","date: 1981-08-01<br />unemploy: 8036","date: 1981-09-01<br />unemploy: 8230","date: 1981-10-01<br />unemploy: 8646","date: 1981-11-01<br />unemploy: 9029","date: 1981-12-01<br />unemploy: 9267","date: 1982-01-01<br />unemploy: 9397","date: 1982-02-01<br />unemploy: 9705","date: 1982-03-01<br />unemploy: 9895","date: 1982-04-01<br />unemploy: 10244","date: 1982-05-01<br />unemploy: 10335","date: 1982-06-01<br />unemploy: 10538","date: 1982-07-01<br />unemploy: 10849","date: 1982-08-01<br />unemploy: 10881","date: 1982-09-01<br />unemploy: 11217","date: 1982-10-01<br />unemploy: 11529","date: 1982-11-01<br />unemploy: 11938","date: 1982-12-01<br />unemploy: 12051","date: 1983-01-01<br />unemploy: 11534","date: 1983-02-01<br />unemploy: 11545","date: 1983-03-01<br />unemploy: 11408","date: 1983-04-01<br />unemploy: 11268","date: 1983-05-01<br />unemploy: 11154","date: 1983-06-01<br />unemploy: 11246","date: 1983-07-01<br />unemploy: 10548","date: 1983-08-01<br />unemploy: 10623","date: 1983-09-01<br />unemploy: 10282","date: 1983-10-01<br />unemploy: 9887","date: 1983-11-01<br />unemploy: 9499","date: 1983-12-01<br />unemploy: 9331","date: 1984-01-01<br />unemploy: 9008","date: 1984-02-01<br />unemploy: 8791","date: 1984-03-01<br />unemploy: 8746","date: 1984-04-01<br />unemploy: 8762","date: 1984-05-01<br />unemploy: 8456","date: 1984-06-01<br />unemploy: 8226","date: 1984-07-01<br />unemploy: 8537","date: 1984-08-01<br />unemploy: 8519","date: 1984-09-01<br />unemploy: 8367","date: 1984-10-01<br />unemploy: 8381","date: 1984-11-01<br />unemploy: 8198","date: 1984-12-01<br />unemploy: 8358","date: 1985-01-01<br />unemploy: 8423","date: 1985-02-01<br />unemploy: 8321","date: 1985-03-01<br />unemploy: 8339","date: 1985-04-01<br />unemploy: 8395","date: 1985-05-01<br />unemploy: 8302","date: 1985-06-01<br />unemploy: 8460","date: 1985-07-01<br />unemploy: 8513","date: 1985-08-01<br />unemploy: 8196","date: 1985-09-01<br />unemploy: 8248","date: 1985-10-01<br />unemploy: 8298","date: 1985-11-01<br />unemploy: 8128","date: 1985-12-01<br />unemploy: 8138","date: 1986-01-01<br />unemploy: 7795","date: 1986-02-01<br />unemploy: 8402","date: 1986-03-01<br />unemploy: 8383","date: 1986-04-01<br />unemploy: 8364","date: 1986-05-01<br />unemploy: 8439","date: 1986-06-01<br />unemploy: 8508","date: 1986-07-01<br />unemploy: 8319","date: 1986-08-01<br />unemploy: 8135","date: 1986-09-01<br />unemploy: 8310","date: 1986-10-01<br />unemploy: 8243","date: 1986-11-01<br />unemploy: 8159","date: 1986-12-01<br />unemploy: 7883","date: 1987-01-01<br />unemploy: 7892","date: 1987-02-01<br />unemploy: 7865","date: 1987-03-01<br />unemploy: 7862","date: 1987-04-01<br />unemploy: 7542","date: 1987-05-01<br />unemploy: 7574","date: 1987-06-01<br />unemploy: 7398","date: 1987-07-01<br />unemploy: 7268","date: 1987-08-01<br />unemploy: 7261","date: 1987-09-01<br />unemploy: 7102","date: 1987-10-01<br />unemploy: 7227","date: 1987-11-01<br />unemploy: 7035","date: 1987-12-01<br />unemploy: 6936","date: 1988-01-01<br />unemploy: 6953","date: 1988-02-01<br />unemploy: 6929","date: 1988-03-01<br />unemploy: 6876","date: 1988-04-01<br />unemploy: 6601","date: 1988-05-01<br />unemploy: 6779","date: 1988-06-01<br />unemploy: 6546","date: 1988-07-01<br />unemploy: 6605","date: 1988-08-01<br />unemploy: 6843","date: 1988-09-01<br />unemploy: 6604","date: 1988-10-01<br />unemploy: 6568","date: 1988-11-01<br />unemploy: 6537","date: 1988-12-01<br />unemploy: 6518","date: 1989-01-01<br />unemploy: 6682","date: 1989-02-01<br />unemploy: 6359","date: 1989-03-01<br />unemploy: 6205","date: 1989-04-01<br />unemploy: 6468","date: 1989-05-01<br />unemploy: 6375","date: 1989-06-01<br />unemploy: 6577","date: 1989-07-01<br />unemploy: 6495","date: 1989-08-01<br />unemploy: 6511","date: 1989-09-01<br />unemploy: 6590","date: 1989-10-01<br />unemploy: 6630","date: 1989-11-01<br />unemploy: 6725","date: 1989-12-01<br />unemploy: 6667","date: 1990-01-01<br />unemploy: 6752","date: 1990-02-01<br />unemploy: 6651","date: 1990-03-01<br />unemploy: 6598","date: 1990-04-01<br />unemploy: 6797","date: 1990-05-01<br />unemploy: 6742","date: 1990-06-01<br />unemploy: 6590","date: 1990-07-01<br />unemploy: 6922","date: 1990-08-01<br />unemploy: 7188","date: 1990-09-01<br />unemploy: 7368","date: 1990-10-01<br />unemploy: 7459","date: 1990-11-01<br />unemploy: 7764","date: 1990-12-01<br />unemploy: 7901","date: 1991-01-01<br />unemploy: 8015","date: 1991-02-01<br />unemploy: 8265","date: 1991-03-01<br />unemploy: 8586","date: 1991-04-01<br />unemploy: 8439","date: 1991-05-01<br />unemploy: 8736","date: 1991-06-01<br />unemploy: 8692","date: 1991-07-01<br />unemploy: 8586","date: 1991-08-01<br />unemploy: 8666","date: 1991-09-01<br />unemploy: 8722","date: 1991-10-01<br />unemploy: 8842","date: 1991-11-01<br />unemploy: 8931","date: 1991-12-01<br />unemploy: 9198","date: 1992-01-01<br />unemploy: 9283","date: 1992-02-01<br />unemploy: 9454","date: 1992-03-01<br />unemploy: 9460","date: 1992-04-01<br />unemploy: 9415","date: 1992-05-01<br />unemploy: 9744","date: 1992-06-01<br />unemploy: 10040","date: 1992-07-01<br />unemploy: 9850","date: 1992-08-01<br />unemploy: 9787","date: 1992-09-01<br />unemploy: 9781","date: 1992-10-01<br />unemploy: 9398","date: 1992-11-01<br />unemploy: 9565","date: 1992-12-01<br />unemploy: 9557","date: 1993-01-01<br />unemploy: 9325","date: 1993-02-01<br />unemploy: 9183","date: 1993-03-01<br />unemploy: 9056","date: 1993-04-01<br />unemploy: 9110","date: 1993-05-01<br />unemploy: 9149","date: 1993-06-01<br />unemploy: 9121","date: 1993-07-01<br />unemploy: 8930","date: 1993-08-01<br />unemploy: 8763","date: 1993-09-01<br />unemploy: 8714","date: 1993-10-01<br />unemploy: 8750","date: 1993-11-01<br />unemploy: 8542","date: 1993-12-01<br />unemploy: 8477","date: 1994-01-01<br />unemploy: 8630","date: 1994-02-01<br />unemploy: 8583","date: 1994-03-01<br />unemploy: 8470","date: 1994-04-01<br />unemploy: 8331","date: 1994-05-01<br />unemploy: 7915","date: 1994-06-01<br />unemploy: 7927","date: 1994-07-01<br />unemploy: 7946","date: 1994-08-01<br />unemploy: 7933","date: 1994-09-01<br />unemploy: 7734","date: 1994-10-01<br />unemploy: 7632","date: 1994-11-01<br />unemploy: 7375","date: 1994-12-01<br />unemploy: 7230","date: 1995-01-01<br />unemploy: 7375","date: 1995-02-01<br />unemploy: 7187","date: 1995-03-01<br />unemploy: 7153","date: 1995-04-01<br />unemploy: 7645","date: 1995-05-01<br />unemploy: 7430","date: 1995-06-01<br />unemploy: 7427","date: 1995-07-01<br />unemploy: 7527","date: 1995-08-01<br />unemploy: 7484","date: 1995-09-01<br />unemploy: 7478","date: 1995-10-01<br />unemploy: 7328","date: 1995-11-01<br />unemploy: 7426","date: 1995-12-01<br />unemploy: 7423","date: 1996-01-01<br />unemploy: 7491","date: 1996-02-01<br />unemploy: 7313","date: 1996-03-01<br />unemploy: 7318","date: 1996-04-01<br />unemploy: 7415","date: 1996-05-01<br />unemploy: 7423","date: 1996-06-01<br />unemploy: 7095","date: 1996-07-01<br />unemploy: 7337","date: 1996-08-01<br />unemploy: 6882","date: 1996-09-01<br />unemploy: 6979","date: 1996-10-01<br />unemploy: 7031","date: 1996-11-01<br />unemploy: 7236","date: 1996-12-01<br />unemploy: 7253","date: 1997-01-01<br />unemploy: 7158","date: 1997-02-01<br />unemploy: 7102","date: 1997-03-01<br />unemploy: 7000","date: 1997-04-01<br />unemploy: 6873","date: 1997-05-01<br />unemploy: 6655","date: 1997-06-01<br />unemploy: 6799","date: 1997-07-01<br />unemploy: 6655","date: 1997-08-01<br />unemploy: 6608","date: 1997-09-01<br />unemploy: 6656","date: 1997-10-01<br />unemploy: 6454","date: 1997-11-01<br />unemploy: 6308","date: 1997-12-01<br />unemploy: 6476","date: 1998-01-01<br />unemploy: 6368","date: 1998-02-01<br />unemploy: 6306","date: 1998-03-01<br />unemploy: 6422","date: 1998-04-01<br />unemploy: 5941","date: 1998-05-01<br />unemploy: 6047","date: 1998-06-01<br />unemploy: 6212","date: 1998-07-01<br />unemploy: 6259","date: 1998-08-01<br />unemploy: 6179","date: 1998-09-01<br />unemploy: 6300","date: 1998-10-01<br />unemploy: 6280","date: 1998-11-01<br />unemploy: 6100","date: 1998-12-01<br />unemploy: 6032","date: 1999-01-01<br />unemploy: 5976","date: 1999-02-01<br />unemploy: 6111","date: 1999-03-01<br />unemploy: 5783","date: 1999-04-01<br />unemploy: 6004","date: 1999-05-01<br />unemploy: 5796","date: 1999-06-01<br />unemploy: 5951","date: 1999-07-01<br />unemploy: 6025","date: 1999-08-01<br />unemploy: 5838","date: 1999-09-01<br />unemploy: 5915","date: 1999-10-01<br />unemploy: 5778","date: 1999-11-01<br />unemploy: 5716","date: 1999-12-01<br />unemploy: 5653","date: 2000-01-01<br />unemploy: 5708","date: 2000-02-01<br />unemploy: 5858","date: 2000-03-01<br />unemploy: 5733","date: 2000-04-01<br />unemploy: 5481","date: 2000-05-01<br />unemploy: 5758","date: 2000-06-01<br />unemploy: 5651","date: 2000-07-01<br />unemploy: 5747","date: 2000-08-01<br />unemploy: 5853","date: 2000-09-01<br />unemploy: 5625","date: 2000-10-01<br />unemploy: 5534","date: 2000-11-01<br />unemploy: 5639","date: 2000-12-01<br />unemploy: 5634","date: 2001-01-01<br />unemploy: 6023","date: 2001-02-01<br />unemploy: 6089","date: 2001-03-01<br />unemploy: 6141","date: 2001-04-01<br />unemploy: 6271","date: 2001-05-01<br />unemploy: 6226","date: 2001-06-01<br />unemploy: 6484","date: 2001-07-01<br />unemploy: 6583","date: 2001-08-01<br />unemploy: 7042","date: 2001-09-01<br />unemploy: 7142","date: 2001-10-01<br />unemploy: 7694","date: 2001-11-01<br />unemploy: 8003","date: 2001-12-01<br />unemploy: 8258","date: 2002-01-01<br />unemploy: 8182","date: 2002-02-01<br />unemploy: 8215","date: 2002-03-01<br />unemploy: 8304","date: 2002-04-01<br />unemploy: 8599","date: 2002-05-01<br />unemploy: 8399","date: 2002-06-01<br />unemploy: 8393","date: 2002-07-01<br />unemploy: 8390","date: 2002-08-01<br />unemploy: 8304","date: 2002-09-01<br />unemploy: 8251","date: 2002-10-01<br />unemploy: 8307","date: 2002-11-01<br />unemploy: 8520","date: 2002-12-01<br />unemploy: 8640","date: 2003-01-01<br />unemploy: 8520","date: 2003-02-01<br />unemploy: 8618","date: 2003-03-01<br />unemploy: 8588","date: 2003-04-01<br />unemploy: 8842","date: 2003-05-01<br />unemploy: 8957","date: 2003-06-01<br />unemploy: 9266","date: 2003-07-01<br />unemploy: 9011","date: 2003-08-01<br />unemploy: 8896","date: 2003-09-01<br />unemploy: 8921","date: 2003-10-01<br />unemploy: 8732","date: 2003-11-01<br />unemploy: 8576","date: 2003-12-01<br />unemploy: 8317","date: 2004-01-01<br />unemploy: 8370","date: 2004-02-01<br />unemploy: 8167","date: 2004-03-01<br />unemploy: 8491","date: 2004-04-01<br />unemploy: 8170","date: 2004-05-01<br />unemploy: 8212","date: 2004-06-01<br />unemploy: 8286","date: 2004-07-01<br />unemploy: 8136","date: 2004-08-01<br />unemploy: 7990","date: 2004-09-01<br />unemploy: 7927","date: 2004-10-01<br />unemploy: 8061","date: 2004-11-01<br />unemploy: 7932","date: 2004-12-01<br />unemploy: 7934","date: 2005-01-01<br />unemploy: 7784","date: 2005-02-01<br />unemploy: 7980","date: 2005-03-01<br />unemploy: 7737","date: 2005-04-01<br />unemploy: 7672","date: 2005-05-01<br />unemploy: 7651","date: 2005-06-01<br />unemploy: 7524","date: 2005-07-01<br />unemploy: 7406","date: 2005-08-01<br />unemploy: 7345","date: 2005-09-01<br />unemploy: 7553","date: 2005-10-01<br />unemploy: 7453","date: 2005-11-01<br />unemploy: 7566","date: 2005-12-01<br />unemploy: 7279","date: 2006-01-01<br />unemploy: 7064","date: 2006-02-01<br />unemploy: 7184","date: 2006-03-01<br />unemploy: 7072","date: 2006-04-01<br />unemploy: 7120","date: 2006-05-01<br />unemploy: 6980","date: 2006-06-01<br />unemploy: 7001","date: 2006-07-01<br />unemploy: 7175","date: 2006-08-01<br />unemploy: 7091","date: 2006-09-01<br />unemploy: 6847","date: 2006-10-01<br />unemploy: 6727","date: 2006-11-01<br />unemploy: 6872","date: 2006-12-01<br />unemploy: 6762","date: 2007-01-01<br />unemploy: 7116","date: 2007-02-01<br />unemploy: 6927","date: 2007-03-01<br />unemploy: 6731","date: 2007-04-01<br />unemploy: 6850","date: 2007-05-01<br />unemploy: 6766","date: 2007-06-01<br />unemploy: 6979","date: 2007-07-01<br />unemploy: 7149","date: 2007-08-01<br />unemploy: 7067","date: 2007-09-01<br />unemploy: 7170","date: 2007-10-01<br />unemploy: 7237","date: 2007-11-01<br />unemploy: 7240","date: 2007-12-01<br />unemploy: 7645","date: 2008-01-01<br />unemploy: 7685","date: 2008-02-01<br />unemploy: 7497","date: 2008-03-01<br />unemploy: 7822","date: 2008-04-01<br />unemploy: 7637","date: 2008-05-01<br />unemploy: 8395","date: 2008-06-01<br />unemploy: 8575","date: 2008-07-01<br />unemploy: 8937","date: 2008-08-01<br />unemploy: 9438","date: 2008-09-01<br />unemploy: 9494","date: 2008-10-01<br />unemploy: 10074","date: 2008-11-01<br />unemploy: 10538","date: 2008-12-01<br />unemploy: 11286","date: 2009-01-01<br />unemploy: 12058","date: 2009-02-01<br />unemploy: 12898","date: 2009-03-01<br />unemploy: 13426","date: 2009-04-01<br />unemploy: 13853","date: 2009-05-01<br />unemploy: 14499","date: 2009-06-01<br />unemploy: 14707","date: 2009-07-01<br />unemploy: 14601","date: 2009-08-01<br />unemploy: 14814","date: 2009-09-01<br />unemploy: 15009","date: 2009-10-01<br />unemploy: 15352","date: 2009-11-01<br />unemploy: 15219","date: 2009-12-01<br />unemploy: 15098","date: 2010-01-01<br />unemploy: 15046","date: 2010-02-01<br />unemploy: 15113","date: 2010-03-01<br />unemploy: 15202","date: 2010-04-01<br />unemploy: 15325","date: 2010-05-01<br />unemploy: 14849","date: 2010-06-01<br />unemploy: 14474","date: 2010-07-01<br />unemploy: 14512","date: 2010-08-01<br />unemploy: 14648","date: 2010-09-01<br />unemploy: 14579","date: 2010-10-01<br />unemploy: 14516","date: 2010-11-01<br />unemploy: 15081","date: 2010-12-01<br />unemploy: 14348","date: 2011-01-01<br />unemploy: 14013","date: 2011-02-01<br />unemploy: 13820","date: 2011-03-01<br />unemploy: 13737","date: 2011-04-01<br />unemploy: 13957","date: 2011-05-01<br />unemploy: 13855","date: 2011-06-01<br />unemploy: 13962","date: 2011-07-01<br />unemploy: 13763","date: 2011-08-01<br />unemploy: 13818","date: 2011-09-01<br />unemploy: 13948","date: 2011-10-01<br />unemploy: 13594","date: 2011-11-01<br />unemploy: 13302","date: 2011-12-01<br />unemploy: 13093","date: 2012-01-01<br />unemploy: 12797","date: 2012-02-01<br />unemploy: 12813","date: 2012-03-01<br />unemploy: 12713","date: 2012-04-01<br />unemploy: 12646","date: 2012-05-01<br />unemploy: 12660","date: 2012-06-01<br />unemploy: 12692","date: 2012-07-01<br />unemploy: 12656","date: 2012-08-01<br />unemploy: 12471","date: 2012-09-01<br />unemploy: 12115","date: 2012-10-01<br />unemploy: 12124","date: 2012-11-01<br />unemploy: 12005","date: 2012-12-01<br />unemploy: 12298","date: 2013-01-01<br />unemploy: 12471","date: 2013-02-01<br />unemploy: 11950","date: 2013-03-01<br />unemploy: 11689","date: 2013-04-01<br />unemploy: 11760","date: 2013-05-01<br />unemploy: 11654","date: 2013-06-01<br />unemploy: 11751","date: 2013-07-01<br />unemploy: 11335","date: 2013-08-01<br />unemploy: 11279","date: 2013-09-01<br />unemploy: 11270","date: 2013-10-01<br />unemploy: 11136","date: 2013-11-01<br />unemploy: 10787","date: 2013-12-01<br />unemploy: 10404","date: 2014-01-01<br />unemploy: 10202","date: 2014-02-01<br />unemploy: 10349","date: 2014-03-01<br />unemploy: 10380","date: 2014-04-01<br />unemploy: 9702","date: 2014-05-01<br />unemploy: 9859","date: 2014-06-01<br />unemploy: 9460","date: 2014-07-01<br />unemploy: 9608","date: 2014-08-01<br />unemploy: 9599","date: 2014-09-01<br />unemploy: 9262","date: 2014-10-01<br />unemploy: 8990","date: 2014-11-01<br />unemploy: 9090","date: 2014-12-01<br />unemploy: 8717","date: 2015-01-01<br />unemploy: 8903","date: 2015-02-01<br />unemploy: 8610","date: 2015-03-01<br />unemploy: 8504","date: 2015-04-01<br />unemploy: 8526"],"type":"scatter","mode":"lines","line":{"width":1.88976377952756,"color":"rgba(0,0,0,1)","dash":"solid"},"hoveron":"points","showlegend":false,"xaxis":"x","yaxis":"y","hoverinfo":"text","frame":null}],"layout":{"margin":{"t":26.2283105022831,"r":7.30593607305936,"b":40.1826484018265,"l":54.7945205479452},"plot_bgcolor":"rgba(242,242,242,1)","paper_bgcolor":"rgba(255,255,255,1)","font":{"color":"rgba(0,0,0,1)","family":"","size":14.6118721461187},"xaxis":{"domain":[0,1],"automargin":true,"type":"linear","autorange":false,"range":[-1787.05,17398.05],"tickmode":"array","ticktext":["1970","1980","1990","2000","2010"],"tickvals":[0,3652,7305,10957,14610],"categoryorder":"array","categoryarray":["1970","1980","1990","2000","2010"],"nticks":null,"ticks":"outside","tickcolor":"rgba(51,51,51,1)","ticklen":3.65296803652968,"tickwidth":0.66417600664176,"showticklabels":true,"tickfont":{"color":"rgba(77,77,77,1)","family":"","size":11.689497716895},"tickangle":-0,"showline":false,"linecolor":null,"linewidth":0,"showgrid":true,"gridcolor":"rgba(255,255,255,1)","gridwidth":0.66417600664176,"zeroline":false,"anchor":"y","title":{"text":"date","font":{"color":"rgba(0,0,0,1)","family":"","size":14.6118721461187}},"hoverformat":".2f"},"yaxis":{"domain":[0,1],"automargin":true,"type":"linear","autorange":false,"range":[2051.65,15985.35],"tickmode":"array","ticktext":["4000","8000","12000"],"tickvals":[4000,8000,12000],"categoryorder":"array","categoryarray":["4000","8000","12000"],"nticks":null,"ticks":"outside","tickcolor":"rgba(51,51,51,1)","ticklen":3.65296803652968,"tickwidth":0.66417600664176,"showticklabels":true,"tickfont":{"color":"rgba(77,77,77,1)","family":"","size":11.689497716895},"tickangle":-0,"showline":false,"linecolor":null,"linewidth":0,"showgrid":true,"gridcolor":"rgba(255,255,255,1)","gridwidth":0.66417600664176,"zeroline":false,"anchor":"x","title":{"text":"unemploy","font":{"color":"rgba(0,0,0,1)","family":"","size":14.6118721461187}},"hoverformat":".2f"},"shapes":[{"type":"rect","fillcolor":null,"line":{"color":null,"width":0,"linetype":[]},"yref":"paper","xref":"paper","x0":0,"x1":1,"y0":0,"y1":1}],"showlegend":false,"legend":{"bgcolor":"rgba(255,255,255,1)","bordercolor":"transparent","borderwidth":1.88976377952756,"font":{"color":"rgba(0,0,0,1)","family":"","size":11.689497716895}},"hovermode":"closest","barmode":"relative"},"config":{"doubleClick":"reset","modeBarButtonsToAdd":["hoverclosest","hovercompare"],"showSendToCloud":false},"source":"A","attrs":{"307d5caf07a9":{"x":{},"y":{},"type":"scatter"}},"cur_data":"307d5caf07a9","visdat":{"307d5caf07a9":["function (y) ","x"]},"highlight":{"on":"plotly_click","persistent":false,"dynamic":false,"selectize":false,"opacityDim":0.2,"selected":{"opacity":1},"debounce":0},"shinyEvents":["plotly_hover","plotly_click","plotly_selected","plotly_relayout","plotly_brushed","plotly_brushing","plotly_clickannotation","plotly_doubleclick","plotly_deselect","plotly_afterplot","plotly_sunburstclick"],"base_url":"https://plot.ly"},"evals":[],"jsHooks":[]}

      or 'pipe it to ggplotly()'

    1. SciScore for 10.1101/2021.12.12.472286: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Collection of samples was approved by the ethic committee of the UMG (reference number: 8/9/20 and SeptImmun Study 25/4/19 Ü) and the Institutional Review Board of MHH (8973_BO_K_2020).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Cell culture: The following cells lines were used in the present study: 293T (human, female, kidney; ACC-635, DSMZ; RRID: CVCL_0063), A549-ACE2 ((Huang et al., 2021); based on parental A549 cells, human, male, lung; CRM-CCL-185, ATCC), BHK-21 (Syrian hamster, male, kidney; ATCC Cat# CCL-10; RRID: CVCL_1915, kindly provided by Georg Herrler, University of Veterinary Medicine, Hannover, Germany), Vero (African green monkey kidney, female, kidney; CRL-1586, ATCC; RRID: CVCL_0574, kindly provided by Andrea Maisner), Huh-7 cells (human, male, liver; JCRB Cat# JCRB0403; RRID: CVCL_0336, kindly provided by Thomas Pietschmann), Calu-3 (human, male, lung; HTB-55, ATCC; RRID: CVCL_0609, kindly provided by Stephan Ludwig) and Caco-2 cells (human, male,</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Authentication: Cell lines were validated by STR-typing, amplification and sequencing of a fragment of the cytochrome c oxidase gene, microscopic examination and/or according to their growth characteristics.<br>Contamination: In addition, all cell lines were regularly tested for mycoplasma contamination.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Thereafter, culture medium containing anti-VSV-G antibody (culture supernatant from I1-hybridoma cells; ATCC no. CRL-2700) was added in order to neutralize residual inpunt virus.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-VSV-G</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Thereafter, the cells were pelleted, resuspended in 250 μl PBS-B containing anti-human AlexaFlour-488-conjugated antibody (1:200; Thermo Fisher Scientific) and incubated again for 60 min at 4 °C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human AlexaFlour-488-conjugated antibody</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell culture: The following cells lines were used in the present study: 293T (human, female, kidney; ACC-635, DSMZ; RRID: CVCL_0063), A549-ACE2 ((Huang et al., 2021); based on parental A549 cells, human, male, lung; CRM-CCL-185, ATCC), BHK-21 (Syrian hamster, male, kidney; ATCC Cat# CCL-10; RRID: CVCL_1915, kindly provided by Georg Herrler, University of Veterinary Medicine, Hannover, Germany), Vero (African green monkey kidney, female, kidney; CRL-1586, ATCC; RRID: CVCL_0574, kindly provided by Andrea Maisner), Huh-7 cells (human, male, liver; JCRB Cat# JCRB0403; RRID: CVCL_0336, kindly provided by Thomas Pietschmann), Calu-3 (human, male, lung; HTB-55, ATCC; RRID: CVCL_0609, kindly provided by Stephan Ludwig) and Caco-2 cells (human, male,</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>detected: (CCLV Cat# CCLV-RIE 1018, RRID:CVCL_0063)</div></div><div style="margin-bottom:8px"><div>A549</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>ATCC) BHK-21</div><div>detected: (IZSLER Cat# BS CL 8, RRID:CVCL_1915)</div></div><div style="margin-bottom:8px"><div>Vero</div><div>detected: (IZSLER Cat# BS CL 87, RRID:CVCL_0574)</div></div><div style="margin-bottom:8px"><div>Huh-7</div><div>suggested: JCRB Cat# JCRB0403, RRID:CVCL_0336)</div></div><div style="margin-bottom:8px"><div>human</div><div>detected: (KCB Cat# KCB 200970YJ, RRID:CVCL_0336)</div></div><div style="margin-bottom:8px"><div>Calu-3</div><div>detected: (ATCC Cat# HTB-55, RRID:CVCL_0609)</div></div><div style="margin-bottom:8px"><div>Caco-2</div><div>suggested: CLS Cat# 300137/p1665_CaCo-2, RRID:CVCL_0025)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">colon; HTB-37, ATCC, RRID: CVCL_0025).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ATCC</div><div>detected: (RCB Cat# RCB0988, RRID:CVCL_0025)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">293T, BHK-21, Vero and Huh-7 cells were maintained in Dulbecco’s modified Eagle medium (DMEM, PAN-Biotech).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK-21</div><div>suggested: ATCC Cat# CRL-6281, RRID:CVCL_1914)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Calu-3 and Caco-2 cells were cultured in minimum essential medium (GIBCO) while A549-ACE2 cells were maintained in DMEM/F-12 medium (GIBCO).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>A549-ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In order to test binding of soluble ACE2 to the S protein, 293T cells seeded in 6-well plates were transfected with S protein expression plasmids or empty plasmid as negative control.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After incubation, the mixtures were added to Vero cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: CLS Cat# 605372/p622_VERO, RRID:CVCL_0059)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The expression vector for the Omicron spike (based on isolate hCoV-19/Botswana/R40B58_BHP_3321001245/2021; GISAID Accession ID: EPI_ISL_6640919) was generated by Gibson assembly using five overlapping DNA strings (Thermo Fisher Scientific, sequences available upon request), linearized (BamHI/XbaI digest) pCG1 plasmid and GeneArt™ Gibson Assembly HiFi Master Mix (Thermo Fisher Scientific).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCG1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">ACE2 open reading frames were inserted into the pQCXIP expression vector making use of NotI and PacI restriction sites.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pQCXIP</div><div>suggested: RRID:Addgene_15714)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For cells expressing VSV-G, culture medium without antibody was added.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VSV-G</div><div>suggested: RRID:Addgene_138479)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Structural models of the S protein were generated using YASARA software (http://www.yasara.org/index.html) and are based on a template that was constructed by modelling the SARS-2 S sequence on PDB: 6XR8 (Cai et al., 2020) using the SWISS-MODEL online tool (https://swissmodel.expasy.org).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>YASARA</div><div>suggested: (YASARA, RRID:SCR_017591)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were analyzed using Microsoft Excel (as part of the Microsoft Office software package, version 2019, Microsoft Corporation) and GraphPad Prism 8 version 8.4.3 (GraphPad Software).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Microsoft Excel</div><div>suggested: (Microsoft Excel, RRID:SCR_016137)</div></div><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Our study has several limitations, including the use of pseudotyped virus and lack of analysis of T cell responses. However, given the important role that antibodies play in immune protection against SARS-CoV-2, our results suggest that preventive and therapeutic approaches have to be adapted for efficient protection against the Omicron variant. While such adaptations are in progress, heterologous or booster immunizations and conventional control measures like face masks and social distancing will help to limit the impact of the Omicron variant on public health.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.12.21267518: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: The clinical trial of the Corona-T-test kit was conducted at Dmitry Rogachev National Medical Research Center of Pediatric Hematology, Oncology, and Immunology in Moscow, Russia.<br>Consent: Written informed consent was obtained from all patients.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Donors were recruited by a separate center, DNKOM Laboratory, where the samples were collected and blinded.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vac PBMCs (n = 45) were collected and frozen 23–65 days after receiving the second dose of the Sputnik-V (Gam-COVID-Vac) vaccine from donors who had a negative antibody tests no later than four weeks before the first shot and no self-reported COVID-like symptoms.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gam-COVID-Vac</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The HE cohort (n = 37) of samples were from people who had close contact with a patient with active COVID-19 (same household or “red zone” medical workers with multiple negative RT-PCR tests) but who were themselves without COVID-19 symptoms and without detectable IgG and IgM anti-S protein antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgM anti-S protein</div><div>suggested: (Creative Diagnostics Cat# DMABT-Z60199, RRID:AB_2455687)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All samples were pretested for antibodies against SARS-CoV-2, and inclusion criteria and antibody tests are shown in the table below.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plates were washed thrice with PBST, and then 100 µL of 0.1 µg/mL biotinylated anti-IFNɣ antibody (R&D Systems, USA) was added and incubated for one hour at 37°C on a rocking platform.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-IFNɣ</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-SARS-CoV-2 ELISA: ELISA kits for the detection of anti-RBD IgG (K153, National Research Center for Hematology, Russia) and SARS-CoV-2-IgМ-EIA-BEST (D-5502, Vector Best, Russia) for the detection of IgM antibodies to full-length S protein were used according to the manufacturers’ instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-RBD IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>K153</div><div>suggested: (Leinco Technologies Cat# K153, RRID:AB_2893857)</div></div><div style="margin-bottom:8px"><div>SARS-CoV-2-IgМ-EIA-BEST</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>D-5502 , Vector Best ,</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgM</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HLA and epitope selection: We selected the HLA list based on the most-presented HLA among the CP cohort: HLA-I: A*01:01; A*02:01; A*03:01; A*11:01; A*23:01; A*24:02; A*25:01; A*30:01; A*32:01; B*07:02; B*08:01; B*13:02; B*15:01; B*18:01; B*27:05; B*35:01; B*38:01; B*40:01; B*44:02; B*44:03; B*51:01; C*01:02; C*03:04; C*04:01; C*05:01; C*06:02; C*07:01; C*07:02; C*12:03; C*15:02 MHC-I peptides: The core set comprised two epitopes from Shomuradova et al. and 25 minimally/non-cross-reactive epitopes from the publications listed in Fig 1A. 67 epitopes from Snyder et al. were chosen with the aim of selecting individual epitopes instead of peptides within a peptide pool and balancing predicted HLA coverage, minimal cross-reactivity (based on the number of non-naive expansions from healthy donors assigned to a specific epitope/peptide group), and higher immunogenicity (based on the number of CP with detected TCR sequences assigned to a specific epitope/peptide group).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>B*08:01; B*13:02; B*15:01; B*18:01; B*27:05; B*35:01; B*38:01; B*40:01; B*44:02; B*44:03</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Meikang Biological Project, KH-M-02, China) were coated with 100 μL per well of 0.01 mg/mL anti-IFNɣ antibody (Hytest, clone GF1) in 100 mM bicarbonate/carbonate (pH 9.6).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Meikang Biological Project</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Alignments were performed using best global-local alignment by the ‘pairwiseAlignment’ (bioPython) function for four ORFs shared by all five strains: orf1ab, S, N, and M, allowing amino acid substitutions with similar biochemical properties (1, 2) and low penalties for gap opening and extension (−0.5).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>bioPython</div><div>suggested: (Biopython, RRID:SCR_007173)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">We used the following mixes in our work (each presented by two submixes, diluted in DMSO or isopropanol): Quantification and statistical analysis: All data comparisons were performed using GraphPad Prism 8, Python 3.2, and FlowJo 10 software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>Python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Fixation and permeabilization were performed with BD Cytofix/Cytoperm according to the manufacturer’s protocol, and intracellular staining was carried out for 30 min in the dark at room temperature with APC anti-IFNɣ (clone B27, BD Biosciences, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BD Cytofix/Cytoperm</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.10.472112: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: All experiments and procedures were pre-approved by the UC Berkeley Animal Care and Use Committee, Protocol AUP-2014-08-6638-2.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">EXPERIMENTAL MODELS AND SUBJECT DETAILS: Mice: Six- to eight-week-old wild-type C57BL/6J female mice were purchased from the Jackson Laboratory and housed at the University of California, Berkeley Animal Facility under specific pathogen-free conditions.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">For immunofluorescence microscopy experiments, images of random fields were captured.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Researchers were not blinded during experiments.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Authentication: Identified DEGs were analyzed by STRING to identify predicted protein-protein interaction networks as well as enriched pathway analysis (https://string-db.org/).</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Afterwards, plates were incubated with biotinylated chicken anti-human TGF-β1 detection antibody and then with streptavidin-horseradish peroxidase (HRP) for signal detection with tetramethylbenzidine (TMB) substrate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human TGF-β1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, heparin (Sigma, H3393), anti-Spike (Genetex, 1A9, GTX632604), anti-Spike (Absolute Antibody, CR3022), rabbit anti-TGFBR1 (Thermo Fisher Scientific, PA5-32631).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Spike</div><div>suggested: (GeneTex Cat# GTX632604, RRID:AB_2864418)</div></div><div style="margin-bottom:8px"><div>GTX632604</div><div>suggested: (GeneTex Cat# GTX632604, RRID:AB_2864418)</div></div><div style="margin-bottom:8px"><div>CR3022</div><div>suggested: (Imported from the IEDB Cat# CR3022, RRID:AB_2848080)</div></div><div style="margin-bottom:8px"><div>anti-TGFBR1</div><div>suggested: (Thermo Fisher Scientific Cat# PA5-32631, RRID:AB_2550094)</div></div><div style="margin-bottom:8px"><div>PA5-32631</div><div>suggested: (Thermo Fisher Scientific Cat# PA5-32631, RRID:AB_2550094)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The following antibodies were used in this study: goat anti-ACE2 (R&D Systems, AF933)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero-E6 cells were used for SARS-CoV-2 titration and maintained in D10 media at 37°C with 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, 15-cm2 dishes of HEK293T cells were transfected with a plasmid encoding SARS-CoV-2 S (Wuhan-Hu-1, Accession #QHD43416.1) using 45 μg total DNA.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, lentivirus vectors were transfected into 293T cells using a lipofectamine 3000 transfection protocol according to the manufacturer’s instructions, along with a packaging vector (psPAX2) and a pseudotyping vector (pMD2.G).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, 6×104 HPMEC or 2×105 Calu-3 were seeded in 300 μL into the apical chambers of 24-well transwell polycarbonate membrane inserts (Transwell permeable support, 0.4 μM, 6.5 mm insert; Corning) and 1.5 mL of medium was added to the basolateral chamber.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">EXPERIMENTAL MODELS AND SUBJECT DETAILS: Mice: Six- to eight-week-old wild-type C57BL/6J female mice were purchased from the Jackson Laboratory and housed at the University of California, Berkeley Animal Facility under specific pathogen-free conditions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57BL/6J</div><div>suggested: RRID:IMSR_JAX:000664)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The hACE2 encoding plasmid was a gift from Hyeryun Choe (Addgene plasmid #1786; http://n2t.net/addgene:1786; RRID:Addgene_1786) (66)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RRID:Addgene_1786</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The hACE2 encoding plasmid was a gift from Hyeryun Choe (Addgene plasmid #1786; http://n2t.net/addgene:1786; RRID:Addgene_1786) (66)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_1786)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">At 24 hours post-transfection, VSV-G expressing VSV-ΔG-rLuc pseudotyped virions were used to infect the transfected HEK293T cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VSV-G</div><div>suggested: RRID:Addgene_138479)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, lentivirus vectors were transfected into 293T cells using a lipofectamine 3000 transfection protocol according to the manufacturer’s instructions, along with a packaging vector (psPAX2) and a pseudotyping vector (pMD2.G).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>psPAX2</div><div>suggested: RRID:Addgene_12260)</div></div><div style="margin-bottom:8px"><div>pMD2 . G</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">CRISPR-Cas9 Knockout: To produce gene-specific knockout cell lines, we utilized a CRISPR-Cas9 pipeline based on the lentiCRISPR v2 lentivirus construct obtained from Feng Zhang (Addgene plasmid # 52961; http://n2t.net/addgene:52961;RRID:Addgene_52961), as previously described (71).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_52961)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 S stabilized trimers from diverse viral variants were purchased from the Native Antigen Company including B.1.1.7</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>B.1.1.7</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Leakage was quantified around the injection sites using Image Studio software (LI-COR Biosciences).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Image Studio</div><div>suggested: (Image Studio Lite, RRID:SCR_013715)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Following sequencing of sample libraries, quality control was performed on the fastq files to ensure that sequencing reads met preestablished cutoffs for number of reads and quality using FastQC (version 0.11.8) (73) and MultiQC (version 1.8) (74).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FastQC</div><div>suggested: (FastQC, RRID:SCR_014583)</div></div><div style="margin-bottom:8px"><div>MultiQC</div><div>suggested: (MultiQC, RRID:SCR_014982)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Quality filtering and adapter trimming were performed using BBduk tools (version 38.76, https://sourceforge.net/projects/bbmap).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>https://sourceforge.net/projects/bbmap</div><div>suggested: (BBmap, RRID:SCR_016965)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Remaining reads were aligned to the ENSEMBL GRCh38 human reference genome assembly (release 33) using STAR (version 2.7.0f) (75), and gene frequencies were counted using featureCounts (version 2.0.0) within the Subread package (76).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ENSEMBL</div><div>suggested: (Ensembl, RRID:SCR_002344)</div></div><div style="margin-bottom:8px"><div>STAR</div><div>suggested: (STAR, RRID:SCR_004463)</div></div><div style="margin-bottom:8px"><div>featureCounts</div><div>suggested: (featureCounts, RRID:SCR_012919)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Comparative analysis of DEGs was performed using a negative binomial distribution model used by DESeq2 (version 1.28.1) (77) as implemented in R (version 4.0.3).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>DESeq2</div><div>suggested: (DESeq, RRID:SCR_000154)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Hierarchical clustering of DEGs and visualization were performed using the ComplexHeatmap (version 2.4.2) and pheatmap package (version 1.0.12).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ComplexHeatmap</div><div>suggested: (ComplexHeatmap, RRID:SCR_017270)</div></div><div style="margin-bottom:8px"><div>pheatmap</div><div>suggested: (pheatmap, RRID:SCR_016418)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Identified DEGs were analyzed by STRING to identify predicted protein-protein interaction networks as well as enriched pathway analysis (https://string-db.org/).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>STRING</div><div>suggested: (STRING, RRID:SCR_005223)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistics: All data were plotted and quantitative analyses performed using GraphPad Prism 8 software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.10.472151: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">AF647-conjugated anti-ALFA single-domain antibody (NanoTag, #N1502-AF647) and anti-NUP98 rabbit monoclonal antibody (C39A3, Cell Signaling, #2598) were diluted by factors of 500 and 50 in 1% BSA/PBS, respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>AF647-conjugated anti-ALFA single-domain antibody</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>AF647-conjugated anti-ALFA single-domain</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-ALFA</div><div>suggested: (Antibodies-Online Cat# ABIN125862, RRID:AB_11186338)</div></div><div style="margin-bottom:8px"><div>anti-NUP98</div><div>suggested: (Cell Signaling Technology Cat# 2598, RRID:AB_2267700)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then, cells were incubated with goat anti-rabbit secondary antibody conjugated with AF568 (Thermo Fisher Scientific, #A11036</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: (Thermo Fisher Scientific Cat# A-11036, RRID:AB_10563566)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell culture: U2OS cell lines (engineered from HTB-96, ATCC) were maintained in complete DMEM (low glucose (1g/L) Dulbecco’s modified Eagle’s medium (DMEM, Thermo Fisher, #10567022) supplemented with 10% Fetal Bovine Serum (FBS, Thermo Fisher, #A31605), 50 IU ml-1 penicillin, and 50 μg ml-1 streptomycin (Thermo Fisher, #15140122)) at 37°C in a humidified atmosphere with 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>U2OS</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>HTB-96</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The recombinant His6-EGFP used in the GFP intensity calibration (Fig. 1b) was expressed in Rosetta 2 (DE3) competent cells (Millipore Sigma #71400) using pDual-EGFP plasmid (Addgene, #63215)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pDual-EGFP</div><div>suggested: RRID:Addgene_63215)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For the calibration, the U2OS stable cell line expressing H2A-Halo was transfected with the GFP-2A-ORF6 plasmid and prepared in an 8-well chamber slide in the same way as in the dose-response characterization.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GFP-2A-ORF6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Oligonucleotides for PCRs were purchased from IDT or Genewiz.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Genewiz</div><div>suggested: (GENEWIZ, RRID:SCR_003177)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The imaging cycle was repeated at 3–6-hour interval at different wells, which was fully automated by using Journal macro in MetaMorph Software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MetaMorph Software</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Computational image analysis: Custom Python codes were used for quantitative image analysis of the time-lapse images.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">NIS-Elements software was used to control the hardware.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NIS-Elements</div><div>suggested: (NIS-Elements, RRID:SCR_014329)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.10.472169: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: PBMCs were obtained from a healthy donor with informed consent, at the Department of Transfusion Medicine (NIH).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibodies: Previously published Ab VH and VL amino acid sequences against SARS-CoV-2 N (# N1833) and SARS-CoV-2 S (# H434) were commercially synthesized, cloned into a human IgG1 vector backbone, produced and purified (Synbio Technologies).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>human IgG1</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells: Vero cells (# CCL-81), BHK-21 (# CCL-10), Caco-2 (# HTB-37), Calu-3 (# HTB-55), CHO-K1 (# CCL-61), CHO-pgsA-745 (# CRL-2242), CHO-pgsB-618 (# CRL-2241), CHO-pgsD-677 (# CRL-2244), CHO-pgsE-606 (# CRL-2246), HEK293-FT (# CRL-11268), A549 (# CCL-185) and MOLT-4 (# CRL-1582) cells were from the American Type Culture Collection (ATCC).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero, BHK-21, Caco-2, Calu-3 and HEK293-FT cells were grown in DMEM with GlutaMAX (Thermo Fisher # 10566016).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK-21</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Caco-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">CHO-K1, CHO-pgsA-745, CHO-pgsB-618, CHO-pgsD-677, CHO-pgsE-606 and A549 cells were grown in F-12K medium (Thermo Fisher # 21127022).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHO-K1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CHO-pgsE-606</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">PBMCs, MOLT-4 and MonoMac-1 cells were grown in RPMI 1640 (Thermo Fisher # 11875119).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MonoMac-1</div><div>suggested: DSMZ Cat# ACC-252, RRID:CVCL_1425)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">BHK-21_hACE2, CHO-K1_hACE2, HEK293-FT_hACE2 and A549_hACE2 cells were grown in their correspondent medium with 250-500 μg/ml of blasticidin (Invivogen # ant-bl-1).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549_hACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The TCID50 and PFU of virus in clarified culture medium was determined on Vero cells after staining with crystal violet.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: CLS Cat# 605372/p622_VERO, RRID:CVCL_0059)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Abs and serum were titrated and specificity was tested, by flow cytometry on HEK293-FT cells transiently expressing SARS-CoV-2 N (Addgene # 141391), S (BEI # NR-52310) or Sst. Immunofluorescence: For confocal microscopy imaging, 2.5 x 104 cells were seeded on 12 mm glass coverslips in 24-well plates in indicated medium with gentamycin (25 μg/ml) overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293-FT</div><div>suggested: RRID:CVCL_6911)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then, 1 x 105 CHO-K1_hACE2 cells (SARS-CoV-2-infectable) were homogeneously mixed and co-seeded with indicated non-infectable cell type, being co-cultured overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHO-K1_hACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">PBMCs, MonoMac-1 and MOLT-4 cells (1.25 x 105) were placed on the upper compartment and separated from the lower chamber by a 3 or 5 μm pore size filter.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MOLT-4</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">At 24 hpi, infected target cells were washed with DPBS and the medium was replaced with 50 μl of RPMI 1640 with 4% low IgG serum (Promega # G711A) containing 5 x 104 Jurkat effector cells (Promega # G701A) and serial dilutions of indicated human mAbs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Jurkat</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mouse polyclonal anti-SARS-CoV-2 Sst serum was produced as followed: 8-to-12-week C57B6 mice (Taconic Farms Inc) were immunized with 4 μg of Sst diluted in DPBS, adjuvanted by TiterMax® Gold (MilliporeSigma # T2684) (2:1) in 50 μl volume via intramuscular injections.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57B6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, a semi-confluent 60 mm plate was seeded with each cell line and co-transfected with 0.5 μg of pCMV(CAT)T7-SB100 (Transposase vector, Addgene # 34879) and 5 μg of pSBbi-Bla hACE2 (Transposon vector), using TransIT-LT1 Transfection Reagent (Mirus Bio), following manufacturer instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV(CAT)T7-SB100</div><div>suggested: RRID:Addgene_34879)</div></div><div style="margin-bottom:8px"><div>pSBbi-Bla hACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The open reading frame of hACE2 (kindly provided by Sonja Best from NIAID/NIH) was cloned into pSBbi-Bla vector (Addgene # 60526) as described 31.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>hACE2</div><div>suggested: RRID:Addgene_1786)</div></div><div style="margin-bottom:8px"><div>pSBbi-Bla</div><div>suggested: RRID:Addgene_60526)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Maximum intensity projections (MIPs) were processed from z-stacks (at least 15 0.3 μm z-steps per image); and for background correction (Gaussian filter) and color processing, using Imaris (Bitplane).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Imaris</div><div>suggested: (Imaris, RRID:SCR_007370)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Animations (gifs) were generated with Photoshop 2022 (Adobe).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Photoshop</div><div>suggested: (Adobe Photoshop, RRID:SCR_014199)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were analyzed with FlowJo (Tree Star) and plotted with Prism v9.1.1 software (GraphPad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Statistical analyses were performed using GraphPad Prism software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Response to reviewers

      Reviewer #1

      I believe that this is a very sound and authoritative study. The analysis of all data seems appropriate and robust, and many connections between the data (and subsets of data) and their possible interpretations have been considered. In fact, in the massive Results section, some interpretations are supported by cited references (this is not meant as a critique). However, I wonder about the length of the Results section, and the balance between it and the relatively short Discussion section. It is difficult for me to nail down any part of Results that might be shortened, as I could not find clear redundancies. I also think that the level of speculation is absolutely warranted, and I did not find excessive claims being made to this or that end. Rather, I suggest to broaden the perspective somewhat (in their Discussion; see below under Significance), which might allow people with a less mechanistic perspective to grasp the potential relevance of this work for non-model plant systems studied mostly by evolutionary geneticists.

      Response: We thank the reviewer for their kind remarks. We have spent a very large amount of time trying to streamline the results section and we are not sure if it would be possible to shorten it any further without removing critical details.

      We appreciate the reviewer’s comment to add more detail to the discussion to make it more appealing to evolutionary geneticists and we have added the following lines to the discussion section: “The WISO or “weak inbreeder/strong outcrosser” model (Brandvain & Haig, 2005) emerges from the dynamics of parental conflict and parent-of-origin effects. Under this model, a parent from populations with higher levels of outcrossing is exposed to higher levels of conflict and can thus dominate the programming of maternal resource allocation in a cross with an individual from a population with lower levels of outcrossing. Such a phenomenon has been observed in numerous clades including Dalechampia, Arabidopsis, Capsella and Leavenworthia (Brandvain & Haig, 2018; İltaş et al., 2021; Lafon-Placette et al., 2018; Raunsgard et al., 2018). Intriguingly, loss of function phenotypes in the RdDM pathway are more severe in recently outcrossing species than in A.thaliana (Grover et al., 2018; Wang et al., 2020) and suggests that RNA Pol IV functions are more elaborate and important in these species. This raises the possibility that the role for RNA Pol IV and RdDM in parental conflict that we describe in A.thaliana here is likely heightened in and mediates the elevated level of parental conflict in species that are currently or have been recently outcrossing.”

      One aspect that might warrant more scrutiny is the mapping of sRNA reads to the reference genome. I found the short section of this (M&M section, page 20, lines 23-25) to be too brief. It is not clear to me which of ShortStack's v3 weighting scheme the authors used, which is relevant for multi-mapping reads (see NR Johnson et al. 2016, G3). In addition, it is not mentioned whether zero mismatches were allowed. Perhaps this is described in more detail in Erdmann et al. (2017), but even if so, it deserves to be clarified here.

      Response: Small RNA reads were aligned after allowing two mismatches. This was indicated in the bowtie command (‘bowtie -v 2’ where v 2 indicates two mis-matches). We have added text to expand on the meaning of the commands.

      We have also expanded the commands used for ShortStack. We used the “Placement guided by uniquely mapping reads (-u)” option to divide the multi-mapping reads.

      The manuscript is well-written and concise, despite the length of the Results section. The verbal clarity and absence of typos or grammatical issues is superb. I did find some of the Figures to be somewhat "un-intuitive", in the sense that it takes acute concentration for an outsider (of sorts) to gather and interpret the underlying data. This is probably due to the many cross-comparisons of differences between two genotypes on one axis and those of a different pair of genotypes on the other axis. I am not sure how this issue can be ameliorated (nor whether this is really necessary); however, from a technical point of view, all Figures and Suppl. Figures are really well-done.

      Response: We thank the reviewer for their kind remarks. We have strived to make the figures easier to understand but we are aware that the figures do require a lot of concentration. We haven’t found an easy way to fix this. We thank the reviewer for patiently going through the figures.

      The list of references seems adequate in terms of citing relevant (both older and very recent) publications. However, almost all cited papers concern Arabidopsis or other model species; I suggest to consider adding a few relevant studies on non-Brassicaceae (whether considered model taxa or not), in conjunction with my suggestion (in Significance) to potentially broaden the scope by searching for natural phenomena that also involve parent-of-origin effects on endosperm/seed development. Curiously, many of the references are "incomplete" in the sense of stopping with the journal's name, then stating the doi, i.e. they lack volume numbers and page/article numbers. This should be harmonized throughout.

      Response: We have added references to non-Brassicaceae species and have also fixed the references.

      Reviewer #2: This manuscript provides evidence that a loss of either the maternal or paternal copy of NRPD1 have different, and sometime opposite, effects on the accumulation of small RNAs and on expression of a subset of genes, with a loss of the maternal copy having more substantial effects. The manuscript is well written, and the conclusions, as far as they go, are justified by the data, which are effectively presented. The overall effect is subtle but informative and according to the authors support a parental conflict model for imprinting. The experiments failed to find a smoking gun in the form of a mechanism to explain how or why the maternal and paternal alleles have different effects and the explanation for a lack of clear phenotypic differences was reasonable, but untested. I would have like to see it tested by looking in a plant species that is outcrossing and highly polymorphic. However, I do appreciate that the observation that the male and female alleles can have distinct effect when mutant is an important clue. My specific comments below may reflect confusion on my part, rather than real issues. If that is that I hope that confusion can aid in clarifying what are in places quite subtle points.

      Response: We thank the reviewer for their comments. We agree that it would be potentially informative to do similar experiments in an outcrossing species but that this is beyond the scope of this manuscript. Additionally, loss of NRPD1 or other components of the RdDM pathway has dramatic effects on gametogenesis in some examined outcrossing species(Grover et al., 2018; Wang et al., 2020), which could prevent the detection of subtle parent-of-origin effects on seed development.

      Page 6, last paragraph: "Because the endosperm is triploid, in these comparisons there are 3 (wild-type), 2 (pat nrpd1+/-), 1 (mat nrpd1+/-) and 0 (nrpd1-/-) functional NRPD1 alleles in the endosperm. However, NRPD1 is a paternally expressed imprinted gene in wild-type Ler x Col endosperm and the single paternal allele contributes 62% of the NRPD1 transcript whereas 38% comes from the two maternal alleles (Pignatta et al., 2014). Consistent with paternal allele bias in NPRD1 expression, mRNA-Seq data shows that NRPD1 is expressed at 42% of wild- type levels in pat nrpd1+/- and at 91% of wild-type levels in mat nrpd1+/- (Supplementary Table 6)". I would think this would really complicate the analysis. Should all of the dosage values include NPRD1 imprinting values? That is to say, expressed in terms of expression values? This is also a bit confusing. The maternal copies together express 38% of the transcript, so why isn't the mat nrpd1 at 68%, rather than 91%? In any event, given this imprinting and differences in dosage of the male and female it appears that two variables, parental origin and expression levels are being compared. Since 91% is awfully close to 100%, are the mat pat comparisons really just comparing low with nearly normal expression of NRPD1? And actually, given that, the outsized effect of the mat nrpd1 +/- is even more striking.

      Response: We included the details of dosage rather than imprinting values because the potential for buffering of expression upon loss of one allele could not be discounted. Indeed, we do find that the endosperm transcriptome buffers against the loss of the maternal or paternal alleles (Supplementary Table 6). The reviewer is correct in pointing out that the outsized effect of mat nrpd1+/- on gene expression is even more striking, and strongly supports our view that these effects are parental rather than endospermic.

      To reduce confusion in this section, we removed the details about 38% maternal allele transcripts obtained from our previous study, and instead report only the observed values from this study (which are also consistent with the previously reported paternally-biased expression of NRPD1 in endosperm).

      Page 4, Line 16. I'm afraid it's still a bit difficult to understand what was being compared what in this section. Please clarify.

      Response: The authors in this previously published study compared sRNAs obtained from wild-type whole seeds (which consists of three different tissues, including endosperm) with mutant endosperm. We are pointing out that the difference in tissue composition makes the effect of nrpd1 mutation hard to disentangle from the tissue differences between the two genotypes.

      Page 5, Line 5. I'm sure this is fine, but it's not entirely clear what is from the previously published paper and what is reanalysis here. All the crosses and measurements were made then, but not organized in this way?

      Response: This data was indeed previously published. In that analysis, we had pooled results from different crosses and calculated significance between genotypes using chi-square tests. During a later study (Satyaki and Gehring, 2019), we realized that we were losing information by ignoring the seed abortion values per cross. So, a reanalysis of that data on a cross by cross basis allowed us to find strong evidence for maternal and paternal effects.

      Page 6, Line 26. This is an excellent dosage series, but it's complicated by imprinting. So it's not 3, 2, 1, 0 effective copies. If we set the paternal copy at ~1 and each maternal at ~0.1, then it's 1.2 (wild type), 0.20 (pat nrpd1+/-), 1 (mat nrpd1+/-), and 0 (nrpd1-/-).

      Response: At the genomic DNA level, its 3, 2,1 and 0 doses. The reviewer’s comment on the transcriptional dose is not clear to us. Based on measured gene expression levels, relative wild-type NRPD1 transcriptional dose =1, pat nrpd1+/- is 0.42, and mat nrpd1+/- is 0.91.

      Page 6, line 31. Is the main thing we are comparing the difference between expression at 42% verses 91% of wild type?

      Response: We are using the small RNA-seq data alongside the mRNA-seq data to argue that loss of mat and pat nrpd1+/- have no impact on overall Pol IV activity in endosperm (as measured by small RNA production). A nrpd1 heterozygous endosperm has almost the same small RNA profile as a wild-type endosperm. Thus any effects seen in the endosperm, including the effects on mRNA expression described later in the manuscript, are likely parental rather than zygotic endospermic effects.

      Page 7, line 11. So, the overall effect in either direction on smRNA gene targets was really quite small, and I'm guessing the effect on gene expression was even smaller.

      Response: The effects of loss of maternal or paternal Pol IV on sRNAs was indeed small (Fig. 1/Fig. S3). Effect of loss of maternal Pol IV on gene expression was substantially large and distinct from the relatively small impacts observed upon loss of paternal Pol IV (Fig. 3) This observation supports the view that Pol IV mediates parent-of-origin effects on gene expression.

      Page 7, line 17. I take it that it is this difference, rather than the overall numbers that is of interest.

      Response: Correct. The lack of a relationship between sRNAs impacted upon loss of mat and pat nrpd1 is additionally suggestive of parent-of-origin effects

      Page 9, line 2. Really interesting, since one might expect that these are methylated loci that would be expected to be fed into any existing embryo maintenance methylation pathway. Surprising that they are maintained independently.

      Response: It is indeed surprising that Pol IV activity in parents can have different impacts on sRNAs in the endosperm. It should be noted though, that as described in Erdmann et al 2017 and in this paper later on, many endosperm sRNA loci are in fact not associated with endosperm DNA methylation. In addition, sRNA loci that are dependent on paternal Pol IV activity are more likely to be associated with DNA methylation than are sRNA loci associated with maternal Pol IV activity. These points have been described in Figure S8.

      Page 9, line 22. Proportion of total imprinted genes? Did the mutant obviate/enhance the imprinting?

      Response: We have modified the manuscript to describe effects on imprinted genes: “ The expression of imprinted genes is known to be regulated epigenetically in endosperm. In mat nrpd1+/- imprinted genes were more likely to be mis-regulated than expected by chance (hypergeometric test p-15) – 15 out of 43 paternally expressed and 45 out of 128 maternally expressed imprinted genes were mis-regulated in mat nrpd1+/- while two maternally expressed imprinted genes but no paternally expressed imprinted genes were mis-regulated in pat nrpd1+/- (Table S6).” We have also added a new supplementary figure (Fig. S6) that describes the impacts of NRPD1 loss of imprinted gene expression.

      Page 9, line 27. How could 2) occur in the homozygous mutant?

      Response: Loss of NRPD1 may impact gene expression in both parents. When the nrpd1-/- mutant endosperm is investigated, we are also examining the consequences of the inheritance of these disrupted gene expression states. We refer to this as epistatic interactions of mat and pat nrpd1.

      Page 10, line 9. Interesting!

      Response: We strongly agree!

      Page 10, line 11. Is this 2.7 versus 2.18 significant because it's statistically significant, or because it's conceptually significant?

      Response: We are pointing out that the 2.7-fold value is quite similar to the predicted value of 2.18-fold, which is arrived at by simply summing the effects of mat nrpd1 and pat nrpd1. This is a conceptually significant point.

      Are the examples in 3D representative, or the most convincing examples? And a big difference in ROS1 is of some concern, since that may well be expected to affect imprinting indirectly. I know I'm being picky here, but the pattern is so intriguing I'd be worried about confirmation bias.

      Response: The examples in 3D are representative for those genes with significant changes in expression in both mat and pat nrpd1, and other genes also behave similarly. The antagonistic effect described for 3D can also be observed as a much broader trend affecting hundreds of genes to varying extents in Fig 3C and 3E-H. The concern about ROS1 is not clear to us but we agree that an effect of ROS1 may be one way that NRPD1 controls gene expression.

      Page 10, line 18. Ok, but 0.123 is a pretty subtle negative correlation. Although I do appreciate that it clearly is not a positive correlation. If I'm understanding correctly, this was the "aha" moment, because it's exactly what one might expect of NRPD1 from the mother and father or working at cross purposes. But the numbers are getting awfully small here.

      Response: It is unclear how to calibrate our expectations of effect sizes considering that our study is the first (to our knowledge) to make such a measurement involving gene expression in parental conflict. A review of the few empirical examples of parental conflict’s impact on seeds shows that parental conflict may drive small changes in seed size (Brandvain and Haig, 2018).

      The evolution of quantitative traits maybe driven by selection for large effects at a small number of loci and/or by selection of small effects at a large number of loci. In a similar vein, parental conflict can impact seed phenotypes either via large effects at a few loci or via small effects at a large number of loci. Our analysis described in Fig 3D-H can fit either possibility. Large effects can be found at a few loci such as SUC2 and PICC (Fig. 3D). Smaller antagonistic effects can be found at hundreds of loci as shown in Figure 5A. The negative correlation described in this figure can be observed even upon dropping the genes that show a statistically significant differential expression in both mat and pat nrpd1+/- (slope after dropping genes significantly mis-regulated in both mat and pat nrpd1+/- is -0.126). In summary, a correlation of -0.123 strongly supports the existence of a widespread antagonistic regulatory effect.

      Page 10, line 29. The point simply being that that other phenomenon is also significant even if the differences are that large?

      Response: We are pointing out that the magnitude of the effects we see are similar to that observed for phenomenon such as dosage compensation.

      Page 12. So, there is no effect on cleavage and no obvious effect on flanking siRNA clusters. The suspense is building...

      Page 12, line 24. And not in potential regulatory regions? CNSs?

      Response: We did not identify a significant enrichment for differentially methylated regions in regulatory regions. We used the relative distance function in bedtools (https://bedtools.readthedocs.io/en/latest/content/tools/reldist.html) to calculate the relationship between the genomic location of DMRs and genomic location of a differentially expressed gene. This analysis was chosen as it does not make a priori assumptions about the size of the regulatory region of a gene. A broad association between DMRs and differentially expressed genes would be indicated by a frequency far greater than 0.02. We show the results of this analysis in Fig. S8F; we find no evidence for significant enrichment of DMRs in the regulatory regions of differentially expressed genes.

      Page 12, line 28. I guess it depend on whether or not the changes are in regulatory sequences no immediately apparent as part of the gene, doesn't it?

      Response: We examined DNA methylation over genes here because in endosperm, unlike in other tissues, many small RNAs are genic. Moreover, DNA methylation within the gene may control transcript abundance (Eimer et al., 2018; Klosinska et al., 2016). We have also examined regulatory regions adjacent to genes in Fig S8F and found no effect.

      Line 13, line 2. Not sure it's that important, but couldn't you chop all of these genes in half and see if they are no longer significant collectively?

      Response: We do not think that this will provide a useful insight.

      Page 14, line 15. I'm afraid I'm getting confused here with the terms cis and trans here. Just to be clear, cis means a direct effect of small RNAs that are dependent on NRPD1 on a gene and trans means anything else? But in this context, it's not clear that is what is meant. Do you mean that gene expression is determined and preset in the gametophyte? What are the levels of expression of NRPD1 in the two gametophytes?

      Response: The reviewer’s interpretation of cis and trans is correct. However, the cis imprints may be preset in gametophytes or in the sporophytic tissues that surround or give rise to the gametophyte. Pol IV is known to be active either in gametophyte or in related sporophytic tissues in both the mother and the father(Kirkbride et al., 2019; Long et al., 2021; Olmedo-Monfil et al., 2010).

      Page 14, line 19. Prior to fertilization?

      Response: Yes, that is the idea. As described in the manuscript, Pol IV activity in either the parental sporophyte or gametophyte prior to fertilization could impact gene expression in the endosperm after fertilization.

      Page 14, line 27. Do you mean driven by, or just associated with?

      Response: In response to the comment, we have replaced the phrase “driven by” with “due to” for increased clarity. In wild-type, DOG1 is predominantly expressed from the paternal allele. In mat nrpd1+/-, the paternal allele is somewhat upregulated but the maternal allele, which is almost silent in wild-type, is highly expressed in mat nrpd1+/-.

      Page 15, line 26. And this is really the issue. The primary conclusion, backed up by the lack (I'm assuming) of phenotypic differences between mat NRPD1 -/+ and pat NRPD1 +/- suggests that the observed differences in expression are not particularly important, unless the exceptional cases are informative.

      Response: We are not sure whether the reviewer means “issue” in a negative, neutral, or positive light. Seed phenotypes are often subtle and we have not examined phenotypic differences in sufficient detail to comment.

      Page 15, line 12. Yes, but I'm not at all clear what the mechanism for this is.

      Response: We have tested and falsified multiple hypotheses to explain how Pol IV can regulate gene expression in endosperm. Considering the complex genetics and the difficulty of isolating endosperm, we have concluded that this is a matter for a future study. The point of this study is the discovery of Pol IV’s parental effects.

      Page 15, line 23. Since this is a very small subset of genes, are these genes that you might expect to play a role in parental conflict?

      Response: The functions of most genes in endosperm remain unknown. However, some have a likely role in conflict. SUC2 is antagonistically regulated by parental Pol IV (Fig. 3D). SUC2 transports sucrose, the key form of carbon imported into seeds from the mother (Sauer & Stolz, 1994).

      Page 15, line 33. Indeed, these could be the informative exceptions.

      Response: We believe the reviewer means that the identify of strongly antagonistically regulated genes may be informative in terms of thinking about these results in the context of parental genetic conflict, which we agree with.

      Page 15, line 29. Hardly surprising, given that the paternal copy of NRPD1 is expressed at a higher level than the maternal copies, is it?

      Response: It is actually somewhat surprising since we show in Fig. 2 that the sRNA production in mat and pat nrpd1+/- are comparable to that of wild-type. The higher contribution of NRPD1 from the paternal copy does not really explain the methylation differences

      Page 16, line 1. So this is what you mean by in cis. Presetting?

      Response: The reviewer’s previous interpretation of cis (acting directly at a target gene) is correct. However, the cis imprints may be preset in gametophyte or in the sporophytic tissues that surround or give rise to the gametophyte. Pol IV is known to be active in gametophytes and in related sporophytic tissues in both the mother and the father.

      These are intriguing results that would benefit from a test of the hypothesis by comparing these result with those obtained in an outcrossing plant species.

      Response: We agree that it would interesting and informative to perform similar experiments in an outcrossing species. However, loss of NRPD1 or other components of the the RdDM pathway have dramatic effects on gametogenesis in outcrossing species (Grover et al., 2018; Wang et al., 2020), preventing the detection of subtle parent-of-origin effects on seed development. Additionally, this would be a separate study.

      Reviewer #3

      We thank the reviewer for their comments.

      • Expression of NRPD1 was 42% of WT in paternal nrpd1 and 91% of WT in maternal nrpd1, yet throughout the paper the effect of maternal nrpd1 was far stronger than paternal nrpd1. The authors may also want to confirm that protein levels follow the same pattern, in case protein degradation or post-transcriptional regulation may play a role.

      Response: We show in Fig. 2 that sRNA production in mat and pat nrpd1+/- are similar to wild-type endosperm. This strongly suggests that NRPD1 protein is produced at functionally equivalent levels in wild-type, mat and pat nrpd1+/-. The finding that mat nrpd1+/- has a stronger effect on gene expression and small RNAs, despite having higher levels of NRPD1 transcript in endosperm, is consistent with our conclusion that the effects we are observing in heterozygous endosperm are due to NRPD1 action before fertilization.

      P. 9 line 1 - this only seems to be true for maternal ISRs, not paternal ISRs; this claim should be narrowed.

      Response: Accordingly, we have modified the text here to : “In summary, these results indicate that most maternally and some paternally imprinted sRNA loci in endosperm are dependent on Pol IV activity in the parents and are not established de novo post-fertilization.”

      A small number of sRNA loci become highly depleted in maternal nrpd1 but not paternal nrpd1 (Fig. 1D, F, Fig. 2C) - are these siren loci?

      Response: This is an interesting question. Siren loci have not been defined in Arabidopsis but are described as loci with high levels of sRNAs in ovules, seed coat, endosperm and embryo (Grover et al., 2020). Loci losing sRNAs in maternal nrpd1+/- include a large number of maternally expressed imprinted sRNAs (mat ISRs). We do not know if mat ISR loci are expressed in the ovule. In Erdmann et al (2017), we excluded loci that were also expressed in the seed coat from mat ISRs. Thus, these loci meet only some of the conditions for being defined as siren loci.

      Fig. 2 suggests that many of the downregulated sRNA regions in maternal nrpd1 are maternally biased to begin with. Related, are genic sRNAs more likely to be affected by maternal or paternal nrpd1 than non-genic or TE sRNAs?

      Response: As described in Fig. 1B and S3, loss of maternal NRPD1 has more impacts on the sRNA landscape. As a percentage of total loci, genes are more likely to be affected than TEs.

      For the sRNA loci shown in Fig. 2C, how is % maternal affected in maternal vs. paternal nrpd1? These ISRs are normally maternal or paternal biased, does this change in maternal or paternal nrpd1?

      Response: We assess the allelic bias of ISRs only when they have at least ten reads in the genotypes being compared. In mat nrpd1+/-, most mat ISRs lose almost all their reads (Fig. 2) and we can assess allelic bias only at 107/366 mat ISRs. As seen in the Rev. comment. Fig1, these 107 lose their maternal bias. In pat nrpd1+/-, loci with maternally biased sRNAs show somewhat increased expression (Fig 2E) but do not show an appreciable change in maternal bias (Figure Review 1). All paternal ISRs do not show any dramatic impacts on allelic bias in mat or pat nrpd1+/-. We have not added this additional datapoint to our paper because we were worried that the paper was becoming too dense – a concern also voiced by reviewer 1. However, we can add this to the manuscript if the reviewer prefers.

      • Might have missed this, but I didn't see the gene ontology results (p9 line 16) shown anywhere? Would like to see significance values, fold enrichments, etc. In particular, the group of paternal nrpd1 up-regulated genes seems too small to have much confidence for GO enrichment analysis.

      Response: We have added a Supplementary Table 7 with outputs of GO analyses.

      • I would suggest expanding the analysis in Fig. 3D-H to explore whether the additive model is more predictive of nrpd1-/- expression levels than other potential models (epistatic, etc.) in general at all genes, or only at the subsets of genes shown, independently of whether the effects are large enough to pass the arbitrary significance cutoffs used in E-H. Identifying specifically which genes do and don't follow this additive pattern could help dissect mechanism. For example, genes following this pattern might share a TF binding site for a TF that is regulated by Pol IV.

      Response: While we are interested, we currently cannot explore other models such as epistasis as this would require knock-down of NRPD1 in the endosperm and we plan to do this as part of a future study.

      1. 13 line 26 - how do changes in CG methylation in maternal or paternal nrpd1 compare to changes in dme or ros1? Do either set of DMRs significantly overlap dme or ros1 DMRs? Could some of these be explained by changes in ROS1 expression, since ROS1 is a Pol IV target?

      Response: Yes. It’s entirely possible that a subset of observed gene expression changes are linked to changes in ROS1 expression. However, there are no comparable methylation data for ROS1 in the endosperm. A potential role for ROS1 has been discussed on Page 11, line 4. Comparison with DMRs in the dme endosperm is difficult. dme mutant endosperm has low non-CG methylation (Ibarra et al., 2012). We have unpublished data showing that the expression of genes involved in RNA-directed DNA methylation (RdDM) is reduced in the dme endosperm. It is therefore difficult to understand if and how DME-mediated demethylation may impact RdDM.

      P. 10 line 3 - is the overlap of 36 out of 51 genes unlikely to occur by chance

      Response: A hypergeometric test indicates that this is indeed significant. We have added it to text on Page 9, line 34.

      In sRNA and mRNA-seq libraries, what was the overall maternal/paternal ratio in each library? Did loss of Pol IV affect this?

      The graphs above show the maternally derived fraction of mRNA and sRNA libraries for different genotypes. Please note that the Ler nrpd1 mutant was generated by backcrossing Col-0 nrpd1+/- into Ler. Some Col-0 regions remain in this background and are called “hold-outs”. Reads mapping to these hold-outs have been excluded while calculating the maternal fraction of each library described in the graph above. We cannot confidently judge if the overall maternal fraction of the mRNA transcriptome is affected by loss of NRPD1 as we likely need more replicates. However, we find that loss of all NRPD1-dependent sRNAs (as in the nrpd1 null mutant) leaves behind sRNAs that roughly reflect the genomic 2:1 ratio.

      P. 9 line 22 - how many paternally and maternally expressed imprinted genes were considered? Were imprinted genes statistically more likely to be misregulated in mat nrpd1?

      Response: We considered 128 maternally and 43 paternally expressed genes that had been previously been identified as imprinted in Col x Ler crosses (Pignatta et al 2014). We have modified the manuscript to describe effects on imprinted genes: “ The expression of imprinted genes is known to be regulated epigenetically in endosperm. In mat nrpd1+/- imprinted genes were more likely to be mis-regulated than expected by chance (hypergeometric test p-15) – 15 out of 43 paternally expressed and 45 out of 128 maternally expressed imprinted genes were mis-regulated in mat nrpd1+/- while two maternally expressed imprinted genes but no paternally expressed imprinted genes were mis-regulated in pat nrpd1+/- (Table S6). “ We have also added a supplementary figure (Figure S6) that focuses on genic mRNA imprinting in NRPD1 heterozygotes and homozygous mutants.

      References cited in the response

      Brandvain, Y., & Haig, D. (2005). Divergent Mating Systems and Parental Conflict as a Barrier to Hybridization in Flowering Plants. The American Naturalist, 166(3), 330–338. https://doi.org/10.1086/432036

      Brandvain, Y., & Haig, D. (2018). Outbreeders pull harder in a parental tug-of-war. Proceedings of the National Academy of Sciences, 115(45), 11354–11356. https://doi.org/10.1073/pnas.1816187115

      Eimer, H., Sureshkumar, S., Singh Yadav, A., Kraupner-Taylor, C., Bandaranayake, C., Seleznev, A., Thomason, T., Fletcher, S. J., Gordon, S. F., Carroll, B. J., & Balasubramanian, S. (2018). RNA-Dependent Epigenetic Silencing Directs Transcriptional Downregulation Caused by Intronic Repeat Expansions. Cell. https://doi.org/10.1016/j.cell.2018.06.044

      Grover, J. W., Burgess, D., Kendall, T., Baten, A., Pokhrel, S., King, G. J., Meyers, B. C., Freeling, M., & Mosher, R. A. (2020). Abundant expression of maternal siRNAs is a conserved feature of seed development. Proceedings of the National Academy of Sciences of the United States of America, 117(26), 15305–15315. https://doi.org/10.1073/pnas.2001332117

      Grover, J. W., Kendall, T., Baten, A., Burgess, D., Freeling, M., King, G. J., & Mosher, R. A. (2018). Maternal components of RNA ‐directed DNA methylation are required for seed development in Brassica rapa. The Plant Journal, 94(4), 575–582. https://doi.org/10.1111/tpj.13910

      Ibarra, C. A., Feng, X., Schoft, V. K., Hsieh, T.-F., Uzawa, R., Rodrigues, J. A., Zemach, A., Chumak, N., Machlicova, A., Nishimura, T., Rojas, D., Fischer, R. L., Tamaru, H., & Zilberman, D. (2012). Active DNA Demethylation in Plant Companion Cells Reinforces Transposon Methylation in Gametes. Science, 337(6100), 1360–1364. https://doi.org/10.1126/science.1224839

      İltaş, Ö., Svitok, M., Cornille, A., Schmickl, R., & Lafon Placette, C. (2021). Early evolution of reproductive isolation: A case of weak inbreeder/strong outbreeder leads to an intraspecific hybridization barrier in Arabidopsis lyrata. Evolution, 75(6), 1466–1476. https://doi.org/10.1111/evo.14240

      Kirkbride, R. C., Lu, J., Zhang, C., Mosher, R. A., Baulcombe, D. C., & Chen, Z. J. (2019). Maternal small RNAs mediate spatial-temporal regulation of gene expression, imprinting, and seed development in Arabidopsis. Proceedings of the National Academy of Sciences, 116(7), 2761–2766. https://doi.org/10.1073/pnas.1807621116

      Klosinska, M., Picard, C. L., & Gehring, M. (2016). Conserved imprinting associated with unique epigenetic signatures in the Arabidopsis genus. Nature Plants, 2, 16145. https://doi.org/10.1038/nplants.2016.145

      Lafon-Placette, C., Hatorangan, M. R., Steige, K. A., Cornille, A., Lascoux, M., Slotte, T., & Köhler, C. (2018). Paternally expressed imprinted genes associate with hybridization barriers in Capsella. Nature Plants, 4(6), 352–357. https://doi.org/10.1038/s41477-018-0161-6

      Long, J., Walker, J., She, W., Aldridge, B., Gao, H., Deans, S., Vickers, M., & Feng, X. (2021). Nurse cell­–derived small RNAs define paternal epigenetic inheritance in Arabidopsis. Science, 373(6550). https://doi.org/10.1126/science.abh0556

      Olmedo-Monfil, V., Durán-Figueroa, N., Arteaga-Vázquez, M., Demesa-Arévalo, E., Autran, D., Grimanelli, D., Slotkin, R. K., Martienssen, R. A., & Vielle-Calzada, J.-P. (2010). Control of female gamete formation by a small RNA pathway in Arabidopsis. Nature, 464(7288), 628–632. https://doi.org/10.1038/nature08828

      Raunsgard, A., Opedal, Ø. H., Ekrem, R. K., Wright, J., Bolstad, G. H., Armbruster, W. S., & Pélabon, C. (2018). Intersexual conflict over seed size is stronger in more outcrossed populations of a mixed-mating plant. Proceedings of the National Academy of Sciences, 115(45), 11561–11566. https://doi.org/10.1073/pnas.1810979115

      Sauer, N., & Stolz, J. (1994). SUC1 and SUC2: two sucrose transporters from Arabidopsis thaliana; expression and characterization in baker’s yeast and identification of the histidine-tagged protein. The Plant Journal, 6(1), 67–77. https://doi.org/10.1046/j.1365-313X.1994.6010067.x

      Wang, Z., Butel, N., Santos-González, J., Borges, F., Yi, J., Martienssen, R. A., Martinez, G., & Köhler, C. (2020). Polymerase IV Plays a Crucial Role in Pollen Development in Capsella. The Plant Cell, 32(4), 950–966. https://doi.org/10.1105/tpc.19.00938

    1. SciScore for 10.1101/2021.12.08.21267417: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Ethical statement: Blood samples were obtained from hospitalized adults with PCR-confirmed SARS-CoV-2 infection and/or vaccinated individuals who were enrolled in a prospective cohort study approved by the Biomedical Research Ethics Committee at the University of KwaZulu–Natal (reference BREC/00001275/2020).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Authentication: Cell lines have not been authenticated.<br>Contamination: The cell lines have been tested for mycoplasma contamination and are mycoplasma negative.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were infected with 100 μL of the virus–antibody mixtures for 1 h, then 100 μL of a 1X RPMI 1640 (Sigma-Aldrich, R6504), 1.5% carboxymethylcellulose (Sigma-Aldrich, C4888) overlay was added without removing the inoculum.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>R6504</div><div>suggested: (Fitzgerald Industries International Cat# 10R-6504, RRID:AB_11190346)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Foci were stained with a rabbit anti-spike monoclonal antibody (BS-R2B12, GenScript A02058) at 0.5 μg/mL in a permeabilization buffer containing 0.1% saponin (Sigma-Aldrich), 0.1% BSA (Sigma-Aldrich) and 0.05% Tween-20 (Sigma-Aldrich) in PBS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-spike</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Secondary goat anti-rabbit horseradish peroxidase (Abcam ab205718) antibody was added at 1 μg/mL and incubated for 2 h at room temperature with shaking.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: (Abcam Cat# ab205718, RRID:AB_2819160)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero E6 cells were passaged every 3–4 days.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">H1299 cells were passaged every second day.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>H1299</div><div>suggested: NCI-DTP Cat# NCI-H1299, RRID:CVCL_0060)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">ACE2-expressing H1299-E3 cells were seeded at 4.5 × 105 cells in a 6 well plate well and incubated for 18–20 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>H1299-E3</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mutations were confirmed visually with BAM files using Geneious software (Biomatters).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Geneious</div><div>suggested: (Geneious, RRID:SCR_010519)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistics and fitting: All statistics and fitting were performed using MATLAB v.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MATLAB</div><div>suggested: (MATLAB, RRID:SCR_001622)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on page 9. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.09.21267557: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: Maternal blood and infant cord blood used were collected at delivery in an EDTA collection tube and were processed within 24 hours.<br>IRB: Study approval: This study was approved by the institutional review board of the UCSF (IRB# 20-32077), Santa Clara Valley Medical Center (IRB# 20-021), Oregon Health and Sciences University (IRB# STUDY00021569) and Marshall University (IRB# 1662248-1).<br>Consent: Written informed consent was obtained from all participants.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Thirty vaccinated and 30 infected pregnant women were chosen from these two cohorts to be matched on the approximate gestational age of first vaccine dose and the earliest confirmed SARS-CoV-2 test.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Correlations between NT50 titers and IgG antibody titers were analyzed using Pearson’s rank test.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Twenty-four hours before administration of virion, 2.5×104 Calu-6 hACE2 cells were plated per well of a 96-well plate in 200 μL of complete DMEM.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-6 hACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The SARS-CoV-2 spike pseudotyped virions harvested from the supernatant of the 293T cells were assayed for titration and then aliquots mixed for 30 minutes with heat-inactivated plasma samples.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Results were analyzed by Prism software version 9 (Graph Pad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">IgG Antibody Measurement: Antibodies to SARS-CoV-2 IgG was measured using the Pylon 3D automated immunoassay system (ET Healthcare, Palo Alto, California) as described previously (63).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ET Healthcare</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Heatmaps were created in R studio (pheatmap) and GraphPad Prism.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      There are several limitations and strength of our study. First, we have few patients that were exposed in the first trimester. However, this is balanced against a significant strength of our study in that the participants were matched by timing of vaccine or live viral exposure during pregnancy, allowing direct comparison of vaccine-induced and natural immunity in pregnancy and different timepoints in pregnancy. Second, we do not have sequencing data for the natural infection cohort, and thus do not know which strains caused the infection. However, all infected patients tested positive before January 2021, prior to broad circulation of the Alpha and Delta variants in the United States (60, 61). Presumably, individuals infected with the Delta variant would have higher specific nAb activity against this strain and may also have differing responses to the other variants. Future studies would be helpful to understand the immunogenicity evoked by the Delta, Mu, and other variants in pregnancy. Third, detailed antibody characterization, such as IgG subtyping or fucosylation state, is needed to understand the role of these factors in the dynamics of maternal-fetal antibody transfer. This should be addressed in future studies. In conclusion, vaccination in pregnancy is highly effective in generating nAbs against all strains of SARS-CoV-2 tested, although activities against the Kappa, Delta, and Mu variants are reduced. Vaccine-induced neutralizing activity is comparable to natural im...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.07.471597: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were incubated on ice for 15 minutes with anti- HA antibody (Invitrogen HA Tag Mouse anti-Tag, DyLight® 650 conjugate, Clone: 2-2.2.14; 1:100 dilution) and Streptavidin-PE (Thermo Fisher scientific; catalog number S866; 1:100 dilution).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti- HA</div><div>suggested: (Claes Örvel lab; Karolinska Institute Cat# anti-MuV rabbit 144, RRID:AB_2747378)</div></div><div style="margin-bottom:8px"><div>anti-Tag</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Competitive indirect enzyme linked immunoassay (competitive ELISA): Nunc™ MaxiSorp 96-well Immuno-Plates (Thermo Fisher Scientific, Illkirch, France) were coated with 200 μL/well of AffinityPure goat anti-mouse IgG+IgM (H+L) antibody (Jackson Immuno Research Laboratories Inc., Pennsylvania, USA) at 10 μg/mL in 50 mM potassium phosphate buffer, and incubated overnight (16h) at 22 ± 2 °C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgG+IgM</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK293 Freestyle™ were transiently transfected at a density of 2.5 106 cells/mL in 100mL Freestyle medium (Thermo-Fisher) by addition of 150 μg plasmid and 1.8 mL of linear polyethylenimine (PEI, 0.5 mg/ml) (Polysciences).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Then, the culture medium of each plate containing the VERO E6 cells is removed and 500 μL of each VHH/virus mixture is added to each well in duplicate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VERO E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Gap repair transformations were made in plasmid pNT VHH72 between restriction sites NheI and NotI with 1 μg of digested vector and a molar ratio of 12:1 (library/digested vector).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pNT</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Genes coding for the various RBD domains were cloned in the pCAGGS RBD-SARS-CoV-2 plasmid, which was a kind gift from Florian Krammer lab.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAGGS RBD-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Reads were demultiplexed and each sample was processed separately using the Galaxy platform (https://usegalaxy.org/) using the functions described in Blankenberg et al 45.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Galaxy</div><div>suggested: (Galaxy, RRID:SCR_006281)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After seven days at 37°C, 120 rpm, 8% CO2, supernatant was purified using HiTrap Protein A for VHH-Fc constructs or HisTrap Excel for RBD constructs, following the manufacturer’s instructions (GE Healthcare).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HisTrap Excel</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Affinity measurement by BioLayer Interferometry: Binding kinetics were determined using an Octet RED96 instrument (ForteBio).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BioLayer</div><div>suggested: (Harvard Medical School Center for Macromolecular Interactions Core Facility, RRID:SCR_018270)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The initial structure of VHH72 was built by homology modelling using the MODELLER software 46 and the coordinates of VHH72 in PDB structure 6WAQ as template 18.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MODELLER</div><div>suggested: (MODELLER, RRID:SCR_008395)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Analysis of the trajectories was achieved using in-house scripts written in the macrolanguage of CHARMM v42b153.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHARMM</div><div>suggested: (CHARMM, RRID:SCR_014892)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Figures were produced with PyMol [PyMOL Molecular Graphics System, Version 2.0 Schrödinger, LLC.] and Gnuplot 5.1.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMOL</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div><div style="margin-bottom:8px"><div>Gnuplot</div><div>suggested: (Gnuplot, RRID:SCR_008619)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      As a result, a second generation of antibodies might be required to overcome these limitations and could be obtained by reshaping the initial sequences by conferring them the necessary properties, such as affinity and selectivity, to have optimal therapeutic efficacy for treatment in humans. From this perspective, many teams have proposed a wide range of methods to generate candidates with the expected properties, mostly increased affinity.29-32 Affinity maturation aims at improving biological activity by adjusting the kinetic parameters of the binding to the target, which in turn may confer greater therapeutic efficacy.25,33 However, the magnitude of this effect depends largely on the epitope recognized by the antibody and the initial affinity along with the format of the antibody and its valence.25 In the context of the current COVID-19 pandemic, several studies have described affinity maturation of VHH or conventional antibodies to enhance their binding to SARS-CoV-2 antigens, by CDR-swapping approaches 34, saturation mutagenesis in CDRs 35,36 or light-chain shuffling36. In recent years, Deep Mutational Scanning (DMS) approaches have emerged as a powerful tool for understanding protein/protein interactions. Deep Mutational Scanning (DMS) explores in a selected protein all possible unique substitutions, i.e. all unique mutations for each position. DMS defines mutational landscape of the protein and helps to understand the interaction modalities as recently shown for the RBD...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.07.471590: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: The protocols performed were also approved by the Institutional Committee for the use and care of experimental animals (CICUAE) from National University of San Martin (UNSAM) (01/2020).<br>IACUC: Studies using SARS-CoV-2 were done in a Biosafety level 3 laboratory and the protocol was approved by the INBIRS Institutional Biosafety Committee.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Animals and immunizations: Eight-week-old female BALB/c or C57BL/6 mice were obtained from IIB UNSAM animal facility.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">An anti-human IRDye 800 (1/2000 dilution) was used as a secondary antibody for Infrared fluorescence detection on the Odyssey Imaging System.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IRDye 800</div><div>suggested: (Rockland Cat# 609-132-003, RRID:AB_220112)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Determination of antibody levels in serum and BAL: RBD-specific antibody responses (IgA, IgG, IgG1, IgG2a) were evaluated by indirect ELISA.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgA , IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgG1 , IgG2a</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The protein was expressed from a pcDNA 3.1 plasmid in HEK 293 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293</div><div>suggested: CLS Cat# 300192/p777_HEK293, RRID:CVCL_0045)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines: Human embryonic kidney cell line 293T expressing the SV40 T-antigen (HEK-293T, ATCC #CRL-11268) was kindly provided by Cecilia Frecha (Instituto de Medicina Traslacional e Ingeniería Biomédica, Hospital Italiano de</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: ATCC Cat# CRL-11268, RRID:CVCL_1926)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For lentivirus production, HEK-293T cells were maintained in DMEM10 containing 100 µg/ml G418 (Sigma Aldrich. St Louis, MO)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">African green monkey kidney cell line Vero E6 ATCC #CRL-1586 were cultured at 37°C in 5% CO2 in Dulbecco’s Modified Eagle’s high glucose medium (Sigma Aldrich) supplemented with 5% fetal bovine serum (FBS) (Sigma Aldrich)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6 ATCC #CRL-1586</div><div>suggested: ATCC Cat# CRL-1586, RRID:CVCL_0574)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudovirus neutralization assay (PsVNA): HEK-hACE2 cells were seeded in 96-well plates in DMEM10 and incubated 24h at 37°C and 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-hACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Fifty μl of the mixtures were then added t Vero cells monolayers for an hour at 37°C (MOI=0.004).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Three mice per group were euthanized at day 5 post-challenge to evaluate organ viral loads, by plaque assay on Vero E6 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Animals and immunizations: Eight-week-old female BALB/c or C57BL/6 mice were obtained from IIB UNSAM animal facility.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/c</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>C57BL/6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The protein was expressed from a pcDNA 3.1 plasmid in HEK 293 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA 3.1</div><div>suggested: RRID:Addgene_20407)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmids: Plasmid pCMV14-3X-Flag-SARS-CoV-2 S was a gift from Zhaohui Qian (Addgene plasmid # 145780)68, psPAX2 was a gift from Didier Trono (Addgene plasmid # 12260); and pLB-GFP was a gift from Stephan Kissler (</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV14-3X-Flag-SARS-CoV-2</div><div>suggested: RRID:Addgene_145780)</div></div><div style="margin-bottom:8px"><div>psPAX2</div><div>suggested: RRID:Addgene_12260)</div></div><div style="margin-bottom:8px"><div>pLB-GFP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudoviruses were obtained by co-transfection with psPAX2, pCMV14-3xFlag SARS-CoV-2 S and pLB GFP by using polyetherimide (PEI) (1:2, DNA:PEI).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV14-3xFlag SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Statistical analysis and plotting were performed using GraphPad Prism 8 software (GraphPad Software, San Diego, CA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on page 35. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.08.471707: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: This work is licensed under a Creative CommonsAttribution 4.0 International (CC BY 4.0) license, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.<br>IRB: (HAARVI) study and was approved by the University of Washington Human Subjects Division Institutional Review Board (STUDY00000959).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were washed 4 × in TBST, then anti-human (Invitrogen) horseradish peroxidase-conjugated antibodies were diluted 1:5,000 and 50 μL added to each well and incubated at 37°C for 1 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">One day post-transfection, cells were infected with VSV(G*ΔG-luciferase)(Kaname et al., 2010) and after 2 h were washed five times with DMEM before adding medium supplemented with anti-VSV-G antibody (I1-mouse hybridoma supernatant, CRL-2700, ATCC)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-VSV-G</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, HEK293T cells in DMEM supplemented with 10% FBS, 1% PenStrep seeded in 10-cm dishes were transfected with the plasmid encoding for the corresponding S glycoprotein using lipofectamine 2000 (Life Technologies) following the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Relative luciferase units were plotted and normalized in Prism (GraphPad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Harlequin

      harlequin, n.

      (ˈhɑːlɪkwɪn, -kɪn)

      Forms: 6 harlicken, 7 harlaken(e, -keen(e, -kin, arlequin, 7– harlequin.

      [a. Fr. harlequin (1585 in Hatz.-Darm.), arlequin, ad. It. arlecchino.    The Italian word is possibly the same as OFr. Hellequin, Herlequin, Herlekin, Hierlekin, Hielekin, Helquin, Hennequin, a devil celebrated in mediæval legend, esp. in la maisnie Helequin, Harlequini familia (Miège), a company or troop of demon horsemen riding by night. Of this the ultimate origin is possibly Teutonic. See Diez, Mahn Etymol. Untersuch., Godefroy, Skeat.]

      I. 1.I.1 a.I.1.a A character in Italian comedy, subsequently in French light comedy; in English pantomime a mute character supposed to be invisible to the clown and pantaloon; he has many attributes of the clown (his rival in the affections of Columbine) with the addition of mischievous intrigue; he usually wears particoloured bespangled tights and a visor, and carries a light ‘bat’ of lath as a magic wand.    (In reference to quot. 1590, it may be noticed that the arlecchino is said, in Italian Dictionaries, to have originally represented the simple and facetious Bergamese man-servant. Cf. the stage Irishman.)

         1590 Nashe Almond for Parrat Ded., Taking Bergamo in my waye homeward‥It was my happe‥to light in felowship with that famous Francattip' Harlicken, who‥asked me many particulars of the order and maner of our playes.    1606 Day Ile of Guls ii. iii, Like a Harlakene in an Italian comedy.    1607 Day, etc. Trav. Eng. Bro. (1881) 56 Here's an Italian Harlaken come to offer a play to your Lordship.    1612 Heywood Apol. Actors ii. 43 To omit all the Doctors, Zawnyes, Pantaloones, Harlakeenes, in which the French, but especially the Italians, have beene excellent.    1676 Dryden Epil. Etheredge's Man of Mode, Those nauseous Harlequins in Farce may pass.    1704 Addison Italy (1766) 68 Harlequin's part is made up of blunders and absurdities.    1727 Fielding Love in Sev. Masques ii. i, A man of sense acts a lover just as a Dutchman would a harlequin.    1756 Foote Eng. fr. Paris i. Wks. 1799 I. 107 A bundle of contradictions, a piece of patch-work, a mere harlequin's coat.    1757 Smeaton in Phil. Trans. L. 204 As if an harlequin had leaped thro' the window.    1759 Johnson Gen. Concl. Brumoy's Grk. Theat. (R.), They represented‥a complete tragedy or comedy in the same manner as dumb harlequin is exhibited on our theatres.    1778 J. Q. Adams Diary 28 Apr. Wks. 1851 III. 146 In the evening we went to the Italian comedy, where I saw a harlequin for the first time.    1817 Byron Beppo iii, Harlequins and clowns, with feats gymnastical.    1858 Hawthorne Fr. & It. Jrnls. I. 81 The papal guard in their‥party-colored dress‥looking not a little like harlequins.

      b.I.1.b transf. A buffoon in general; a fantastic fellow.

         1878 Carlyle in Ld. R. Gower My Remin. xxvii. (1883) II. 175 [He called Beaconsfield] ‘that melancholy harlequin’.

      2.I.2 A small breed of spotted dogs. So G. harlekin (Grimm).

         1774 Goldsm. Nat. Hist. III. viii. 286 The mongrel kind‥the Dutch mastiff, the harlequin,‥and the Dane.

      3.I.3 More fully harlequin duck. A northern species of duck, Histrionicus minutus, with fantastically variegated plumage.

         1772 Forster in Phil. Trans. LXII. 419 Anas. A. Histrionica‥Harlequin Duck.    1863 Kingsley Water Bab. vii. 269 Swans and brantgeese, harlequins and eiders.    1876 Smiles Sc. Natur. xiii, The Harlequin‥and the Eider duck visit the loch occasionally in winter.    1884 Harper's Mag. Apr. 706/2 Harlequin-ducks of the gayest plumage.

      4.I.4 The Oriental or noble opal. Also attrib.

         1873 C. Robinson N.S. Wales 62 Opals‥Amongst the polished stones are some of the harlequin class.

      II. 5.II.5 attrib. or as adj. Having the characteristics of a harlequin or of his dress; burlesque, ludicrous; particoloured.    harlequin china, harlequin service, harlequin set, a name given to a set of cups, etc., of different colours and patterns.

         1779 Wilkes Corr. (1805) V. 223 A formal declaration of war by harlequin heralds.    1806–7 J. Beresford Miseries Hum. Life (1826) vi. i, A china Shakspeare and Milton in Harlequin jackets.    1859 Helps Friends in C. Ser. ii. I. Addr. to Rdr. 10 At this Harlequin period of the world what is written one week may seem obsolete the next.    1871 Mrs. Whitney Real Folks xiii. (Cent.), She had six lovely little harlequin cups on a side-shelf in her china-closet‥rose, and brown, and gray, and vermilion, and green, and blue.

      6.II.6 Comb., as harlequin-leap, harlequin-preacher; harlequin-looking adj. Also harlequin bat, an Indian species, Scotophilus ornatus, of pale tawny-brown, variegated with white spots; harlequin beetle, a South American longicorn beetle, Acrocinus longimanus, with particoloured elytra; harlequin brant, the American white-fronted goose, Anser albifrons gambeii, also called pied or speckled brant; harlequin bug Austral., either of two bugs with brightly-coloured markings, Dindymus versicolor or Tectocoris diophthalmus; harlequin cabbage-bug, an American hemipterous insect, Murgantia histrionica, having brilliant markings; †harlequin deer, ? a particoloured fallow deer; harlequin duck: see 3; harlequin (eye)glasses, spectacles, spectacles with the frame tilted upwards at the corners (named from their resemblance to a harlequin's mask); harlequin fish, (a) Rasbora heteromorpha, a small cypriniform fish found in Thailand, Malaya, and Sumatra; (b) Othos dentex, the scarlet rock cod, a perciform fish found along the coasts of south and west Australia; harlequin-flower, a name of the South African genus Sparaxis, N.O. Iridaceæ, with great variety of colouring; harlequin fly, a fly of the genus Chironomus; harlequin garrot, the golden-eye duck or pied wigeon, a species of Clangula; harlequin (Great) Dane, a Great Dane having a black and white coat; harlequin moth, the magpie moth, Abraxas grossulariata; harlequin opal = harlequin n. 4; harlequin pigeon, an Australian Bronze-wing pigeon; harlequin ring (see quot.); harlequin rose, a variety of rose with striped petals; harlequin smiler, Merogymnus eximius, a small Australian perciform fish; harlequin snake, the coral-snake and other species of Elaps, so called from their variegated colouring of orange and black.

         1865 Wood Homes without H. viii. (1868) 176 The magnificent insect which is known to entomologists as the *Harlequin Beetle‥belongs to the wood-burrowers.    1882 Stanford's Compend. Geogr., Central Amer. 128 The most deadly enemy of the gum-elastic tree is‥the well-known ‘harlequin beetle’.

         1945 K. C. McKeown Austral. Insects xv. 81 The commonest and best known species [of Pyrrhocoridæ] is the striking red and black insect popularly known as the *Harlequin Bug (Dindymus versicolor Sch.), found throughout Australia, and attacking apples and other fruits.    1970 T. E. Woodward et al. in Insects of Australia (C.S.I.R.O.) xxvi. 450/1 Tectocoris diophthalmus (Thunb.), the ‘harlequin bug’ of Queensland, attacks the bolls of cotton, and is common on other malvaceous plants.

         1872 C. V. Riley in 4th Ann. Rep. Missouri Entomol. 35 *Harlequin cabbage bug.

         1778 Eng. Gazetteer s.v. Ickworth, A park well stocked with the fine *harlequin-deer.

         1945 ‘L. Lewis’ Birthday Murder (1951) i. 7 Her *harlequin eyeglasses became crooked on her pointed face.    1961 Wodehouse Service with Smile ix. 130 She was regarding him austerely through her harlequin glasses.

         1956 M. West Gallows on Sand x. 115 A school of *harlequin fish flirted away from my descent, their tube-like bodies flashing blue and gold, their ugly faces smiling like a circus clown's.    1959 Times 3 Mar. 7/1 The ‘guinea pigs’ in these experiments are inch-long harlequin fish‥from south-east Asia.

         1900 Miall & Hammond (title) The structure and life history of the *harlequin fly (Chironomus).    1956 Nature 17 Mar. 534/1 The family Chironomidae has scarcely been studied at all in New Zealand.‥ Known colloquially as the ‘Harlequin fly’, they are, it seems, almost ubiquitous.

         1863 Baring-Gould Iceland 162 A magnificent *harlequin garrot floated unmoved within a stones throw.

         1800 *Harlequin Dane [see Dane 2].    1909 Daily Chron. 28 July 7/1 A black and white or harlequin Great Dane.    1948 ‘Sigma’ in B. Vesey-Fitzgerald Bk. Dog ii. 420 When smart men drove a well-appointed turnout, a Dalmatian or harlequin Great Dane was necessary to complete the picture.

         1813 Examiner 1 Feb. 69/2 A *harlequin-leap through a window.

         1835 Willis Pencillings I. xv. 111 The *harlequin-looking Swiss guard.

         1887 Col. & Indian Exhib., Rep. Col. Sect. 70 Some specimens are of a rare kind, known as ‘*Harlequin’ opals.

         1847 Leichhardt Jrnl. vii. 227 We saw two flocks of the *harlequin pigeon (Peristera histrionica).

         1760 Jortin Erasm. II. 195 Stories of a *Harlequin-Preacher, who used to surprise his audience with his monkey-tricks.

         1877 W. Jones Finger-ring 414 *Harlequin-rings‥were so called because they were set round with variously-coloured stones.

         1876 T. Hardy Ethelberta (1890) 194 They were striped, red and white, and appeared to be leaves of the *Harlequin rose.

         1955 A. Ross Australia 55 ix. 118 Sharks‥whose presence causes‥coral trout and *Harlequin Smilers suddenly to evaporate.    1964 T. C. Marshall Fishes of Great Barrier Reef 326 Harlequin Smiler Merogymnus eximius.

         1885 C. F. Holder Marvels Anim. Life 131 The coloring of the *harlequin [snake]‥is exceedingly rich.

         1940 Optometric Weekly 19 Dec. 1262 The *Harlequin spectacle frame is protected by patents.    1962 J. Braine Life at Top xii. 154 Her harlequin spectacles didn't make her expression any less severe.

      Hence harlequina, -ess, a female harlequin. harlequiˈnesque, harleˈquinic adjs., having the style of a harlequin. harleˈquinically adv., after the manner of a harlequinade. ˈharlequinism, the performance of a harlequin; action characteristic of a harlequin. ˈharlequinize v., to convert into a harlequin; to dress or do up in fantastical colouring.

         1867 *Harlequina [see harlequinade a.]

         1882 Stevenson New Arab. Nts. II. xii. 222 His blouse was stained with oil colours in a *harlequinesque disorder.

         1785 in Cornh. Mag. (1883) June 718 Humorous and characteristic masks; among the best of which we reckon‥a whimsical *harlequiness.

         1804 Miniature No. 4. 14 (title) Ode to the Rainbow, in the genuine Fantastical, Unmeaning, *Harlequinic Style of Sentimental Sonneteers.

         1824 W. Taylor in Monthly Rev. CIII. 47 The Tale‥is‥so *harlequinically metamorphosing.

         1808 Edin. Rev. XII. 203 The philosophical *harlequinism of that valiant knight.    a 1852 Webster Wks. (1877) I. 345 In popular governments, men must not‥be disgusted by occasional exhibitions of political harlequinism.

         1876 R. Broughton Joan ii. viii. III. 225 The small dining-room‥is travestied indeed and *harlequinized like the rest of the house.

    1. SciScore for 10.1101/2021.12.08.471684: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: Sample size was determined based on subject availability and conformity of sample collection to the described timeline.<br>Consent: Study approval: All participants provided written informed consent prior to participation in the study, which was performed according to protocols approved by the Institutional Review Board (IRB) of the SUNY Upstate Medical University under IRB number 1587400 for experimental samples and 1839296-1 for pre-pandemic control samples.<br>IRB: Study approval: All participants provided written informed consent prior to participation in the study, which was performed according to protocols approved by the Institutional Review Board (IRB) of the SUNY Upstate Medical University under IRB number 1587400 for experimental samples and 1839296-1 for pre-pandemic control samples.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Staining and Flow Cytometry: Stimulated PBMC were washed twice in warm complete culture media and transferred to polypropylene 96-well plates for staining in the dark with 50μL of spike tetramer probe cocktail containing 100ng Spike per probe (total 200ng) at 4°C for 1 hour prior to surface staining in FACS wash buffer with the antibodies listed in table S1 at 4°C for 30min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>30min</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were washed and antigen-specific antibody binding was detected using anti-human IgG HRP (MilliporeSigma, St. Louis, MO, USA, Cat. SAB3701362), or anti-human IgM HRP (SeraCare, Milford, MA, USA, Cat. 5220-0328).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antigen-specific</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human IgM</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Stained cells and compensation controls were acquired on a BD Fortessa or Aria II and analyzed using FlowJo (BD), version 10.8.0.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody binding data were analyzed by nonlinear regression (One site specific binding with Hill slope) to determine EC50 titers, reported as Kd values, in GraphPad Prism 9.1.0 (GraphPad Software, La Jolla, CA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analyses: Statistical analyses were performed using Prism version 9.1.0 (GraphPad), except for correlations.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Graphics: Study design and assay workflow schematics were created with BioRender.com.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BioRender</div><div>suggested: (Biorender, RRID:SCR_018361)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on pages 27 and 29. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.07.471539: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: Human plasma collection and cohort selection: Plasma was collected from healthcare worker (HCW) volunteers who received the mRNA vaccine (Moderna mRNA-1273 or Pfizer-BioNTech BNT162B2) between November 2020 and January 2021 as approved by the Yale Human Research Protection Program Institutional Review Board (IRB Protocol ID 2000028924).<br>IRB: Human plasma collection and cohort selection: Plasma was collected from healthcare worker (HCW) volunteers who received the mRNA vaccine (Moderna mRNA-1273 or Pfizer-BioNTech BNT162B2) between November 2020 and January 2021 as approved by the Yale Human Research Protection Program Institutional Review Board (IRB Protocol ID 2000028924).<br>Consent: After obtaining informed consent, peripheral blood was collected in EDTA tubes from human subjects, and plasma was extracted upon centrifugation.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Timed mating and injections: C57BL/6J mice were mated overnight and females were checked for the presence of seminal plugs each morning, designated E0.5.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-HERV-W/Syncytin-1 antibody and ELISAs: 96-well MaxiSorp plates (Thermo Scientific #442404</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-HERV-W/Syncytin-1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mouse Anti-HERV-W monoclonal antibody (Abnova #H00030816-M06) was serially diluted to generate a standard curve.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-HERV-W</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were washed three times with PBS-T (PBS with 0.1% Tween-20) and 50 μl of HRP anti-Human IgG Antibody (GenScript #A00166) diluted 1:5000 in dilution solution were added to each well.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Human IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">50 ul of HRP anti-Mouse IgG1 Antibody (Southern Biotech #1070-05) diluted 1:3000 in dilution solution were added to each standard well.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HRP anti-Mouse IgG1 Antibody</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-Mouse IgG1</div><div>suggested: (SouthernBiotech Cat# 1070-05, RRID:AB_2650509)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Timed mating and injections: C57BL/6J mice were mated overnight and females were checked for the presence of seminal plugs each morning, designated E0.5.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57BL/6J</div><div>suggested: RRID:IMSR_JAX:000664)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All statistical analyses comparing fetal viability and growth measurements were performed with GraphPad Prism 8.4.3 software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Human plasma collection and cohort selection: Plasma was collected from healthcare worker (HCW) volunteers who received the mRNA vaccine (Moderna mRNA-1273 or Pfizer-BioNTech BNT162B2) between November 2020 and January 2021 as approved by the Yale Human Research Protection Program Institutional Review Board (IRB Protocol ID 2000028924).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Yale Human Research Protection Program</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Limitations of our mouse model of vaccination include the use of a single dose of mRNA-1273 during pregnancy whereas the full vaccine schedule in humans is two doses approximately 28 days apart, longer than the murine gestation period. While this study provides the first step in establishing safety for early vaccine approaches in pregnancy, we surveyed litters only for overt birth defects and size at E18.5. Findings of this work await validation with results from the ongoing human studies of vaccination during the first trimester. Our study does not capture potential effects of mRNA vaccination timing during late gestation. Finally, using human data we demonstrated that circulating anti-syncytin-1 antibodies do not rise following COVID-19 mRNA vaccination with either mRNA-1273 or BNT162B2. These findings support the mounting evidence that a syncytin-1-based mechanism of infertility is not supported by scientific observations [19,21]. This study is limited as we only interrogated the presence of anti-syncytin-1 in a total of 51 subjects. Larger studies are warranted to further assess anti-syncytin-1 antibody status in women who receive the mRNA vaccines. Millions of women and pregnancies continue to be impacted by the ongoing COVID-19 pandemic and by vaccine hesitancy. In the absence of complete clinical trial data, many women are choosing to vaccinate during pregnancy after weighing the risks and benefits of their situation. Thus, filling in gaps in knowledge, particularly su...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. e sobering finding i s t h a t e v e n i f g l o b a l w a r m i n g i s l i m i t e d t o 2 ° C , h e a t e v e n t s that once occurred twice per century will happen every 3 to 4 years—and will tend to coincide with droughts, com-pounding the impacts

      with global warming, floods, drought and other horrible weather events are likely to increase, which goes against sustainable development

    1. SciScore for 10.1101/2021.12.04.471153: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After decanting the supernatant, cells were resuspended in 50 μL FACS buffer and blocked with 10 μL of 1 mg/mL IgG (Thermo Fisher, Human IgG Isotype Control, 02-7102, RRID: AB_2532958) for 5 min at 4°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Human IgG Isotype Control</div><div>detected: (Thermo Fisher Scientific Cat# 02-7102, RRID:AB_2532958)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After blocking, 2.5 μL of 0.2 μg/μL α-ACE2 antibody from R&D Systems (Human ACE-2 Alexa Fluor® 488-conjugated Antibody, FAB9332G-100UG) was added and incubated for 30 min at 4°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>α-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines and cell culture: HEK293FT cells were purchased from Thermo Fisher/Life Technologies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293FT</div><div>suggested: RRID:CVCL_6911)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudotype virus production: HEK293FT or Lenti-X HEK293T cells (Lenti-X) were used to produce SARS-CoV-2 pseudotyped lentivirus (Spike-lenti) for optimizing viral production; Lenti-X cells were used to generate Spike-lenti for all viral inhibition experiments.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: KCB Cat# KCB 200744YJ, RRID:CVCL_0063)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The Spike protein from pcDNA3.1-SARS2-Spike was a gift from Fang Li (Addgene plasmid # 145032; http://n2t.net/addgene:145032; RRID:Addgene_145032);34 this gene was cloned into a modified pcDNA 3.1 backbone (Clontech-Takara) with a beta-globin intron in the 5’ untranslated region for pseudotyping lentivirus.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div></div><div>detected: RRID:Addgene_145032)</div></div><div style="margin-bottom:8px"><div>pcDNA 3.1</div><div>suggested: RRID:Addgene_20407)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The Tet3G transactivator (pLVX-EF1a-TET3G) and cognate TRE3GV promoter (pLVX-TRE3G</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLVX-EF1a-TET3G</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">) (Takara) were cloned into modified pGIPZ and pLVX (Takara) backbones, respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pGIPZ</div><div>suggested: RRID:Addgene_121488)</div></div><div style="margin-bottom:8px"><div>pLVX</div><div>suggested: RRID:Addgene_174088)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were then transfected via calcium phosphate method.51 Briefly, DNA (3 μg pMD2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pMD2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">G encoding vesicular stomatitis virus G protein (VSV-G), 8 μg psPAX2 packaging vector, and 10 μg of transfer plasmid encoding desired transgene) were diluted with sterile H2O and added to 2M CaCl2 to achieve a final concentration of 0.3M CaCl2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>psPAX2</div><div>suggested: RRID:Addgene_12260)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines and cell culture: HEK293FT cells were purchased from Thermo Fisher/Life Technologies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Thermo Fisher/Life</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">53 Band intensities from ImageJ for the sACE2 standards were analzyed in MATLAB (Mathworks, R2021b) as a function of the amount of ACE2 added in number of molecules (assuming a 115 KDa size for sACE2), and a linear regression was performed to generate a calibration curve.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div><div style="margin-bottom:8px"><div>MATLAB</div><div>suggested: (MATLAB, RRID:SCR_001622)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Approximately 5,000-10,000 single cells were analyzed for each sample on FlowJo software v10.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In dose-response curve experiments, the percent of transduced cells for a given treatment was normalized by the percent of transduced cells determined from that treatment’s largest dilution as depicted in Figure S5.54 Curves were then fit with a four parameter, nonlinear regression in GraphPad Prism 9.2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.05.471310: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells and pseudotype assay: 293T, Huh-7 (human liver cells), and BHKs were maintained under standard cell culture conditions in DMEM with L-glutamine, antibiotics, and 10</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Huh-7</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Westernblot: Viral pseudotypes were concentrated and 293T producer cells were lysed in 1% SDS and clarified as described previously1.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: KCB Cat# KCB 200744YJ, RRID:CVCL_0063)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Spike sequences from HCoV-229E (AB691763.1), MERS-CoV (JX869059.2), and SARS-CoV-1 (AY278741) were codon-optimized, appended with a carboxy-terminal FLAG tag sequence separated by a flexible poly-glycine linker and cloned into pcDNA3.1+ as previously described1.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1+</div><div>suggested: RRID:Addgene_117272)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Amino acid sequences for the receptor binding domain of the spike glycoprotein were aligned using ClustalW multiple sequence alignment with default parameters.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ClustalW</div><div>suggested: (ClustalW, RRID:SCR_017277)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A maximum likelihood phylogenetic tree was inferred with PhyML v.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PhyML</div><div>suggested: (PhyML, RRID:SCR_014629)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The final tree was then visualized as a cladogram with FigTree v1.4.4 (https://github.com/rambaut/figtree).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FigTree</div><div>suggested: (FigTree, RRID:SCR_008515)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.06.471455: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">These 48 HCWs ranged in age from 22-61 years (median = 37; IQR = 31.75-43.25) and included 26 male and 22 female HCWs.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were then washed and treated with 100 μL of HRP labeled anti-human-IgG antibody (31220, EDI, San Diego, CA) for 30 min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human-IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell Lines and Maintenance: HEK293T cells (CRL-11268, CVCL_1926, ATCC, Manassas, VA) and HEK293T-ACE2 cells (NR-52511, BEI Resources, ATCC, Manassas, VA) were maintained in Dulbeco’s Modified Eagles Medium (Gibco, 11965-092, ThermoFisher Scientific, Waltham, MA) supplemented with 10% (v/v)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: ATCC Cat# CRL-11268, RRID:CVCL_1926)</div></div><div style="margin-bottom:8px"><div>CVCL_1926</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To determine relative titers of harvested virus, the pseudotyped virus for each of the SARS-CoV-2 variants were used to infect HEK293T-ACE2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Constructs for Pseudotyping Virus Production: Production of lentiviral pseudotyped virus was performed using a previously reported protocol using pNL4-3-HIV-1-inGluc vector (13, 14, 21–23).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pNL4-3-HIV-1-inGluc</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">This vector is a pNL4-3-HIV-1 ΔEnv construct and contains a Gaussia luciferase reporter gene with a CMV promoter both oriented in an anti-sense orientation relative to the HIV-1 genome.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pNL4-3-HIV-1 ΔEnv</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Constructs encoding N- and C-terminal flag-tagged SARS-CoV-2 spike (S) for each variant — D614G, Alpha (B.1.1.7), Beta (B.1.351), and Delta (B.1.617.2) — were synthesized and cloned into pcDNA3.1 vector using KpnI/BamHI restriction enzyme cloning by GenScript BioTech (Piscataway, NJ).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Neutralizing titer 50% (NT50) for each serum sample was determined by non-linear regression with least squares fit in GraphPad Prism 5 (GraphPad Software, San Diego, California)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.03.21267253: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Quality control (QC) samples consisted of pooled commercial control and COVID-19 human plasma samples (as described in a previous publication [25]), and were prepared alongside clinical and calibration curve samples in each cohort.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>COVID-19</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">(Eluent additive for LC-MS; Cat# 40867) and Dimethyl sulfoxide (DMSO; Cat# 41648) were from Fluka, formic acid (LC-MS Grade; Eluent additive for LC-MS; Cat# 85178) was from Thermo Scientific™,</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Thermo Scientific™</div><div>suggested: (Thermo Scientific Wellwash Wellwash, RRID:SCR_020569)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The 6495C mass spectrometer was controlled by Agilent’s MassHunter Workstation software (LC-MS/MS Data Acquisition for 6400 series Triple Quadrupole, Version 10.1) and was operated in positive electrospray ionisation mode with the following parameters: 3500 V capillary voltage (positive), 0 V nozzle voltage (positive), 12 L/min sheath gas flow at a temperature of 280°C, 17 L/min gas flow at a temperature of 170°C, 40 psi nebulizer pressure, 166 V fragmentor voltage, 5 V cell accelerator potential.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Agilent’s MassHunter</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mass spectrometry data processing: Mass spectrometry data processing was performed with vendor-specific software: Agilent MassHunter Quantitative Analysis, v10.1 and SCIEX OS Software v2.0.1.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Agilent MassHunter Quantitative Analysis</div><div>suggested: (Agilent Masshunter Quantitative Analysis software, RRID:SCR_015040)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Prediction of WHO grade and disease outcome: For the prediction of the current WHO grade and for the outcome prediction a Support Vector Machine was used as implemented in scikit-learn 0.23.2 (sklearn.svm.SVC) [53] using default parameters (rbf-kernel) and balanced class weights (class_weight = ”balanced”).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>scikit-learn</div><div>suggested: (scikit-learn, RRID:SCR_002577)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      In our study, we overcame a common limitation of proteomic assays for their routine use - their dependency on low flow rate-chromatography [48–50]. Exploiting the high sensitivity of contemporary triple-quadrupole mass spectrometers, we demonstrate the accurate quantification of the peptide panel using analytical flow rate chromatography, which not only is robust and fast, but also routinely used in clinical laboratories for small molecule analysis, greatly simplifying the application of our assay in the clinical routine. The developed biomarker panel includes 50 peptides derived from 30 plasma proteins. The proteins are related to biological processes which have been shown to be important for the COVID-19 host response and pathophysiology, like the innate immune response, the coagulation system or the complement cascade [14,25,26,35]. The assay is hence monitoring processes that are closely linked to disease progression and the exceptionally diverse clinical presentation of patients with SARS-CoV-2 infection. In this study, we established the assay on two routine-laboratory-compatible LC-MRM platforms, and performed analytical validation of the key technical aspects of the assay. We demonstrate excellent sensitivity, accuracy, precision, as well as reproducibility across two different targeted mass spectrometry platforms. Of note, reagents for sample preparation and LC-MRM method setup are also commercially available in standardised kit formats. As such, the assay could be e...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.02.21267198: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: The BIDMC institutional review board approved this study (2020P000361).<br>Consent: All participants provided informed consent.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Enzyme-linked immunosorbent assay (ELISA): SARS-CoV-2 spike receptor-binding domain (RBD)-specific binding antibodies in serum were assessed by ELISA as described previously.6,7 96-well plates were coated with 2 μg/mL of SARS-CoV-2 WA1/2020, B.1.617.2 (delta), and B.1.351 (beta) RBD protein in 1× Dulbecco phosphate-buffered saline (DPBS) and incubated at 4 °C overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>B.1.351</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plates were again washed 3 times and 50 μL of SULFO-Tagged anti-Human IgG detection antibody diluted to 1x in Diluent 100 was added to each well and incubated shaking at 700 rpm at room temperature for at least 1 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Human IgG</div><div>suggested: (RevMAb Biosciences Cat# 31-1019-MK, RRID:AB_2783627)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">6 106 peripheral blood mononuclear cells well were re-suspended in 100 µL of R10 media supplemented with CD49d monoclonal antibody (1 µg/mL) and CD28 monoclonal antibody (1 µg/mL).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD49d</div><div>suggested: (BD Biosciences Cat# 347690, RRID:AB_647457)</div></div><div style="margin-bottom:8px"><div>CD28</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The next day, the cells were washed twice with DPBS, stained with aqua live/dead dye for 10 mins and then stained with predetermined titers of monoclonal antibodies against CD279 (clone EH12.1, BB700), CD4 (clone L200, BV711), CD27 (clone M-T271, BUV563), CD8 (clone SK1, BUV805), CD45RA (clone 5H9, APC H7) for 30 min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD279</div><div>suggested: (BD Biosciences Cat# 566460, RRID:AB_2744348)</div></div><div style="margin-bottom:8px"><div>CD4</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD8</div><div>suggested: (Abcam Cat# ab34397, RRID:AB_2291359)</div></div><div style="margin-bottom:8px"><div>CD45RA</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were washed twice with 1X Perm Wash buffer (BD Perm/WashTM Buffer 10X in the CytoFix/CytoPerm Fixation/ Permeabilization kit diluted with MilliQ water and passed through 0.22µm filter) and stained with intracellularly with monoclonal antibodies against IFN-γ (clone B27; BUV395), and CD3 (clone SP34.2, Alexa 700), for 30 min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IFN-γ</div><div>suggested: (BD Biosciences Cat# 563563, RRID:AB_2738277)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">RBD-specific B cell staining: PBMCs were stained with Aqua live/dead dye for 20 min, washed with 2% FBS/DPBS buffer, and cells were suspended in 2% FBS/DPBS buffer with Fc Block (BD) for 10 min, followed by staining with monoclonal antibodies against CD45 (clone HI30, BV786), CD3 (clone UCHT1, APC-R700), CD16 (clone 3G8, BUV496), CD14 (clone M5E2, BV605), CD19 (clone SJ25C, BUV615), CD20 (clone 2H7, PE-Cy5), IgM (clone G20-127, BUV395), IgD (clone IA6-2, PE), CD95 (clone DX2, BV711), CD27 (clone M-T271, BUV563), CD21 (clone B-ly4, PE-CF594), CD38 (clone HB7, BUV805), CD71 (clone M-A712, BV750) and staining with SARS-CoV-2 antigens including biotinylated SARS-CoV-2 (WA1/2020) RBD proteins (Sino Biological), SARS-CoV-2 (WA1/2020) RBD proteins (Sino Biological) labeled with FITC, at 4 °C for 30 min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD45</div><div>suggested: (Nanostring Cat# 121300104, RRID:AB_2893077)</div></div><div style="margin-bottom:8px"><div>CD3</div><div>suggested: (BD Biosciences Cat# 565119, RRID:AB_2744385)</div></div><div style="margin-bottom:8px"><div>CD16</div><div>suggested: (BD Biosciences Cat# 751323, RRID:AB_2875332)</div></div><div style="margin-bottom:8px"><div>CD14</div><div>suggested: (BD Biosciences Cat# 564054, RRID:AB_2687593)</div></div><div style="margin-bottom:8px"><div>CD19</div><div>suggested: (Agilent Cat# TC67401, RRID:AB_579635)</div></div><div style="margin-bottom:8px"><div>CD20</div><div>suggested: (BD Biosciences Cat# 740204, RRID:AB_2739954)</div></div><div style="margin-bottom:8px"><div>PE-Cy5), IgM</div><div>suggested: (Bioss Cat# bs-0336R-PE-Cy5, RRID:AB_10893125)</div></div><div style="margin-bottom:8px"><div>IgD</div><div>suggested: (Thermo Fisher Scientific Cat# 24-5093-51, RRID:AB_469565)</div></div><div style="margin-bottom:8px"><div>CD95</div><div>suggested: (BD Biosciences Cat# 741292, RRID:AB_2870823)</div></div><div style="margin-bottom:8px"><div>CD27</div><div>suggested: (BD Biosciences Cat# 751679, RRID:AB_2875665)</div></div><div style="margin-bottom:8px"><div>CD21</div><div>suggested: (BD Biosciences Cat# 748726, RRID:AB_2873130)</div></div><div style="margin-bottom:8px"><div>CD38</div><div>suggested: (BD Biosciences Cat# 742074, RRID:AB_2871359)</div></div><div style="margin-bottom:8px"><div>CD71</div><div>suggested: (BD Biosciences Cat# 746857, RRID:AB_2871661)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudovirus neutralizing antibody assay: The SARS-CoV-2 pseudoviruses expressing a luciferase reporter gene were used to measure pseudovirus neutralizing antibodies as described previously.6,7 In brief, the packaging construct psPAX2 (AIDS Resource and Reagent Program), luciferase reporter plasmid pLenti-CMV Puro-Luc (Addgene) and spike protein expressing pcDNA3.1-SARS-CoV-2 SΔCT were co-transfected into HEK293T cells (ATCC CRL_3216) with lipofectamine 2000 (ThermoFisher Scientific).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: ATCC Cat# CRL-3216, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The mixture was incubated at 37 °C for 1 h before adding to HEK293T-hACE2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T-hACE2</div><div>suggested: RRID:CVCL_A7UK)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudovirus neutralizing antibody assay: The SARS-CoV-2 pseudoviruses expressing a luciferase reporter gene were used to measure pseudovirus neutralizing antibodies as described previously.6,7 In brief, the packaging construct psPAX2 (AIDS Resource and Reagent Program), luciferase reporter plasmid pLenti-CMV Puro-Luc (Addgene) and spike protein expressing pcDNA3.1-SARS-CoV-2 SΔCT were co-transfected into HEK293T cells (ATCC CRL_3216) with lipofectamine 2000 (ThermoFisher Scientific).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>psPAX2</div><div>suggested: RRID:Addgene_12260)</div></div><div style="margin-bottom:8px"><div>pLenti-CMV Puro-Luc</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pcDNA3.1-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Fixed cells were transferred to 96-well round bottom plate and analyzed by BD FACSymphony™ system.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BD FACSymphony™</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Subsequent analyses were performed using FlowJo software (BD Bioscience, v.9.9.6).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Descriptive statistics were calculated using GraphPad Prism 8.4.3, (GraphPad Software, San Diego, California).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04999111</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">A Study of Ad26.COV2.S Administered as Booster Vaccination i…</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      We thank the reviewers for their helpful, detailed and insightful comments. We have modified the figures and rewritten large sections of the manuscript following the reviewers’ suggestions. In addition, we have incorporated new data throughout the manuscript and figures to clarify and better support our conclusions. All of these changes have significantly improved the coherence, consistency and clarity of our data, and have allowed us to better communicate the advance our findings represent for the fields of splicing and muscle development.

      Please find a point-by-point response to the reviewers’ comments below. The reviewers’ comments are in black and italics.

      Response to Reviewer 1* Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      Rbfox proteins regulate skeletal muscle splicing and function and in this manuscript, Nikonova et.al. sought to investigate the mechanisms by which Rbfox1 promotes muscle function in Drosophila.

      Using a GFP-tagged Rbfox1 line, the authors showed that Rbfox1 is expressed in all muscles examined but differentially expressed in tubular and fibrillar (IFM)muscle types, and expression is developmentally regulated. Based on RNA-seq data from isolated muscle groups, the authors showed that Rbfox1 expression is much higher in TDT (jump muscle) than IFM.

      Using fly genetics authors developed tools to reduce expression of Rbfox1 at different levels and the highest levels of muscle-specific Rbfox1 knockdown was lethal and displayed eclosion defects (deGradFP > Rbfox1-IRKK110518 > Rbfox1-RNAi > Rbfox1-IR27286). Consistently, Rbfox1 knockdown flies have reduced jumping and climbing phenotypes, due to tubular muscle defect where Rbfox1 is expressed at higher levels. Rbfox1 knockdown in IFM caused flight defects which have been shown previously. Further characterization of IFM and tubular muscles demonstrated a requirement of Rbfox1 for the development of myofibrillar structures in both fibrillar (IFM) and tubular fiber-types in Drosophila. Interestingly, knockdown or overexpression of Rbfox1 displayed hypercontraction phenotypes in IFMs which is often an end result of misregulation of acto-myosin interactions which was rescued by expression of force-reduction myosin heavy chain (Mhc, P401S), in the context of Rbfox1 knockdown (the rescue experiment could not be performed with Rbfox1 overexpression due to complex genetics).

      Authors also performed computation analyses of the Rbfox binding motifs in the fly genome and identified GCAUG motif in 3,312, 683, and 1184 genes in the intronic, 5'UTR, and 3'UTR, respectively. These genes are enriched for factors that play important roles in muscle function including transcription factors (exd, Mef2, Salm), RNA-binding proteins (Bru1), and structural proteins (TnI, encoded by wupA). Many of these gene transcripts and proteins are affected in flies with reduction or overexpression of Rbfox1. Using fly genetics, authors propose and test different mechanisms (co-regulation of gene targets by Rbfox1 and Bru1), and regulators of muscle function (exd, Me2, Salm) and structural proteins (TnI, Mhc, Zasp52, Strn-Mlck, Sls) by which these changes could affect the muscle function.

      *Overall, the characterization of Rbfox1 phenotypes and myofibrillar structure is very well elucidated, mechanisms by which Rbfox1 affects muscle function are not clear and remain largely speculative. We thank the reviewer for the positive evaluation of our phenotypic analysis of Rbfox1 knockdown in multiple muscle fiber types. This manuscript is the first detailed characterization of Rbfox1 in Drosophila muscle, extending far beyond our previous finding that Rbfox1-IR flies are flightless. Beyond behavioral and cellular phenotypes, we report that there are regulatory interactions between Rbfox1, Bruno1 and Salm and identify other Rbfox1 targets in flies. We acknowledge that there are molecular and biochemical details of specific regulatory mechanisms that remain to be elucidated, but this paper provides many foundational observations to guide future biochemical experiments and is thus important to the muscle field.

      \*Major comments**

      *1. The varying level of Rbfox1 knockdown (deGradFP > Rbfox1-IRKK110518 > Rbfox1-RNAi > Rbfox1-IR27286) was achieved by different strategies without validation at the protein level (likely due to lack of a Rbfox1 antibody). It is important to show different Rbfox1 protein level (at least with different RNAi), especially when authors propose that autoregulation of Rbfox1 causes increased level Rbfox1 transcript in case of Rbfox1-RNAi (mild knockdown). Autoregulation of Rbfox1 in mammalian cells may not be similar in flies.

      To address this comment, we have toned-down the discussion of level-dependent regulation throughout the manuscript, and have removed claims of Rbfox1 autoregulation. We appreciate the reviewer’s point that it would be ideal to be able to determine the protein levels of Rbfox1 in the different knockdown conditions. We have tested the published antibody against DmRbfox1, but it is very dirty and we see multiple bands in Western Blot. This background partially obscures the bands from 80-90 kDa at the molecular weight where we expect Rbfox1, and prevents accurate quantification (see Reviewer Figure 1). Verification of protein levels of Rbfox1 will require generation of a new antibody which is beyond the scope of this study. As we do not have a good antibody, we performed two experiments to demonstrate our ability to tune knockdown efficiency. First, we crossed Rbfox1-IRKK110518 and Rbfox1-IR27286 to UAS-Dcr2, Mef2-Gal4 and demonstrated we could enhance the phenotype (Figure 2A, B). Second, we performed knockdown with the same hairpins at different temperatures and demonstrate that stronger knockdown at higher temperature leads to stronger phenotypes with the same hairpin

      (Figure 2B). This data supports our knockdown series interpretation.

      Reviewer Figure 1. Western Blot of whole fly with anti-Rbfox1 (A2BP1) (Shukla et al., 2017). Tubulin was blotted as a loading control.

      • TnI and Act88F protein levels are inversely correlated with Rbfox1 level in IFM but did not correlate with the RNA level. Using RIP authors showed that Rbfox1 was shown to bound to wupA transcripts (has Rbfox binding sites) but not Act88F transcripts (does not have Rbfox binding sites). Authors performed Rbfox1 IP and identified co-IP of components of cellular translational machinery and propose that wupA (TnI) levels are regulated by translation or NMD (non-sense mediated decay). A follow up experiment was not performed to identify the mechanism by which TnI level is regulated by Rbfox1. *

      Further biochemical and genetic verification of the underlying mechanisms of Rbfox1 regulation in Drosophila muscle will be addressed in a future manuscript, as in vivo modulation of translation or NMD in an Rbfox1 knockdown background involves recombination to coordinate multiple genetic elements. We have modified the text to reflect this hypothesis remains to be explored in future experiments (Line 473-474).

      We have further added RT-PCR data for wupA transcript levels in IFM and TDT with Rbfox1-IRKK110518 knockdown (Figure S4 A), but as in Rbfox1-RNAi flies, there is not a significant change in expression. We do see significant downregulation of Act88F when we overexpress Rbfox1 in IFM (Figure S4 B), as well as in TDT when we knockdown Rbfox1 with either Rbfox1-IRKK110518 or Rbfox1-IR27286.

      It was known that TnI mutations (affects splice site, fliH or Mef2 binding site, Hdp-3) led to a reduction in TnI level and hypercontraction. Authors showed rescue of hypercontraction phenotype in hdp-3 background by knocking down Rbfox1, likely due to increase in wupA transcription (Mef2-dependent or independent manner). However, no rescue was observed in the fliH background. Reduced level of Rbfox1 in fliH background would be expected to cause worsening of phenotype as splicing of remaining wupA transcripts would be affected with reduced Rbfox1 level. The splicing of wupA of exon 4 is not affected in Rbfox1 knockdown (fig. 6U), it's not clear if the splicing of exon 6b1 is affected in Rbfox1 knockdown.

      We thank the reviewer for pointing out our lack of clarity regarding exon 6b1 and IFM-specific isoform 6b1. To address this comment and validate our previous data, we performed additional Sanger sequencing on RT-PCR products, added a diagram of the wupA gene region in Figure 4 A and improved the clarity of our discussion of the fliH and hdp3 alleles and our results in the text.

      To directly respond to the reviewer, first, it is unclear if the reduced level of Rbfox1 in a fliH background should actually cause a more severe phenotype. Our data suggests that Rbfox1 represses TnI expression through binding the 3’-UTR, and can likely indirectly regulate wupA expression level via Mef2. Thus, arguably, the reduced level of Rbfox1 in the fliH background might not affect splicing, as the mutations in the regulatory element should rather make wupA insensitive to increased Mef2 expression in the Rbfox-RNAi background.

      Second, we confirmed via Sanger sequencing of RT-PCR products that both IFM and TDT in control and Rbfox1-IR flies use exon 6b1 (current exon 7). The IFM isoform contains exon 3, 6b1 and 9, while the TDT isoform contains exon 3 and 6b1, but skips exon 9 (see Figure 4 A). In other tubular muscles, wupA isoforms skip exons 3 and 9, and use exon 6b2 instead of 6b1. Thus, to directly answer the reviewer’s question, no, splicing of exon 6b1 itself is not affected by Rbfox1. However, Rbfox1 does influence expression of the ”6b1 isoform”, or the wupA isoforms in IFM and TDT containing exon 6b1 and exon 3. Additionally, our data shows that Bru1, not Rbfox1, regulates alternative splicing of wupA exon 9 (Fig. S6 T).

      What the reviewer has correctly identified with this comment is that the effect on splicing in the hdp-3 allele also appears to be complex and to have not been fully clarified. Although hdp-3 results from mutation of a splice site in exon 6b1 (which based on (Barbas et al., 1993) results in aberrant use of 6b2 in IFM), it also results in a near complete absence of the longer isoform containing exon 3 in adult flies. hdp-3 is reported in the same paper to affect both IFM and TDT, which both express isoforms containing exon 3 and 6b1. It is not known how mis-splicing of exon 6b1 leads to loss of isoforms containing exon 3, but our data indicate that Rbfox1 is somehow involved. It is purely speculation and beyond the scope of this manuscript, but perhaps selection of alternative exons in wupA are not independent events (ie that the splicing of exon 3 depends on correct splicing of exon 6b1). This could be mediated with interactions with chromatin, the PolII complex or through a larger splicing factor complex (something like LASR, for example (Damianov et al., 2016)), that restricts choice in alternative events through higher-order interactions. Another possible mechanism is that a second mutation exists in the hdp-3 allele that affects splicing of exon 3, although this was not indicated in the extensive sequencing data in (Barbas et al., 1993).

      Bruno1 was identified as a co-regulator of Rbfox1 in different IFM and tubular muscle types. However, except Mhc, other Rbfox1 targets seem to be regulated by either Rbfox1 or Bruno1, not both. Analyses of RNA-seq datasets from single and double knockouts should identify additional targets to support the claim that - Rbfox1 and Bruno1 co-regulate alternative splice events in IFMs. Phenotypic changes with reduced Rbfox1 and Bruno1 double knockdowns are very severe, but the mechanistic basis of such genetic interaction resulting in synergistic phenotypes in IFMs is lacking as splicing changes in single vs double knockout is similar.

      We agree with the reviewer that RNA-seq data would be useful to obtain a genome-wide perspective on the regulatory interactions between Rbfox1 and Bru1, and we plan to generate this data as part of a future manuscript. However, the tissue-specific dissections to isolate enough material from all of the necessary genotypes will take months to complete, and are not realistic to wait to include in this manuscript. Instead, to address the reviewer’s question, we have expanded our RT-PCR experiments to cover a wider panel of events in 12 sarcomere genes (see new data in Figures 6 and S6 and summary in Figure 8). We now can show that splice events in Fhos and Zasp67 are Rbfox1 dependent, while events in sls, Strn-Mlck and wupA are Bru1 dependent. An event in Zasp66 responds to both Rbfox1 and Bru1, but in opposite directions. Events in Mhc, Tm1 and Zasp52 are regulated by both Rbfox1 and Bru1 (or are sensitive to changes in Bru1 expression in the Rbfox1 background), and change in the same direction. This data provides a clearer mechanistic basis for the synergistic phenotype observed between Rbfox1 and Bru1 in IFM.

      Rbfox1 is expressed at a high level in tubular muscle whereas Bruno1 is expressed at a high level in IFM. Rbfox1 binds to Bruno1 transcript and inversely regulates Bru1-RB level but knockdown of Bru1 does not affect Rbfox1 level (Fig. S5 G,I,J). Overexpression of Bruno1 decreased the Rbfox1 level, however, it's difficult to interpret these results as overexpression of Bruno1 may have other effects on IFM gene expression.

      The reviewer correctly pointed out that we did not observe significant changes in Rbfox1 mRNA levels in the mutant bru1M3 background, however, in the original version of this manuscript, we also showed a significant decrease in Rbfox1 expression in IFM from the bru1-IR background at both 72 h APF and 1 d adult in mRNA-Seq data. To clarify differences in Rbfox1 levels between bru1-IR and our bru1 mutant backgrounds, we have performed additional RT-PCR experiments. We examined Rbfox1 levels after knockdown of bru1 (bru1-IR), and we now show that Rbfox1 levels are significantly decreased in IFM and TDT after bru1-IR (Fig. 5S, Fig S5 I). We see a weaker effect in the bru1M2 hypomorphic mutant, which likely reflects differences in Bru1 expression levels in bru1-IR and the bru1M2 allele. These results are consistent with the mRNA-seq data we presented previously (now in Fig. 5R). These additional data suggest that loss as well as gain of Bru1 affects Rbfox1 expression levels.

      A dose-dependent effect of Rbfox1 knockdown was shown to regulate the expression of transcription factors that are important for muscle type specification and function including exd, Mef2, and Salm. However, it is not clear how Rbfox1 mechanistically regulates the expression of these transcription factors.

      We present two pieces of data suggesting possible regulatory mechanisms for Mef2. First, RIP data suggest Rbfox1 can directly bind the 3’-UTR region of Mef2, and this region contains two binding motifs identified in both the oRNAment database and in our PWMScan dataset. Second, we show that use of the 5’-UTR regions of Mef2 is altered in Rbfox1-IR muscle. Although not definitive, this suggests that regulation of alternative 5’-UTR use may influence transcript stability or translation efficiency. We feel the many experiments to elucidate the detailed mechanism of regulation (and indeed to determine the likely contribution of multiple, layered regulatory processes) are beyond the scope of this paper, and are better left for future studies. This manuscript is the first in-depth characterization of Rbfox1 function in Drosophila muscle, and we provide multiple lines of evidence suggesting that different regulatory mechanisms exist as a basis for future experiments to explore these interesting and important regulatory interactions.*

      **Minor comments**

      1. It is not described if the rescue of Rbfox1 knockout by expression of force-reduction myosin heavy chain (Mhc, P401S) led to rescue of phenotypes (jumping, climbing, flight). *

      Force-reduction myosin heavy chain MhcP401S is a mutation at the endogenous Mhc locus that results in a headless myosin and was previously characterized to be flightless (Nongthomba et al., 2003). It is however able to rescue jumping and walking defects observed with the hdp2 TnI allele, and supports largely normal myofibril assembly (Nongthomba et al., 2003). It is also important to note that fibrillar muscle function is very finely tuned, such that alterations that result in flightlessness in many cases do not alter myofibril structure as detected by confocal microscopy (Schnorrer et al., 2010). We therefore looked at myofiber and sarcomere structure as a more sensitive read-out of the rescue ability in the Rbfox1 knockdown, to be able to detect a partial-rescue of myofibrillar structure that may not be evident in a behavioral assay.

      Immunofluorescence (IF) and Western blotting are different techniques, and Bruno1 antibody was validated for specificity in IF but not in Western blots. Figure 5L and S5 E should include muscle samples from Bru1M2.

      We have added a Western Blot panel in Figure S5 D including bru1-IR, bru1M2 and samples of different wild-type tissues including abdomen, ovaries, testis and IFM.

      To quantify alternative splicing or percent spliced in (PSI), primers are typically designed in the exons flanking the alternative exons. A better primer design along with PSI calculation by RT-PCR will robustly validate alternative splicing changes in different genetic background (Fig 6U and S6 U).

      We do not yet have RNA-Seq data from these Rbfox1 knockdown samples to facilitate calculation of transcriptome-wide PSI values; thus, we rely on the results from our RT-PCR experiments. Our primers used to detect alternative splice events are indeed located within flanking exons or as close to the alternative exons as possible based on sequence design limitations (see schemes in Figure 6 and Figure S6). Many of the events we are detecting are complex, and not a simple “included” or “excluded” determination, and are therefore not amenable to RT-qPCR. To increase the robustness of our validation, we now provide RT-PCR gel-based quantification of exon use for the events we tested in Zasp52, Zasp66, Zasp67, wupA and Mhc (Figure 6 U-W and Figure S6 T-U).*

      Reviewer #1 (Significance (Required)):

      Describe the nature and significance of the advance (e.g. conceptual, technical, clinical) for the field.

      Understanding how muscle fiber type splicing and gene expression is regulated will conceptually move the field forward. How transcriptional and posttranscriptional programs coordinate to specify muscle fiber type gene expression is still lacking.

      Place the work in the context of the existing literature (provide references, where appropriate). Multiple RNA binding proteins and splicing factors have been shown to affect muscle function along with hundreds of gene expression and splicing changes in a complex fashion. Linking phenotypes with gene expression changes is still challenging as RNA binding proteins or RBPs are multifunctional and affect the function of other regulators that are important for muscle biology. *We thank the reviewer for recognizing the conceptual advance our findings represent, as well as the complexity in the regulatory network we are seeking to understand. A detailed understanding of the coordination of transcriptional and posttranscriptional programs is enabled by our work and will be the subject of future investigation.

      * State what audience might be interested in and influenced by the reported findings.

      Fly genetics, alternative splicing regulation, muscle specification and function.

      Define your field of expertise with a few keywords to help the authors contextualize your point of view. Indicate if there are any parts of the paper that you do not have sufficient expertise to evaluate.

      Regulation and function of alternative splicing in muscle. I do not have a thorough knowledge of Drosophila genetics.


      Response to Reviewer 2 Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      **Summary**

      This paper reports analysis of the function of RbFox1, an RNA-binding protein, best known for roles in the regulation of alternative splicing. It uses Drosophila as its in vivo model system, one that is highly suited to the analysis in vivo of complex biological events. In general, the authors present a very thorough approach with an impressive range of molecular analysis, genetic experiments and phenotypic assays. *We thank the reviewer for recognizing the suitability of our model organism as well as the time investment and diversity of experiments that were performed in this work. We have added and revised multiple experiments during this revision, which has greatly improved the manuscript.

      * The authors report that Rbfox1 is expressed in all Drosophila muscle types, and regulated in both a temporal and muscle type specific manner. Using inhibitory RNA to knock down gene function, they show that Rbfox1 is required in muscle for both viability and pupal eclosion, and contributes to both muscle development and function. A Bioinformatic approach then identifies muscle genes with Rbfox1-binding motifs. They show Rbfox1 regulates expression of both muscle structural proteins and the splicing factor Bruno1, interestingly preferentially targeting the Bruno1-RB isoform. They report functional interaction between Rbfox1 and Bruno1 and that this is expression level-dependent. Lastly, they report that Rbfox1 regulates transcription factors that control muscle gene expression.

      They conclude that the effect on muscle function of RbFox1 knock down is through mis-regulation of fibre type specific gene and splice isoform expression. Moreover, "Rbfox1 functions in a fibre-type and level-dependent manner to modulate both fibrillar and tubular muscle development". They propose that it does this by "binding to 5'-UTR and 3'-UTR regions to regulate transcript levels and binding to intronic regions to promote or inhibit alternative splice events." They also suggest that Rbfox1 acts "also through hierarchical regulation of the fibre diversity pathway." They provide further evidence to the field that Rbfox1's role in muscle development is conserved.

      **MAJOR COMMENTS**

      Are key conclusions convincing?

      In terms of presentation, I suggest ensuring a clear demarcation throughout of the evidence behind the main conclusions. This can get somewhat lost as a great deal of information is presented, including all the parallels with prior findings in other systems. I am not saying this is a major problem, just highlighting the importance of clarity. Conclusions to clearly evidence include: Rbfox1 functions in a fibre-type manner to modulate both fibrillar and tubular muscle development (e.g. L664); Rbfox1 functions in a level-dependent manner (e.g. L664); Rbfox1 functions by binding to 5'-UTR and 3'-UTR regions to regulate transcript levels (e.g. L670); Rbfox1 functions by binding to intronic regions to promote or inhibit alternative splice events" (e.g. L670); "Bru1 can regulate Rbfox1 levels in Drosophila muscle, and likely in a level-dependent manner" (L488) - Clearly evidence the level effect; "first evidence for negative regulation for fine tuning acquisition of muscle-type specific properties. Depending on its expression level, Rbfox1 can either promote or inhibit expression of" muscle regulators (L797). Lastly, the controlled stoichiometry of muscle structural proteins is known to be important, but all mechanisms are not known, so again make the supporting evidence as clear as possible for the interesting point of a role for Rbfox1 in this (e.g. L787). *Using the above comments from the reviewer as a guide, we have rewritten the manuscript, including large portions of the discussion, introduction and results. We thank the reviewer for pointing out where we could more effectively communicate our results, support our conclusions and highlight the significance of our findings.

      * Should some claims be qualified as preliminary or removed?

      P301 "complicated genetic recombination" - seems a bit weak to include. Either do it or don't include? *

      We have removed this statement from the text.*

      *

      Also, see section below on "adequate replication of experiments"

      Are additional exps essential? (if so realistic in terms of time and cost) None essential in my view. It depends on the authors' goals, but for the most impact of the project then following up these suggestions are possible. L369-372: mutate putative Rbfox1 binding site and ask does binding still occur or not. If it doesn't, then ask if this mutation affects the expression of the putative target gene. L775-777 "Our data thus support findings that Rbfox1 modulates transcription, but introduce a novel method of regulation, via regulating transcription factor transcript stability." It would be good to demonstrate this.

      We thank the reviewer for these suggestions, and agree they are indeed interesting experiments, but beyond the scope of this manuscript. We plan to pursue the detailed molecular and biochemical mechanisms of regulation in a future project including exploring Rbfox1 binding through use of reporters, identification of direct targets via CLIP and investigation of post-transcriptional regulation of translation or NMD.*

      Presented in such a way as to be reproduced

      Yes

      Are exps adequately replicated?

      A main area I would address is the authors frequent use of "may", "tend", "trend". This is confusing the picture they present. What is statistically significant and what is not? Only the former can be used as evidence. Examples include: L170: "may display preferential exon use" - does it or doesn't it? L272: "myofibrils tended to be thicker" - were they or weren't they? L350 "wupA mRNA levels tend towards upregulation in Rbfox1-RNAi". L353 "but tended towards upregulation (Fig. S4A)" L466 "Correspondingly, we see a trend towards increased protein-level expression of Bru1-PA" L474 "both Bru1-PA and Bru1-PB tend to increase" L485 "Overexpression of Bru1 in TDT with Act79B-Gal4 also tends to reduce Rbfox1" L595 "Rbfox1-IR27286 tended towards increased exd levels in IFM (Fig. 7A)" L614 "and a trend towards increased use of Mef2-Ex20 " Also, L487 "suggesting that Bru1 can also negatively regulate Rbfox1" - one cannot use a non-significant observation to suggest something. *

      We have modified the text to limit use of “may”, “tend” and “trend”, and have removed discussion of non-significant results. We thank the reviewer for the very helpful and detailed list of sentences to modify.

      \*MINOR COMMENTS**

      *

      Although individual samples are not significant, in aggregate there is a trend….

      * Specific exp issues that are easily addressable

      L162: "dip in Rbfox1 expression levels around 50h APF". The Fig indicates as early as 30h. Is this significantly less than the 24h data point? Comparisons in Figure 1G that are significant based on DESeq2 differential expression analysis with an adjusted p-value L427 "this staining was lost after Rbfox1 knockdown". This conflicts with Fig 5K which says no significant difference. Again in L429 "Rbfox1 knockdown leads to a reduction of Bru1 protein levels in IFMs and TDT." Fig says no significant difference in TDT. *

      We thank the reviewer for pointing out this inconsistency. We have revised the text accordingly. Our Western Blot (Figure 5L, M) and RT-PCR (Figure 5N, O) do show changes of Bru1 protein and mRNA expression levels after knockdown of Rbfox1KK110518. *

      Are prior studies referenced appropriately?

      This m/s is an authoritative presentation of the field as a whole with a comprehensive, impressive reference list. However, a point related to this area is one of the main things I would consider tackling. This is to have more clarity in the demarcation of what this study has found that adds to prior knowledge. It is worthwhile in itself to demonstrate the many similarities with previous work in other systems, as part of establishing the Drosophila system with all its analytical advantages for in vivo molecular genetics as an excellent model for future study in this area of research. However, the impact/strength of this m/s would be enhanced by clarity in presenting what is new to the field in all organisms. *We thank the reviewer for this suggestion. We have rewritten large portions of the manuscript, including the introduction and discussion, to improve the clarity of our findings and their importance to the field.

      * Are the text and Figs clear and accurate?

      TEXT

      L156: more precise language than "in a pattern consistent with the myoblasts" - maybe a simple co-expression with a myoblast marker? *

      We have revised this phrasing in the text. Rbfox1 expression in myoblasts was previously reported by (Usha and Shashidhara, 2010). *

      L181: at first use define difference between RNAi and IR*

      We use IR as an abbreviation for RNAi. In particular, we are trying to distinguish the two hairpins obtained from stock centers (27286 and KK110518) from the third, homemade RNAi hairpin, originally named UAS-dA2BP1RNAi, that was generated by Usha and Shashidhara (Usha and Shashidhara, 2010). We have better defined this in the text and methods. *

      L205: maybe clearly explain the link between eclosion and tubular muscle?? *

      We have added a sentence explaining the link between eclosion and tubular muscle (see Line 331).*

      L231: "Sarcomeres were not significantly shorter at 90h APF with the stronger Mef2-Gal4" - not clear why this is the case when the less strong knockdown conditions have shorter sarcomeres. *

      We have modified the text as well as the figure labeling to clarify that the other samples were tested in 1 d adult, while the KK110518 hairpin was tested at 90 h APF. This likely indicates that the short sarcomeres observed in 1 d adults reflect hypercontraction, which in IFM is classically first apparent after eclosion when the flies actively try to use the flight muscles. The difference in timing is due to pupal lethality of the KK110518 hairpin line, so we could not evaluate adult flies.*

      L234: "classic hypercontraction mutants in IFMs display a similar phenotype" - presumably not similar to the not significantly shorter sarcomeres of the previous sentence. *

      We have modified the text to clarify this statement. The change in sarcomere length from 90 h APF to 1 d adult is actually the relevant observation, as this reflects the progressive shortening of sarcomeres observed in classic hypercontraction mutants.*

      L244: "90h", should be "90h APF"? *

      Yes, we have modified the text.*

      L273: "Myofibrils in Act88F-Gal4 mediated knockdown only showed mild defects (Fig. 3 G, H, Fig. S2 C, D) despite adult flies being flight impaired". This seems worthy of discussion - the functional defect is not due to overt structure change? *

      In our own experience as well as observations included in a genome-wide RNAi screen in muscle (Schnorrer et al., 2010), there are a rather large number of knockdown conditions where few if any structural defects are observed at the level of light microscopy, but flies are completely flightless. We interpret this to reflect the narrow tuning of IFM function, where slight alterations in calcium regulation or sarcomere gene isoform expression result in dysfunction and a lack of flight. Ultrastructural evaluation might reveal defects in these cases, but the defect could also be with the dynamics of tropomyosin complex function, calcium regulation, mitochondrial function or even neuro-muscular junction structure. We have added a sentence to the text to discuss and clarify the Act88F result.*

      L281 "also known as Zebra bodies" - helpful to indicate these on the Fig, they are not. *

      We have added arrows to the figure to mark the Zebra bodies, and updated the figure legend.*

      L282: "we were unable to attempt a rescue of these defects" - I may have missed something, but what about rescue undertaken of the defects on previous pages? *

      This is the first point in the text where we introduced overexpression of Rbfox1, as preceding experiments where knockdown or using a GFP-tagged protein trap line at the endogenous locus. We have revised the sentence to focus on the overexpression phenotype with UH3-Gal4.*

      L283: "Over-expression of Rbfox1 from 40h APF" - this is the first over-expression experiment, so introduce why done now (and perhaps not earlier), and also explain the use of a different Gal4 driver.*

      We have reworded this section of the text. The UH3-Gal4 driver is restricted to expressing in IFM from 40h APF, so is first expressed after myofibrils have been generated and selectively in IFM. This avoids lethality observed from pan-muscle expression with Mef2-Gal4 (presumably due to severe defects in tubular muscles), and also allows us to image IFM tissue from adult flies. Later experiments with Mef2-Gal4 were performed with a later temperature shift to avoid this early lethality.*

      L290 "Interestingly, both Rbfox1 knockdown and Rbfox1 over-expression produce similar hypercontraction defects" - this could be interesting, worthy of discussion/explanation. *

      The most logical explanation is that Rbfox1 regulates the balance in fiber-type specific isoform expression. Loss of Rbfox1 would cause a shift in the relative ratio of the isoforms of structural genes, and overexpression of Rbfox1 would likely cause a similar shift in the opposite direction. This is supported by our RT-PCR panel, where we see co-regulation of different events with Bru1, and we see fiber-type specific difference in regulation of alternative splicing (Figure 8). Overexpression of Rbfox1 would be expected to make IFM look more like TDT, which would result in an isoform imbalance and lead to the observed hypercontraction phenotype. Interestingly, loss and overexpression of Bru1 also result in the same hypercontraction phenotype, similar to what we observe with Rbfox1. We have added a paragraph in the discussion about level-dependent regulation, to address this reviewer comment.*

      P305: Bioinformatic analysis. It is not clear what is taken as a potentially interesting result. On average a specific 5 base motif is found every 1000bps - so what is being looked for? How many sites in what length or position? A range of examples are described in the next pages of the m/s. For example: L337 "Bruno1.... contains 42 intronic and 2 5'-UTR Rbfox1 binding motifs" and L591 "exd contains three Rbfox1 binding sites," *

      We have redone the bioinformatic analysis completely, relying on data from oRNAment and the in-vitro determined PWM. We have also rewritten all portions of the text related to this analysis and no longer focus on the number of observed motifs in a given gene. As we unfortunately do not have RNA CLIP data, we do not know genome-wide which motifs are bound in muscle. Clustering of motifs may reflect binding, but a single, strong motif can also be bound, as we demonstrate via RIP of the wupA transcript. Thus, we identified interesting targets to test based on 1) a previously described role in the literature in myofibril assembly or contractility and 2) the presence of any Rbfox1 motif in that gene. A more elegant selection method of direct and indirect target exons will be designed for a future manuscript after integrating CLIP and mRNA-Seq data that have not yet been collected.

      L315: "many of these genes have binding or catalytic activity". "catalytic activity" seems very vague.

      For the original supplemental figure panel, we relied on Panther high-level ontology terms, which can unfortunately be rather vague, ie “catalytic activity” or “binding activity”. We have redone this analysis and rely rather on GO terms in the biological process and molecular function categories (Figure S3 B).

      L317 "When we look in previously annotated gene lists" - be more specific. What are they?

      This section of the text has been rewritten, and the “previously annotated gene lists” are described in greater detail in the Methods. *

      L327 "may also affect the neuro-muscular junction" - maybe better left for the Discussion? *

      We have removed this sentence from the Results.*

      L333 "extradenticle (exd) and Myocyte enhancer factor 2 (Mef2) contain 3 and 7 Rbfox1 motifs," Discuss the number and position of multiple motifs found in known targets? *

      We have removed the discussion of the number of binding sites for different target genes, instead incorporating this information graphically in Figure S3 C. It is not clear that the number of binding sites per gene has any influence on whether it is regulated in Rbfox1 knockdown. Thus, we have de-emphasized discussion of the number of binding sites throughout the text.*

      L350 "wupA mRNA levels " - clearer to stick to using TroponinI or WupA? *

      We have updated instances throughout the text to consistently refer to the protein as Troponin-I (TnI) and the gene or mRNA as wupA. *

      L376 "To check whether Rbfox1 regulates some target mRNAs such as wupA....." The suggestion here is more of a further indication than a "check". *

      We have reworded this section of the results to make the link between post-transcriptional regulation and our mass spectrometry results more salient.*

      L544 "In IFMs, knockdown of Rbfox1 and loss of Bru1 results in...." clarify if this is the two genes separately or the two genes together? *

      We have rewritten this entire section and present an expanded list of tested alternative events. We have taken care in this revision to clearly denote if the genotype is Rbfox1-IR or bru1M2 or a double knockdown background.*

      L580 "Our bioinformatic analysis identified Rbfox1 binding motifs in more than 40% of transcription factors genes" - is this all TFs or just "muscle" TF genes? *

      We have redone this analysis and changed this sentence in the text.*

      L598, what would be the mechanism of some decrease in Rbfox1 increasing mRNA levels and more of a decrease resulting in a decrease of the mRNA? The authors say "the nature of this regulation requires further investigation". *

      We have added more data to this section of the manuscript and repeated several of these experiments. After adding more biological replicates and additional data points, we have more consistent results that also demonstrate the variability in bru1 expression levels after Rbfox1 knockdown. Overall levels of bru1 assayed with a primer set in exons 14 and 17 now consistently show an increase in bru1 expression after Rbfox1 knockdown between all three hairpins (Rbfox1-RNAi, Rbfox1-IRKK110518 and Dcr2, Rbfox1-IR27286) (Figure 5 N).

      The relationship between expression level of Rbfox1 and expression level of bru1 and Bru1 protein isoforms is more complex. We now report a novel splice event in the annotated isoform bru1-RB that skips exon 7, resulting in a frame shift and generation of a protein that lacks all RRM domains, which we call bru1-RBshort (Figure S5). This short isoform is preferentially used in TDT, while the long isoform encoding the full-length protein is preferentially used in IFM (Figure 5 P). Presumably, this provides a mechanism, in addition to the use of different promoters, for muscle cells to regulate expression levels of different Bru1 isoforms. Knockdown of Rbfox1 in IFM results in a significant increase in the use of the long mRNA isoform, but paradoxically a decrease in the corresponding protein isoform (Figure 5, S5). We interpret this to mean that Rbfox1 regulates alternative splicing of Bru1, and likely independently a translational/post-translational mechanism regulates the expression level of Bru1-RB. This in theory could be mediated by interaction with translational machinery, post-translational modification, increased P-granule association, etc., and given the depth and breadth of experiments (as well as the multitude of isoform-specific expression reagents) required to isolate the responsible pathway, we deem it beyond the scope of this manuscript to biochemically demonstrate this specific regulatory mechanism. *

      L609 "The short 5'-UTR encoded by Mef2-Ex17". Ensure all abbreviations are defined. What does "Ex" mean here? Not straightforward to relate to the diagram in the Supplemental material that indicates the Mef2 gene has many fewer than 17 exons. In Fig7 legend too. *

      We have changed “Ex” to “exon” in the text. We apologize for the confusion. We have also added a diagram to Figure 7 E of the 5’-UTR region of Mef2, and a complete diagram of the locus in Figure S3 C. Based on the current annotation, Mef2 exons are numbered 1 to 21, corresponding to at least 16 distinct regions of the genome (18 if you include the variable 3’-UTR lengths). Exons sometimes will have more than one number in the annotation if a particular splice event causes a shift in the ORF, or if alternative splice sites or poly-adenylation sites are used. Mef2 is also on the minus strand, so as exons are numbered based on the genome scaffold, the exon numbering goes in reverse (ie exon 1 is the 3’-UTR).

      We strongly believe in following the numbering provided in the annotation, to increase reproducibility and transparency in working with complex gene loci for many different genes. Another researcher can go to Flybase, look-up the exon number from a given gene from a specific annotation, and get the exact location and sequence of the exons we name. It is incredibly challenging and time intensive to go through older papers and figure out which exon or splice event corresponds to those in the current annotation, and we aim to alleviate this difficulty (we illustrate this in Figure 4 A for the wupA locus, where we verified exon numbers in annotation FB2021_05 by BLASTing each individual sequence and primer provided in (Barbas et al., 1993).*

      L617 "Levels of Mef2 are known to affect muscle morphogenesis but not production of different isoforms" - clarify what is meant here by "different isoforms". *

      We have revised this section of the text. This statement was meant to reflect that Mef2 affects muscle morphogenesis through regulation of transcription levels, but not at the level of alternative splicing.*

      L638 "Salm levels were significantly increased in IFM from Rbfox1-RNAi animals, but significantly decreased in IFMs from flies with Dcr2 enhanced Rbfox1-IR27286 or Rbfox1-IRKK110518". This is worth discussion or further analysis. Normally would expect an allelic series, with an effect becoming more apparent with increased loss-of-function. *

      Dcr2, Rbfox1-IR27286 and Rbfox1-IRKK110518 produce a stronger knockdown than Rbfox1-RNAi, and indeed produce significantly decreased levels of salm, thus following the allelic series. We repeated this experiment, but obtained the same results. *

      L641 "This suggests that Rbfox1 can regulated Salm". How, if there are no Rbfox1 binding sites? Deserves further analysis? *

      Our new bioinformatic analysis suggests a possible answer, in that it identified possible Rbfox1 motifs in a salm exon and a site in an intron. Previously, we had focused on introns and UTR regions. In addition, using the PWM we now recover Rbfox1 binding sites of the canonical TGCATGA as well as AGCATGA sites. The intron site in salm is an AGCATGA site. Further experiments will be required to determine if Rbfox1 directly binds to salm mRNA, if it interacts with the transcriptional machinery to regulate salm expression, or if this regulation occurs through yet a different mechanism, and are beyond the scope of this manuscript.*

      L674: "We found the valence of several regulatory interactions..." I'm not sure the meaning of "valence" here and elsewhere will be readily understood. *

      Thank you for pointing this out. We have used a different phrasing throughout the text.*

      FIGURES

      Fig 1 it is difficult to see the green in A-F. Can this be improved? It is clearer in I-L. *

      We have replaced the images with better examples and increased the levels to make the green channel better visible. *

      Fig 2 legend (others too), say what the clusters of small black ellipses in P and Q are. *

      Thank you for pointing out this oversight. All boxplots are plotted with Tukey whiskers, such that they are drawn to the 25th and 75th percentile plus 1.5 the interquartile range. Dots represent outlying datapoints outside of this range. We have added statements in the relevant figure legends, as well as a more detailed explanation in the Methods. *

      Fig 3 it is not easy to see a shorter sarcomere in D, as the arrow partially obscures what is being indicated. Also, the data in G indicates that sarcomeres are not shorter in Mef2 GAL4 > KK110518, although the legend says this is shown in D. *We have rephrased the statement in the legend. The arrows are pointing to frayed or torn myofibrils.

      Fig 5 legend "-J). Bru1 signal is reduced with Rbfox1-IRKK110518 (C, F, I)". Clarify that this is only in IFM. It is not significant in TDT or Abd-M.

      Done.*

      Fig 7 legend "quantification of the fold change in exd transcript levels" - only KK110518 in IFM is significant. *

      This panel was moved to Figure S7. The relevant regions of the text and figure legend were modified to reflect that only Rbfox1-IRKK110518 results in a significant change in exd levels. C - "indicates Rbfox1 binds to Mef2 mRNA" - it is not easy to see the band.

      We replaced the image and adjusted the levels to make the band more visible. D - what do the different lanes on the gel below the histogram in D correspond to? We adjusted the labeling on the figure panel. The gel is a representative image of RT-PCR results that are quantified above in the histogram.

      *Suggestions that would help the presentation of their data and conclusion **

      There is a lot of good, thorough work here, but overall there is the impression that some of the presentation/writing could be improved (also see the above lists on clarity and accuracy). I admire the authors for their comprehensive presentation of what has already been found out in this field. As the authors summarise, a lot is already known in many other species, so (as also indicated above) it is crucial to emphasise what new is found in this work that advances overall knowledge in this field. This can be obscured in many places where they say because of what was found in vertebrate systems we looked in Drosophila. These include: L417: "This led us to investigate if Rbfox1 might regulate Bru1 in Drosophila." L452: "and we were curious if these interactions are evolutionarily conserved in flies." L528 "Thus, we next checked if Rbfox1 and Bru1 co-regulate alternative splicing in Drosophila muscle." L677 "Moreover, as in vertebrates, Rbfox1 and Bru1 exhibit cross-regulatory interactions" L683 "Rbfox1 function in muscle development is evolutionarily conserved" L697 "Here we extend those findings and show that as in vertebrates......" L702 "our observations are consistent with observations in vertebrates" L707 "Studies from both vertebrates and C. elegans suggest that Rbfox1 modulates developmental isoform switches." L746 "We see evidence for similar regulatory interactions between Rbfox1 and the CELF1/2 homolog Bru1 in our data from Drosophila." *We thank the reviewer for this honest and helpful assessment of the manuscript. Upon rereading the original text and with the guidance of the list of sentences above, we agreed with the reviewer and we have rewritten large segments of the manuscript. In particular in the introduction and discussion, we now better emphasize what is new in our findings and how they advance overall knowledge in this field.

      L185 paragraph. The knockdown series is important for the study. A lot is presented in this paragraph, especially for a non-specialist and it could be easier to follow. Perhaps present the four genetic conditions in the order of the severity of their phenotype on viability. Also, clearly state what each Gal4 driver is used for. What is the nature of the RNAi/IR lines such that Dcr2 could enhance their action? Also comment on off targets - are any predicted?

      We have rewritten this paragraph as the reviewer requested. The hairpins are ordered by decreasing phenotypic severity, and we have more clearly described each Gal4 driver as well as Dicer2. This information is also available in the Methods, along with the off targets for the hairpins. KK110518 has one predicted off-target ichor, but this gene is not expressed in IFM, TDT or leg based on mRNA-Seq data. 27286 has no predicted off-targets. *

      L227: "In severe examples". Be as clear as possible. Are the "severe examples" using the stronger RNAi line or are they the most severe examples with a single line? I'd suggest including the result in the main Fig rather than in the Supplemental. However, as I read more of the m/s I realise there is a great deal of important information in the Supplemental Figs, and so the case is not much stronger for this example than many others. The balance of what is included where could be looked at, because it is not straightforward for the reader to read the paper and quickly flick between the main and supplemental Figs. Later in the m/s is a substantial section that starts L450 (finishes L489) and which only refers to Supplemental Figs. L503 is another area where it is necessary, and difficult, for the reader to move between main Figs and supplemental Figs. *We have reorganized the figure panels in several figures, notably Figures 4, 5, 6, 7 and 8 and the corresponding supplementary figures, including moving panels from the supplemental figures to the main figures and generating more comprehensive quantification panels. In the specific case referenced here for Fig. S1 P and Q, we chose to keep the most representative images of the phenotype in the main figure (Fig. 2 I, N), and have reworded the text to reflect that the most severe phenotypic instances are in the supplement. As we do not have CLIP data, we chose to keep the bioinformatics analysis in the supplement and have shortened the paragraph in the results devoted to Figure S3. We hope our reorganization and rewriting have better streamlined the text and figures.

      L258: - perhaps a Table summarising this and other phenotype trends with the different RNA conditions might be helpful. It gets quite difficult to follow.

      We have revised the text and several figure panels to make the phenotypic trends with the different RNAi conditions easier to follow.*

      Reviewer #2 (Significance (Required)):

      The advance reported is mechanistic.

      The authors already do a very good job of placing their work in the context of prior research (see comment is Section A).

      Muscle biologists interested in its development and function will be interested in this work. More broadly, those intrigued by alternative splicing will be interested. Despite its very widespread occurrence, much about alternative splicing is still poorly understood in terms of regulation and significance. This is especially the case in vivo, and this paper uses an excellent in vivo model system (Drosophila) for the genetic and mechanistic analysis of complex biological problems. My field of expertise: cell differentiation, gene expression, muscle development, Drosophila.

      Response to Reviewer 3 Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      **SUMMARY**

      This manuscript characterizes the role of splicing factor Rbfox1 in Drosophila muscle and explores its ability to modulate expression of genes important for fibrillar and tubular muscle development. The authors hypothesize that Rbfox1 binds directly to 5'-UTR and 3'-UTR regions to regulate transcript levels, and to intronic regions to promote or inhibit alternative splicing events. Because some of the regulated genes encode transcriptional activators and other splicing factors such as Bru1, the effects of Rbfox1 may encompass a complex regulatory network that fine-tunes transcript levels and alternative splicing patterns that shape developing muscle. Most likely the authors' hypothesis is correct that Rbfox1 is critical for muscle development in Drosophila, but overall the interesting ideas presented here are too often based only on correlations without further experimental validation. *

      We respectfully disagree with the reviewer that our hypothesis that Rbfox1 is critical for muscle development in Drosophila is based only on correlation without further experimental validation. In this manuscript we extensively characterize the knockdown phenotype of 3 RNAi hairpins against Rbfox1 as well as a GFP-tagged Rbfox1 protein in both fibrillar flight muscle and tubular abdominal and jump muscle. All hairpins produce similar phenotypes with defects in myofiber and myofibril structure and result in behavioral defects in climbing, flight and jumping, confirming this phenotype is due to loss of Rbfox1 and not a random off-target gene. We also convincingly demonstrate that Rbfox1 regulates Bru1, another splicing factor known to be critical for fibrillar specific splice events in IFM. Moreover, Rbfox1 and Bru1 genetically interact selectively in IFM and our RT-PCR data for 12 select structural genes reveals fiber-type specific alternative splicing defects regulated by Rbfox1 selectively, by Bru1 selectively, or by both Rbfox1 and Bru1. Thus, we conclude that Rbfox1 is indeed critical for muscle development, and this is the first report to demonstrate this requirement in Drosophila.*

      **MAJOR COMMENTS**

      The hypothesis that Rbfox1 plays an important role in regulating muscle development is based on previous studies in other species and supported by much new data in this manuscript. Initial bioinformatic analysis showed that many Drosophila genes, including 20% of all RNA-binding proteins, 40% of transcription factors, etc. have the motifs in introns or UTR regions. However, I think a deeper analysis is required. Any hexamer might be present about once every 4kb, and we do not expect all UGCAUG motifs are necessarily functional, so one might ask whether the association of Rbfox motifs with muscle development genes is statistically significant? Are the motifs conserved in other Drosophila species, which might support a functional role in muscle? Are the intronic motifs located as expected for regulatory effects, that is, proximal to alternative exons that exhibit changes in splicing when Rbfox1 expression is decreased or increased? *

      We appreciate the point of the reviewer that it would be ideal to distinguish genome-wide motifs that are actually bound directly by Rbfox1 from those that are unused, but our behavioral and phenotypic characterization of the knockdown phenotype in this manuscript is also valid without this data. The most effective approach to identify direct targets is to perform cross-linking immunoprecipitation, or CLIP, but we unfortunately do not have CLIP data from Drosophila muscle and it is beyond the scope of the current study to generate this data. It is not trivial to obtain the amount of material necessary to identify tissue-specific binding sites, as we would also likely expect differences in targeting specificity between tubular and fibrillar muscle. Genome-wide analysis of the evolutionary conservation of binding site motifs is also not trivial and is beyond the scope of this paper.

      Despite these limitations and to address the reviewer’s comment, we have done the following:

      1. We have completely redone our bioinformatic analysis using transcriptome data from the oRNAment database (Benoit Bouvrette et al., 2020), as well as searching genome-wide for instances of the in vitro determined PWM using PWMScan, to capture possible sites in introns (Figure S3). The oRNAment database was shown to reasonably predict peaks identified in eCLIP from human cell lines, which we assume would translate to a similar predictive capacity in the Drosophila
      2. We have calculated the expected distribution of Rbfox1 sites in a random gene list for Figure S3, and indeed the number of Rbfox1 sites in sarcomere genes is significantly enriched.
      3. We have looked more carefully at the distribution of Rbfox1 and Bru1 motifs in the transcriptome (in the oRNAment data), and find not only that these motifs frequently occur in the same muscle phenotype genes, but also that they are closer together than is expected by chance (Fig. S4 J).
      4. We marked the location of Rbfox1 and Bru1 motifs in the vicinity of select alternative splice events we tested via RT-PCR on the provided summary diagrams (Fig. 6, Fig. S6).
      5. We have tested additional alternative splice events in total from 12 structural genes, and of the 9 events misregulated after Rbfox1 or Bru1 knockdown, all but 1 are flanked by Rbfox1 or Bru1 binding motifs. This indicates that the motifs are indeed located as expected for a regulatory effect. Is it possible to knock out an Rbfox motif and show that splicing of the alternative exon is altered, or regulation of transcript levels is abrogated?


      The construction and mutation of reporter constructs is possible, but would take longer than the recommended revision time-frame, in particular to generate reporters that can be evaluated in vivo. We intend to address the biochemical mechanism(s) of Rbfox1 regulation with future experiments in a separate manuscript.

      Also, what was the background set of genes used for the GO enrichment analysis? Genes expressed in muscle or all genes?

      The background set of genes for GO enrichment (now Figure S3 B) was all annotated genes for the “all genes” label and all muscle phenotype genes for the “Muscle phenotype” label.

      The data on cross regulation between Rbfox1 and Bru1 are confusing and inconsistent, since mild knockdown and stronger knockdown of Rbfox1 seem to have different effects on Bru1 expression. New data suggest that Rbfox1 can positively regulate Bru1 protein levels (Fig.5), but this seems inconsistent with the lab's earlier studies indicating opposite temporal mRNA expression profiles for Rbfox1 and Bru1 across IFM development. 


      We apologize for the confusion, but the relationship between Rbfox1 and bru1 levels across IFM development has not been published previously. We previously generated that mRNA-Seq data, but presented here (now in Figure 5Q) is a new analysis of that data, specifically focused on Rbfox1 and bru1 expression. We have corrected the phrasing in the text.

      To address this comment, along with points raised above by Reviewer 2, we have revised this part of the manuscript, added more data to this section of the manuscript and repeated several of these experiments. After adding more biological replicates and additional data points, we have more consistent results that also demonstrate the variability in bru1 expression levels after Rbfox1 knockdown. Overall levels of bru1 assayed with a primer set in exons 14 and 17 now consistently show an increase in bru1 expression after Rbfox1 knockdown between all three hairpins (Rbfox1-RNAi, Rbfox1-IRKK110518 and Dcr2, Rbfox1-IR27286) (Figure 5 N). This is consistent with our observations of inversely correlated mRNA levels during IFM development, as when Rbfox1 levels decrease, bru1 transcripts increase.

      We agree with the reviewer that the relationship between the expression level of Rbfox1 and expression level of bru1 mRNA and Bru1 protein isoforms is more complex. We now report a novel splice event in the annotated isoform bru1-RB that skips exon 7, resulting in a frame shift and generation of a protein that lacks all RRM domains, which we call bru1-RBshort (Figure S5). Unknowingly, we had previously used a primer set from exon 7 to exon 8 as “common”, which lead to some confusion. This short isoform is preferentially used in TDT, while the long isoform encoding the full-length protein is preferentially used in IFM (Figure 5 P). Presumably, this provides a mechanism, in addition to the use of different promoters, for muscle cells to regulate expression levels of different Bru1 isoforms. Knockdown of Rbfox1 in IFM results in a significant increase in the use of the long mRNA isoform, but paradoxically a decrease in the corresponding protein isoform (Figure 5, S5). We interpret this to mean that Rbfox1 regulates alternative splicing of Bru1, and likely independently a translational/post-translational mechanism regulates the expression level of Bru1-RB. This in theory could be mediated by interaction with translational machinery, post-translational modification, increased P-granule association, etc., and given the depth and breadth of experiments (as well as the multitude of isoform-specific expression reagents) required to isolate the responsible pathway, we deem it beyond the scope of this manuscript to biochemically demonstrate this specific regulatory mechanism. *

      *

      Both Rbfox1 and Bru1 gene have many Rbfox motifs, but they are both large genes (>100kb) and would be expected to have many copies of all hexamers. How do we know whether any of them are functional?

      We do not know if all of the Rbfox1 binding sites in the Bru1 and Rbfox1 loci are bound, but the CLIP data required to assess this is beyond the scope of this manuscript, as discussed above. We do show, however, that changes in the expression level of Rbfox1 affect the expression of Bru1 on both the mRNA transcript and protein level, and changes in the expression level of Bru1 also can affect the expression level of Rbfox1. The direct or indirect nature of this regulation remains to be fully elucidated, although we do provide RIP data showing we can detect bru1 transcript bound to Rbfox1-GFP (Figure S4 I). We have modified the text to address this comment.

      Figure S4, section I, J: if changes in Bru1-RB isoform expression are correlated with Rbfox1 knockdown, it seems reasonable to test whether the Bru1-RB promoter can drive expression of GFP in an Rbfox1-dependent manner. But if I understand correctly, the assay as described on p. 19 uses the promoter region upstream of Bru1-RA. What is the logic for this experiment? It is not surprising that no effect was observed. The end result is that we have no idea whether Rbfox1 directly regulates bru1-RB. Even if it does, bru-Rb appears to be a minor component of Bru expression in IFM.

      Upon reevaluating this experiment and with respect to the reviewer’s comment, we have removed it from the manuscript to avoid confusion. Our new data indicate a switch in use of the bru1-RBlong and bru1-RBshort isoforms (Figure 5 N-P), suggesting that Rbfox1 regulation is on the level of splicing.

      Further experiments will be necessary to refine the indirect versus direct regulatory effects of Rbfox1 on Bru1, but our data do demonstrate that Bru1 levels are regulated in Rbfox1 knockdown conditions. We also provide a RIP experiment (Figure S4 I) showing that Rbfox1-GFP does directly bind bru1 mRNA, but we did not determine if this was isoform-specific. Multiple additional experiments would be necessary to distinguish between regulation of alternative splicing, direct binding to regulate transcript translation or stability, or transcriptional regulation via regulation of Salm, or some combination of these possible mechanisms. The data presented here are important to the field as they are the first report of isoform-specific regulation of Bru1 in muscle, even if we do not conclusively show if this regulation by Rbfox1 is direct or indirect.

      In the section "Rbfox1 and Bruno1 co-regulate alternative splice events in IFMs", the data show that splicing of several genes is altered by knockdown or over-expression of Rbfox1 and Bru1. The interesting conclusion is for a complex regulatory dynamic where Rbfox1 and Bru1 co-regulate some alternative splice events and independently regulate other events in a muscle-type specific manner. However, if we are to conclude that these activities are due to direct binding of Rbfox1 and Bru1 to the adjacent introns, we need information about the location of flanking Rbfox and/or Bru1 motifs. Do upstream or downstream binding sites correlate with enhancer or silencer activity, as reported in previous studies of these splicing factors in other species? For wupA, Figure S3 shows an intronic Rbfox site, but exon 4 is not labeled so the reader cannot correlate this information with the diagram in Figure 6U.

      As mentioned above, we have marked the location of Rbfox1as well as Bru1 binding motifs in the diagrams in Figure 6 and Figure S6. We have tested additional alternative splice events, and can now show events regulated only in the Rbfox1 knockdown, only after bru1 knockdown, or in double knockdown flies (Figure 8). 8 out of 9 events where we see clear changes in splicing are flanked by potential Rbfox1 or Bru1 motifs. Demonstration of direct binding and assay of genome-wide binding sites through CLIP studies is beyond the scope of this manuscript and will be pursued in the future.

      The evidence that Rbfox1 directly affects expression of transcription factor Exd seems to be based only a correlation between Rbfox1 knockdown and decreased expression of Exd. The observation that binding of Rbfox1 to the Exd 3'UTR in RIP experiments further weakens the case.

      We agree with the reviewer and have moved the data related to exd to the supplement (Figure 7 and S7). We still mention exd in the text as it is significantly decreased after knockdown with Rbfox1-IRKK110518, but we have removed it from larger claims of transcriptional regulation as well as from the summary in Figure 8. Also, just to note that although we failed to detect Rbfox1-GFP bound to exd, this experiment was performed with adult flies. Since Exd is functionally important early in pupal development during fate specification of the IFMs, it is possible we might detect binding to exd mRNA at a different developmental timepoint.

      Similarly, there is a correlation of Rbfox1 knockdown with expression of alternative 5'UTRs in the Mef2 gene. However, the changes in UTR expression appear mostly not statistically significant. Do the authors have a model to explain what mechanism might allow Rbfox to regulate expression of alternative 5'UTRs, which would seem to be a transcriptional process?

      Mef2 transcript levels are significantly increased after knockdown with Rbfox1-RNAi and decreased after overexpression of Rbfox1, and we can detect direct binding of Rbfox1-GFP to Mef2 RNA via RIP. This establishes Mef2 as a likely direct target of Rbfox1 regulation, likely through the two Rbfox1 motifs in the 3’-UTR (Figure S3 C). In addition to this regulation, we made an observation that has not been previously reported in the literature, that IFM expresses a particular isoform of Mef2 that uses a short promoter encoded by Exon 17. We see both tissue-specific use of Exon 17 (Figure 7 F) as well as developmental regulation of Exon 17 use in IFM (Figure S7 C). Surprisingly, we saw that use of exon 17 in the Mef2 promoter is altered in Rbfox1 knockdown muscle. We now provide a quantification of this data, to show the change is statistically significant. We also provide a scheme of the Mef2 locus and RT-PCR primers with exons 17, 20 and 21 labelled (Figure 7 E). We have also rewritten this section of the text to increase the impact and clarity of our finding.

      For Salm, there apparently are no Rbfox motifs in the gene, and there are statistically significant but apparently inconsistent changes in Salm expression when it is knocked down in IFM by Rbfox1-RNAi (Salm increases) vs knockdown by Rbfox1-IR27286 or Rbfox1-IRKK110518 (Salm decreases). These are potentially interesting observations but more data would be needed to make stronger conclusions. How would regulation occur in the absence of Rbfox motifs?


      The best explanation we can provide for why salm expression is increased with the weak hypomorph Rbfox1-RNAi condition, but decreased with the stronger hypomorph Rbfox1-IRKK110518 or Dcr2, Rbfox1-IR27286 conditions is that salm regulation is sensitive to Rbfox1 expression or activity level. We now discuss this in a new section of the discussion. We further attempted several experiments to address this question, including obtaining an endogenously tagged Salm-GFP line, as well as a UAS-Salm line (kindly provided by F. Schnorrer). Disappointingly, there is no GFP expressed in the Salm-GFP line, either live, by immunostaining or in Western Blot of multiple developmental stages, indicating that the line has fallen apart and we have not yet redone the CRISPR targeting to generate a new line. The UAS-Salm construct works (too well), in that overexpression with Mef2-Gal4 results in early lethality and we have not yet managed to optimize the experiment and obtain enough pupal muscle where we can evaluate the effect on Bru1 or Rbfox1 levels.

      Our new bioinformatic analysis further revealed possible Rbfox1 motifs in a salm exon and a site in an intron. Previously, we had focused on introns and UTR regions. Now, using the in vitro determined PWM, we can recover Rbfox1 binding sites of the canonical TGCATGA as well as AGCATGA sites. The intron site in salm is an AGCATGA site. Further experiments will be required to determine if Rbfox1 directly binds to salm pre-mRNA, if it interacts with the transcriptional machinery to regulate salm expression, or if this regulation occurs through yet a different mechanism. We feel the many required experiments are beyond the scope of the current manuscript. Our data provides an experimental basis for future studies on this topic.

      \*MINOR COMMENTS**

      1. In several figures there is a misalignment of the transcriptional driver information with the phenotype data in the bar graphs above. Please correct the alignments to make interpretation easier. *

      We have revised the layout of labels for many plots throughout the manuscript to avoid a category label associated with a genotype label at a 45-degree angle, and to make interpretation easier.

      On p. 14 Brudno et al. is cited as ref for Fox motifs near muscle exons, but this paper only focused on brain-specific exons.

      In addition to brain-specific exons, Brudno et al. also analyzed a set of muscle-specific exons, and thus this is the appropriate reference. For instance, from the Brudno paper, “As an additional control in some experiments we analyzed a smaller sample of muscle-specific alternative exons that were collected exactly as described above for the brain-specific exons” and “UGCAUG was also found at a high frequency downstream of a smaller group of muscle-specific exons.” Further details of the muscle-specific exon analysis can be found in (Brudno et al., 2001).

      For Mef2, why do exons described as 5'UTR have numbers 17, 20, and 21? One would normally expect these to be exon 1, 2 or 1A, 1B, etc.

      We rely on the Flybase annotation and numbering system to refer to exons. Per Flybase, all exons are labeled in the 5’ to 3’ direction of the sequenced genome, even for genes, such as Mef2 or wupA, that are encoded on the reverse strand. We strongly believe in following the numbering provided in the annotation, to increase reproducibility and transparency in working with complex gene loci for many different genes. Another researcher can go to Flybase, look-up the exon number from a given gene from a specific annotation, and get the exact location and sequence of the exons we name. It is incredibly challenging and time intensive to go through older papers and figure out which exon or splice event corresponds to those in the current annotation. We illustrate this in Figure 4 A for the wupA locus, where we verified exon numbers in annotation FB2021_05 by BLASTing each individual sequence and primer provided in (Barbas et al., 1993). The Mhc locus is even more complex, in particular regarding alternative 3’-UTR regions and historic versus current exon designations (Nikonova et al., 2020). For clarity and reproducibility, we therefore rely on the current Flybase designations.

      Fig 8: "regulation of regulators" seems to imply the Rbfox1 is impacting transcription?? Is there precedence for this type of regulation by Rbfox1? Yes, indeed, there is precedence for Rbfox1 impacting transcription, as we presented in the Discussion. Rbfox2 is reported to interact with the Polycomb repressive complex 2 to regulate gene transcription in mouse (Wei et al., 2016) and in flies Rbfox1 interacts with transcription factors including Cubitus interruptus and Suppressor of Hairless to regulate transcription downstream of Hedgehog and Notch signaling (Shukla et al., 2017; Usha and Shashidhara, 2010). In addition, Rbfox1 regulates splicing of Mef2A and Rbfox1 and Rbfox1 cooperatively regulate splicing of Mef2D during C2C12 cell differentiation (Gao et al., 2016). Our results provide a further piece of evidence implicating Rbfox1 either directly or indirectly in transcriptional regulation as well as regulation of alternative splicing.

      * Reviewer #3 (Significance (Required)):

      **SIGNIFICANCE**

      These studies of a major tissue-specific RNA binding protein, Rbfox1, are definitely important for our understanding of functional differences between muscle subtypes, and between muscle and nonmuscle tissues. The broad outlines of Rbfox1 alternative splicing regulation are known, but there is very little specific detail about the important targets in muscle subtypes that might help explain functional differences between subtypes. If more experimental validation can be obtained for regulation of transcript levels by binding 3'UTRs, this would also represent new information. *

      We thank the reviewer for recognizing the significance of our work and our detailed analysis of Rbfox1 phenotypes in different muscle fiber-types. Experimental validation of 3’-UTR binding will be a significant time investment in terms of building and testing in-vivo reporter constructs, assaying NMD and translation effects and performing the CLIP studies necessary for identification of directly-bound 3’-UTR regions, extending beyond the scope of this manuscript and the time allotted for revision. The data we present here represent an important advance in our understanding how Rbfox1 contributes to muscle-type specific differentiation, and form the basis for future experiments to explore the molecular and biochemical mechanisms underlying this regulation. *

      I am reviewing based on my experience studying alternative splicing in vertebrate systems, with an emphasis on Rbfox genes. Therefore I am unable to evaluate the functional data on different subtypes of muscle in Drosophila.

      *

      Reviewer Response References

      Barbas, J. A., Galceran, J., Torroja, L., Prado, A. and Ferrús, A. (1993). Abnormal muscle development in the heldup3 mutant of Drosophila melanogaster is caused by a splicing defect affecting selected troponin I isoforms. Mol Cell Biol 13, 1433–1439.

      Benoit Bouvrette, L. P., Bovaird, S., Blanchette, M. and Lécuyer, E. (2020). oRNAment: a database of putative RNA binding protein target sites in the transcriptomes of model species. Nucleic Acids Research 48, D166–D173.

      Brudno, M., Gelfand, M. S., Spengler, S., Zorn, M., Dubchak, I. and Conboy, J. G. (2001). Computational analysis of candidate intron regulatory elements for tissue-specific alternative pre-mRNA splicing. Nucleic Acids Res 29, 2338–2348.

      Damianov, A., Ying, Y., Lin, C.-H., Lee, J.-A., Tran, D., Vashisht, A. A., Bahrami-Samani, E., Xing, Y., Martin, K. C., Wohlschlegel, J. A., et al. (2016). Rbfox Proteins Regulate Splicing as Part of a Large Multiprotein Complex LASR. Cell 165, 606–619.

      Gao, C., Ren, S., Lee, J.-H., Qiu, J., Chapski, D. J., Rau, C. D., Zhou, Y., Abdellatif, M., Nakano, A., Vondriska, T. M., et al. (2016). RBFox1-mediated RNA splicing regulates cardiac hypertrophy and heart failure. J Clin Invest 126, 195–206.

      Nikonova, E., Kao, S.-Y. and Spletter, M. L. (2020). Contributions of alternative splicing to muscle type development and function. Semin. Cell Dev. Biol.

      Nongthomba, U., Cummins, M., Clark, S., Vigoreaux, J. O. and Sparrow, J. C. (2003). Suppression of muscle hypercontraction by mutations in the myosin heavy chain gene of Drosophila melanogaster. Genetics 164, 209–222.

      Schnorrer, F., Schönbauer, C., Langer, C. C. H., Dietzl, G., Novatchkova, M., Schernhuber, K., Fellner, M., Azaryan, A., Radolf, M., Stark, A., et al. (2010). Systematic genetic analysis of muscle morphogenesis and function in Drosophila. Nature 464, 287–291.

      Shukla, J. P., Deshpande, G. and Shashidhara, L. S. (2017). Ataxin 2-binding protein 1 is a context-specific positive regulator of Notch signaling during neurogenesis in Drosophila melanogaster. Development 144, 905–915.

      Usha, N. and Shashidhara, L. S. (2010). Interaction between Ataxin-2 Binding Protein 1 and Cubitus-interruptus during wing development in Drosophila. Dev Biol 341, 389–399.

      Wei, C., Xiao, R., Chen, L., Cui, H., Zhou, Y., Xue, Y., Hu, J., Zhou, B., Tsutsui, T., Qiu, J., et al. (2016). RBFox2 Binds Nascent RNA to Globally Regulate Polycomb Complex 2 Targeting in Mammalian Genomes. Mol Cell 62, 875–889.

    1. SciScore for 10.1101/2021.12.02.470852: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The structures of the individual domains were aligned using VMD, with the sequential gaps between them ranging between 3-5 residues, which were filled using loop modeling in MODELLER.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MODELLER</div><div>suggested: (MODELLER, RRID:SCR_008395)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Multiple sequence alignment for the above eight sequences was carried out using the MAFFT program with the L-INS-i method73 and visualized using Jalview. 74 Glycan-lipid and glycan-glycan interactions: As the glycan molecules attached to the HR2 domain are situated close to the membrane and to the glycans on the neck region, their possible interactions were further analyzed.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MAFFT</div><div>suggested: (MAFFT, RRID:SCR_011811)</div></div><div style="margin-bottom:8px"><div>Jalview</div><div>suggested: (Jalview, RRID:SCR_006459)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on page 29. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.12.02.471028: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: Single cell profiling: Splenocytes were collected from mRNA-LNP vaccinated and control mice were collected as described above for mouse immunization and sample collection, and normalized to 1000 cells/μL.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Animals: M. musculus (mice), 6-8 weeks old females of C57BL/6Ncr, were purchased from Charles River and used for immunogenicity study.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">All experiments utilize randomized littermate controls.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Replication, randomization, blinding and reagent validations: Replicate experiments have been performed for all key data shown in this study.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Contamination: All cell lines tested negative for mycoplasma.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Thereafter, cells were washed twice in MACS buffer and incubated with PE–anti-human FC antibody (Biolegend, M1310G05) in MACS buffer for 30 min on ice.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PE–anti-human FC</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">anti-mouse CD28 antibody (Biolegend, Clone 37.51) and seed into 96-well plate for overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse CD28</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-mouse secondary antibody was diluted to 1:2500 in blocking buffer and incubated at room temperature for one hour.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-mouse</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In vitro mRNA expression: HEK293T cells were electroporated with mRNA encoding B.1351 variant (6P) or B.1.617 variant (6P) proteins using Neon™ Transfection System 10 µL Kit following the standard protocol provided by manufacturer.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, 293T cells were seeded in 150 mm plates, and transfected with 21 µg pHIVNLGagPol, 21 µg pCCNanoLuc2AEGFP, and 7.5 µg of a SARS-CoV-2 SΔ19 or B.1.351 variant-Δ19 or SARS-CoV-2 SA SΔ19 plasmid, utilizing 198 µl PEI.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were incubated at 37°C supplied with 5% CO2. 48 hr later, 293T-hACE2 cells were collected and the GFP+ cells were analyzed with Attune NxT Acoustic Focusing Cytometer (Thermo Fisher).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T-hACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Animals: M. musculus (mice), 6-8 weeks old females of C57BL/6Ncr, were purchased from Charles River and used for immunogenicity study.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57BL/6Ncr</div><div>suggested: RRID:MGI:2160593)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmid construction: The DNA sequences of B.1.351 and B.1.617 SARS-CoV-2 spikes for the mRNA transcription and pseudovirus assay were synthesized as gBlocks (IDT) and cloned by Gibson Assembly (NEB) into pcDNA3.1 plasmids.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmid expressing a C-terminally truncated SARS-CoV-2 S protein (pSARS-CoV-2Δ19) was from Dr Bieniasz’ lab</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pSARS-CoV-2Δ19</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, 293T cells were seeded in 150 mm plates, and transfected with 21 µg pHIVNLGagPol, 21 µg pCCNanoLuc2AEGFP, and 7.5 µg of a SARS-CoV-2 SΔ19 or B.1.351 variant-Δ19 or SARS-CoV-2 SA SΔ19 plasmid, utilizing 198 µl PEI.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCCNanoLuc2AEGFP</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, CD4 FITC (Biolegend, Clone GK1.5,1:200) in MACS buffer (D-PBS with 2 mM EDTA and 0.5% BSA) on ice for 20 min, cells were washed with MACS buffer then fixed and permeabilized using the BD Cytofix/Cytoperm fixation/permeabilization solution kit according to the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BD Cytofix/Cytoperm</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Analysis was performed using FlowJo software according to the gating strategy outlined in a Supplemental Figure.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The 50% inhibitory concentration (IC50) was calculated with a four-parameter logistic regression using GraphPad Prism (GraphPad Software Inc.)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The pooled library was sequenced using MiSeq (Illumina) with 2*300 read length.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MiSeq</div><div>suggested: (A5-miseq, RRID:SCR_012148)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Bulk VDJ sequencing data analysis: Raw fastq files from bulk BCR and TCR sequencing were processed by MiXCR v2.1.5 to clonotypes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MiXCR</div><div>suggested: (MiXCR, RRID:SCR_018725)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For T-cell specific analyses, cells associated with the following terms were taken as a subset and used for standard Seurat pipeline analyses as described above: “CD4 T cell”, “CD8 T / NKT cell”, “CD8 T cell”, “T cell-like.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Seurat</div><div>suggested: (SEURAT, RRID:SCR_007322)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">” For B-cell specific analyses, cells associated with the following terms were taken as a subset: “B cell”, “B cell-like”, “Progenitor B cell”, “Plasma cell.” For functional annotation, differentially upregulated and downregulated genes with cutoff of adjusted p-value 0.05 were used for DAVID analysis.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>DAVID</div><div>suggested: (DAVID, RRID:SCR_001881)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The statistical significance was labeled as follows: n.s., not significant; * p < 0.05; ** p < 0.01; *** p < 0.001; **** p < 0.0001. Prism (GraphPad Software) and RStudio were used for these analyses.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on pages 32 and 37. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reviewer 1

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      *The manuscript by Wibisana et al. describes an impressive set of experiments that analyse the NFkB response at the single-cell level, using a variety of cutting-edge techniques (live cell imaging, single-cell RNA-seq, single-molecule RNA FISH, and single-cell ATAC-seq) in chicken DT40 B-cells.

      In the fist half of the paper, the authors perform a detailed characterization of the cell-to-cell variation arising from a homogeneous stimulation with various doses of anti-IgM. They observe that the NFKB TF RelA forms clear nuclear 'foci' upon stimulation in DT40 cells: this was anecdotally shown in a different cell-type by the same authors in ref 7, but (to my knowledge) has never been systematically studied. This allows them to quantitatively analyse the foci formed in response to stimulation, and they show that this is dose-dependent, heterogeneous and biomodal, and exhibits properties of cooperativity. In parallel, the authors analyse the resulting stimulus-driven changes in gene expression, first using single-cell RNA-seq, and then, elegantly, using RNA FISH, which allows them to directly compare the number of RelA foci to gene expression in individual cells. Like the RelA foci, they find that cell-to-cell gene expression is heterogeneous and bimodal (this has been described before). Interestingly, though, they are able to show that individual stimulus-responsive genes exhibit distinct patterns of cell-to-cell hetereogeneity: they can categorize 4 clusters of responding genes according to different patterns of cell-to-cell variation at distinct stimulus doses, and moreover they show that while the heterogeneity of NFKBIA arises due to bimodal expression levels, that of CD83 is simply due to broad variation between cells. Although focused on NFkB, there is a lot of information here with some important (and non-intuitive) implications that could apply to many other stimulus-driven or developmental responses that exhibit heterogeneous patterns of gene expression. A more in-depth analysis of the single-cell datasets would certainly be very worthwhile and fruitful.

      In the second half of the paper, the authors attempt to use their single-cell data, alongside ATAC-seq genomic analyses, to draw inferences about how or whether the model genes NFKBIA and CD83 are regulated by super-enhancers (SEs). Both of these genes are associated with SEs that gain accessibility upon stimulation (recapitulating the authors' findings in ref 8 in a different cell-type), and the CD83 promoter exhibits co-accessibility with two regions within an adjacent SE. The authors also show that both genes are sensitive to treatment with 1.6-HD, a compound that disrupts liquid-like condensates (a characteristic that has been reported for SEs), and CD83 is sensitive to an inhibitor of Brd4 (which has been associated to SE function). However, while these findings could be considered to be suggestive of regulation by SEs, they are clearly not definitive (nor do the authors claim so).

      Finally, the authors show (figure 4a-c) that while the level of stimulus-driven gene upregulation correlates with co-accessibility with both SEs and typical enhancers (TEs), the cell-to-cell heterogeneity of gene expression correlates only with co-accessibility with SEs. This would agree with a model in which SE-regulated gene regulation may generally impart heterogeneous or switch-like gene expression. *

      **Specific comments**

      • The experiments are adequately presented, and the authors indicate that not only the sequencing data but also the analysis code is available. Nevertheless, the methods section is rather terse, and could benefit from more detail to understand the various analyses, particularly concerning the analyses of SEs in figures 3 and S7, where it is often difficult to understand how peaks or genes are categorized.

      Response: We thank the Reviewer for pointing this out and we agree that the Methods section was not described in detail, particularly in how the SEs were analyzed and categorized. Therefore, we have added more details on how SEs were categorized in the Methods section as follows:

      “ Peak calling and enhancer identification from ATAC-seq data were performed using Homer v4.10.4 (http://homer.ucsd.edu/homer/) using the bam files generated from the Cell Ranger pipeline. Tag directories were created for the bam file from each condition using the “makeTagDirectory” program with the “--sspe -single -tbp 1” option. Peak calling was performed using the “findPeaks” program with the “-style super -typical -minDist 5000 -L 0 -fdr 0.0001” option. This procedure stitches peaks within 5 kb and ranks regions by their total normalized number reads and classifies TE and SE by a slope threshold of 1. Peak annotation was subsequently performed using the “annotatePeaks.pl” program with the GRCg6a.96 annotation file. The consequent peak files were merged between each stimulation condition for the SE and TE peaks separately using the “mergeBed” program of bedtools. Peak annotation was performed for the second time for the merged peaks to create the final SE and TE peaks. ATAC fold-change was then calculated between both conditions for the merged peaks separately for SE and TE. Genes associated with both SE and TE were assigned only to the SE.”

      Similarly, we have added more details for other analyses in the Method section and the main sentences.

      • The imaging, scRNA-seq and RNA-FISH experiments are well-presented, although the supplementary figures 4 and 5 include key results that would merit inclusion within the main figures. *

      Response: We thank the Reviewer for this comment. We have included supplementary figures 4b and 5d in the main figures (new Fig. 2g) since both of these figures represent the raw data revealing the differences between smFISH counts and RNA-seq derived gene expression.

      • It is strking that although all the conclusions about SEs are drawn almost exclusively from analysis of ATAC-seq data, no raw ATAC-seq data is directly shown in any figure (even in the browser snapshots of figure 4d & e). It would be important to show the actual ATAC data from which the inferences of figures 3 and 4 are drawn, especially so that it is possible to visualize the implication of a particular 'ATAC fold-change' or of 'ATAC-gained enhancers'. Response: We have added a browser snapshot of the ATAC-seq data, presenting the super-enhancer region assigned to both CD83 and NFKBIA* (new Fig. 3c).

      Reviewer #1 (Significance (Required)):

      • This manuscript can be considered as a follow-up of the authors' previous paper (Michida 2020, ref 8), here focusing on cell-to-cell heterogeneity rather than on the overall magnitude of the stimulus-induced response. Overall, the experiments are well-performed and bring new data to an interesting angle of gene regulation. However, the analyses presented do not seem to fully exploit the data, and the authors do not manage to present any strong conclusions, particularly relating to the possible involvement of super enhancers.

      Response: To strengthen our conclusions about the possible involvement of super-enhancers in regulating heterogeneity, we performed additional analyses on the properties of the SE including the number of transcription factors, NF-κB and PU.1 binding motifs and the length of the enhancers, according to a previous report (Michida et al., 2020, Cell Rep). This was also conducted to confirm whether the ATAC-seq-based SE identification method presents results consistent with those provided by H3K27Ac-ChIP-based methods utilized in the previous study (Michida et al., 2020, Cell Rep). SEs revealed longer genomic length (new Supplementary Fig. 8a) and this length was positively correlated with the ATAC signal (new Supplementary Fig. 8b). Furthermore, gained and lost SE revealed a correlation with enhanced gene expression upregulation and downregulation, respectively, compared to TE (new Fig. 3g). We also demonstrated that SE-regulated genes have a higher Fano factor change, which is consistent with the state of an SE whether it is gained or lost (new Fig. 5a, 5b). For binding motif analysis, we observed a slightly higher PU.1 motif density at SEs (new Supplementary Fig. 11), corresponding to the results of the previous study (Michida et al., 2020, Cell Rep). Interestingly, only the density of NF-κB and not PU.1 was correlated with ATAC signal change in SE (new Fig. 4a), suggesting that those SEs were controlled by nuclear translocation of NF-κB.

      As a mechanism to produce gene expression heterogeneity in phenotypically identical cells, we observed that co-accessibility, which has been reported to be concordant with genomic contacts is correlated to Fano factor change, indicating that gene expression heterogeneity possibly stems from cis-regulatory interactions. NF-κB activation has been reported to increase the heterogeneity in some genes and is attributed to the accumulation of Ser5p RNAPII (Wong et al., 2018, Cell Rep). Additionally, Ser5p RNAPII has been reported to accumulate at enhancer regions (Koch et al., 2011, Nat Struct Mol Biol), and that the accumulation of RNAPII is suggested to assist in gene expression activation through enhancer-promoter contact (Thomas et al., 2021, Mol Cell). Our results support these conclusions since co-accessibility or putative cis-regulatory interactions correlate to Fano factor changes. SE can form phase-separated transcription hubs containing multiple enhancers and/or promoters, which may enable the higher diffusion rate of active enhancers; therefore, it may induce a higher possibility of genomic DNA interactions (Gu et al., 2018, Science). In contrast, the enrichment of TATA motif has also been proposed to generate transcriptional heterogeneity (Faure et al., 2017, Cell Syst). Therefore, we examined this possibility with our data. However, we observed a higher occurrence of TATA box in genes associated with lost SE (new Supplementary Fig. 18) which might have caused gene expression heterogeneity in unstimulated cells. This heterogeneity might be due to the differences in Pol II loading intervals (Tunnacliffe & Chubb, 2020, Trends Genet) however the noise associated with gained SE is possibly generated by the fluctuation of high-order biomolecular assembly. Therefore, we believe that the source of heterogeneity in these conditions were different.

      Additionally, we performed Hill function analysis to reveal the threshold behavior of gene expression in our analysis since previously gained SEs were associated with threshold gene expression (Michida et al., 2020, Cell Rep). In this study, we presented that threshold behavior in gained SE is related to motif density of NF-κB (Fig. 4d), however, threshold behavior does not seem to be related to heterogeneous gene expression.

      Following these results, we concluded that NF-κB activated SE has two closely related but distinct functions for gene control: (1) enhanced heterogeneity and fold-changes and (2) switch-like expression. These are controlled by different mechanisms stemming from chromatin status: (1) frequency of cis-regulatory genomic interactions possibly mediated by phase separation and (2) cooperative binding of NF-κB to DNA. These differences were well represented by expression profiles of CD83 (higher heterogeneity and weak bimodal expression) and NFKBIA (lower heterogeneity and strong bimodal expression).

      • For instance, the existence of multiple gene clusters that exhibit distinct patterns of heterogeneity implies that switch-like gene activation occurs on a per-gene basis, rather than corresponding to an all-or-nothing activation of individual cells. This would be an exciting finding, and the authors have the data to test this. Likewise, the division of heterogeneous gene expression into bimodal (like NFKBIA) or unimodal (like CD83) distributions could be a nice paradigm if systematically applied to the other 1335 differentially-expressed genes identified by the authors. * Response: We appreciate this comment. Following your comment, we analyzed the relationship between heterogeneity and bimodality (switch-like expression or high Hill coefficient) for the remaining genes. We observed that SE having a high Hill coefficient contained a higher number of NF-κB motif in SE (new Fig. 4), indicating that cooperative binding of NF-κB to DNA shaped non-linear gene expression profiles as we indicated in a previous paper (Michida et al., 2020, Cell Rep). Additionally, as described in the earlier section, we observed that heterogeneity arises from cis-regulatory genomic interaction. We compared these gene groups and observed that these properties were not completely shared (new Supplementary Fig. 15), indicating that bimodality and heterogeneity originated from different mechanisms. We assume that those differences are mediated through a combination of chromatin accessibility and the biophysical properties of NF-κB.

      • In contrast, although the authors try to use their data to investigate gene regulation by SEs, these inferences are all somewhat indirect, and the authors themselves do not manage to draw any definitive conclusions. Response: We appreciate this comment. We performed the additional computational analysis and carefully interpreted the data. Additionally, we have now concluded that SEs have two major biological functions: (1) gene expression heterogeneity, which is mediated via cis-regulatory interactions (Fig. 5) and (2) bimodal gene expression, which is mediated by NF-κB binding (new Fig. 4). The latter finding has also been reported in a mouse primary B cell, albeit the mechanism causing heterogeneity was a novel conclusion of this study.

      • I feel that the authors are under-selling their data here. As-is, the data represents more of a resource than a study with a clear message, but I believe that with more in-depth analysis the authors could make a much more significant advance, particularly concerning the cell-to-cell heterogeneity of gene expression. I would be very enthusiastic to review the same data again with a more detailed analysis, which I believe would enormously improve the manuscript. Response: We appreciate this comment. As described in this report and the revised manuscript, we performed a considerably detailed computational analysis and gained several novel insights to answer the question regarding the functional roles of SE. We are grateful to learn that gene expression patterns may be estimated from ATAC-seq profiles and that they may even be controlled. We hope that this Reviewer would observe the scientific value of our study and provide us with your valuable feedback on our revised manuscript.

      Reviewer #2

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      Imaging and single cell sequencing analyses of super-enhancer activation mediated by NF-κB in B cells" by Wibisana et al. examined the relationship between super-enhancers, NF-κB nuclear aggregation, and target gene regulation. The authors have generated a large amount of data from fluorescent microscopy, scRNA-seq, scATAC-seq, smRNA FISH. While this is an impressive dataset in terms of diverse technically advanced methods employed, it is not clear what to take as a main conceptual advance. What could be the functional implications of observed cell-cell variability in B cell transcriptional responses to environmental stimuli? In addition to this general point, the following are specific comments that could improve the manuscript.

      1. In Figure 2, smRNA FISH foci of CD83 and NFKBIA are quantified as # of spots per cell (Supplementary figure 5). But it is difficult to see in Figure 2 the colocalization of any mRNA spots with RelA foci. Ideally, it will be convincing to show by DNA FISH that these target loci are indeed located within NF-κB occupied super-enhancer puncta. Even with the current RNA FISH data, some colocalization analysis could have been performed. * Response: In Figure 2, we were unable to perform accurate colocalization analysis with the current smFISH data as the probes used by us map to exons. Moreover, we have also previously performed DNA-FISH; nevertheless, it was difficult to assess co-localization between the DNA and RelA proteins secondary to the degradation of RelA-GFP proteins. Therefore, we decided to perform intronic smRNA-FISH, which can be used to pinpoint the site of active transcription (Levesque and Raj, 2013, Nat Methods). The results, along with the quantification results, are presented in the new Fig. 2f.
      • Supplementary Figure 5a shows lower correlations of # GFP-RelA foci to CD83 transcripts in comparison to NFKBIA. Even though the foci and smRNA FISH spots are derived from high resolution imaging data, we should remember that any snapshot measurements have limited information content for gene regulatory relationships. Live cell studies (for example, from the groups of Suzanne Gaudet, Kathryn Miller-Jensen, and Myong-Hee Sung) have shown that time-integrated measures (e.g. maximum fold change and area under the curve of RelA signaling time course in single cells) are better correlates to transcriptional output of target genes (Lee REC et al 2014 Mol Cell; Wong VC et al 2019 Biophysical J; Sung MH et al. 2014 Science Signal; Martin EW et al. 2020 Science Signal). *

      Response: We thank the Reviewer for this valuable comment. One of the reasons for a lower correlation between GFP-RelA foci and CD83 transcripts compared to NFKBIA may be the difference in expression timing of CD83 and NFKBIA and the timing of nuclear localization of GFP-RelA. RelA localizes in the nucleus 10−30 mins after cell stimulation, and NFKBIA is an early responsive gene, however, CD83 is expressed later (new Supplementary Fig. 17). Therefore, this time difference possibly affects correlation accuracy. Although we agree that high-throughput time-course measurement of RelA-GFP combined with smFISH measurements, such as that reported in Wong VC et al., 2019, will be ideal, it is technically difficult since DT40 are suspension cells and the smFISH protocol requires multiple washing and centrifugation steps. Thus, with this experimental setup, we were unable to perform the time-course analysis.

      Nonetheless, we measured the time-course foci formation at the same single-cells (new Supplementary Fig. 1b) and observed that it effectively represents Figure 1a, which is a snapshot of the population dynamics of RelA foci across time. Additionally, the observed dynamics, which revealed a steep initial increase and slight decrease with time, effectively recapitulates the previous reports (Lee et al., 2014, Mol Cell; Wong et al., 2019, Biophys J).

      In our analysis, we performed imaging analysis to demonstrate that NF-κB foci formation is switch-like, and this formation might be involved in the formation of phase-separated condensates enhancing DNA to DNA contact. The number of foci may depend upon the intracellular concentration of NF-κB, and fold change in the RelA signal may be correlated with gene expression as previously reported (Lee et al., 2014, Mol Cell; Wong et al., 2019, Biophys J). However, there is another report presenting that promote/enhancer proximity is not related to gene expression (Alexander et al. 2019, eLife). Although we were unable to perform this analysis owing to the limitations stated above, we tried to find the relationship between RelA foci and gene expression by performing biochemical perturbations (Fig 1e-f, Fig 5h) and presented that these foci are related to gene expression.

      • The analyses have been performed using DT40 cells. In the Methods section, no description was provided about what type of B cells DT40 is, even though few outside of the field may not know that the cells were immortalized from chicken. This is an important consideration, because some nuclear bodies and genome organization features are different between host species and they also depend on whether the cells are primary or transformed. Because the authors do not discuss this point, it seems possible that the findings about NF-κB aggregates and super-enhancers may not necessarily hold true for primary B cells. *

      Response: We thank the Reviewer for pointing out these issues. We have added the following description on DT40 cells in the Methods section describing that DT40 cells are chicken bursal lymphoma cells.

      DT40 B lymphocytes have been widely used as a B cell model for studying B cell receptor signaling (Mori et al., 2002, J. Exp. Med.; Patterson et al., 2002, Cell; Saeki et al., 2003, EMBO J.) due to its high gene targeting efficiency. We also previously confirmed that anti-IgM stimulation induces the NF-κB signaling pathway in mouse primary splenic B cells and DT40 and that the signaling molecules and dynamics in these cells are well conserved (Shinohara et al., 2014, Science; Shinohara et al., 2016, Sci. Rep.; Inoue et al., 2016, NPJ Syst. Biol. Appl.). However, we understand the Reviewer’s concerns. Therefore, we have provided the track view of primary B cell ATAC-seq data to demonstrate that the chromatin accessibility changes upon anti-IgM stimulation in CD83 and NFKBIA were similarly observed in primary B cell data (new Supplementary Fig. 9b) and that the upregulation and association with SE of CD83 and NFKBIA were also observed in primary B cell (new Supplementary Fig. 9a).

      • Similarly, the GFP-RelA expressing DT40 cell generation should be described with more detail (beyond "provided by ..."). N-terminal or C-terminal fusion? Did the fusion construct contain an artificial promoter (e.g. CMV) or an upstream fragment of the genomic Rela locus (chicken or human)? Methods of transfection and cloning of stable lines? These choices affect the interpretation of the data, so they must be fully described and justified. *

      Response: We thank you for pointing this out. We have added the following details on the RelA-GFP construct in the Methods section:

      Mouse RelA-eGFP with eGFP on the C terminal was cloned into a pGAP vector containing Ecogpt resistance gene targeting endogenous GAPDH locus. This construct was further electroporated into wild-type cells and selected using Ecogpt to produce RelA-GFP-expressing DT40 cells.

      • DT40 cells were cultured in 39 degrees. Michael White and colleagues have shown that high temperatures can alter NF-kappaB dynamics and function (https://www.pnas.org/content/115/22/E5243). Did the authors try lower temperatures to ascertain that the NF-kB aggregates and other major findings are still observed in 37 degrees? *

      Response: We performed the experiments at 39 degrees to mimic the natural body temperature of chicken since DT40 cells were derived from chicken bursal lymphoma (Saribasak and Arikawa, 2006, Subcell Biochem). Previously, we cultured DT40 cells at 37 degrees and observed that the cell growth was inhibited, and thus, we believed that it was not ideal to perform experiments of DT40 cells at 37 degrees.

      Reviewer #2 (Significance (Required)):

      It is not clear what to take as a main conceptual advance.

      Response: Considering the original manuscript, we agree with the Reviewer on the lack of strong emphasis on the conclusions of our study. Therefore, in this revised manuscript, we have focused on the comprehensive mechanism of heterogeneity and switch-like activation in gene expression control. As we described in the comments to Reviewer #1, we performed an additional in-depth computational analysis on SE and TE. Consequently, we demonstrated that enhanced heterogeneity and expression fold-changes mediated by SE are defined by the number of cis-regulatory genomic interactions in open chromatin regions (Figure 5), however, switch-like expression (bimodal patterns) is determined by the number of NF-κB binding in SE (new Figure 4). The latter finding has also been reported in a mouse primary B cell in our previous study (Michida et al. 2020, Cell Rep.). However, the mechanism causing heterogeneity is a novel conclusion obtained in this study. We also concluded that these similar, albeit quantitatively and slightly different characteristics in gene control can be achieved through a combination of chromatin accessibility of host cells and biophysical properties of NF-κB molecule, which is involved in phase separation.

      What could be the functional implications of observed cell-cell variability in B cell transcriptional responses to environmental stimuli?

      Response: We performed gene ontology analysis to reveal how the heterogeneously expressed genes (cluster 4) (Fig. 2d) presented enrichment for immune-related functions (Supplementary Fig. 5b). This result supports a previous study, which stated that variability in gene expression is related to function (Osorio et al., 2019, Cells).

      This discussion is incorporated in the manuscript as follows:

      “We observed that genes with an increased heterogeneity upon increasing stimulation dose are enriched with cell-type-specific immune regulatory genes (Supplementary Fig. 5b), supporting a previous report where heterogeneity in gene expression is tied to biological functions and may be used by cells as a bet-hedging or a response distribution mechanism (Osorio et al., 2019, Cells), where cells exhibit heterogeneity to enable response to changing environment and also allowing dose-dependent fractional activation respectively. This was observed in CD83, a B cell activation marker, demonstrating the involvement of heterogeneity in B cell development.”

    1. es s i m p l e m e n t e la suposición, en r e a l i d a d la insis-tencia, d e q u e c u a l q u i e r p e r s o n a con s u s f a c u l t a d e s r a z o n a b l e m e n t e i n t a c t a s p u e d e llegar a c o n c l u s i o n e s de s e n t i d o c o m ú n y que, u n a
      1. Accesibilidad, suposición que todos pueden llegar a la misma conclusión compartida y que debe ser aceptada a la luz del sentido común
    1. SciScore for 10.1101/2021.11.29.470440: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: All in vivo experiments described were carried out in strict accordance with good animal practice according to NIH recommendations.<br>IACUC: All procedures for animal use were approved by the IACUC Committee at Omeros, Inc. (Seattle, WA, USA) and under an approved protocol.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">CD-1 female mice (Charles River Laboratories) 6-8 weeks of age were used for immunological studies performed at the vivarium facilities of Omeros Inc. (Seattle, WA).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Fluorescent-conjugated anti-mouse antibodies used for labeling included CD8β antibody (clone H35-17.2, ThermoFisher), CD4 (clone RM4-5, BD), IFN-γ (clone XMG1.2, BD), TNF-α (clone MP6-XT22, BD) and IL-2 (clone JES6-5H4; BD), and staining was performed in the presence of unlabeled anti-CD16/CD32 antibody (clone 2.4G2; BD).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD4</div><div>suggested: (BioLegend Cat# 391503, RRID:AB_2721611)</div></div><div style="margin-bottom:8px"><div>IFN-γ</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>TNF-α</div><div>suggested: (Leinco Technologies Cat# T698, RRID:AB_2737572)</div></div><div style="margin-bottom:8px"><div>IL-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-CD16/CD32</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The cells (2-4 × 105 cells per well of a 96-well plate) were added to the ELISpot plate containing an immobilized primary antibody to either IFN-γ or IL-4 (BD Cat# 551881 and BD Cat# 551878, respectively), and were exposed to various stimuli (e.g. control peptides SIV and ConA, S-WT and N peptides pools – see catalog numbers above) at a concentration of 1-2 μg/mL peptide pools for 36-40 hours.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IL-4</div><div>suggested: (BD Biosciences Cat# 551878, RRID:AB_2336921)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">ELISA for detection of antibodies: For IgG antibody detection in inoculated mouse sera and lung homogenates, ELISAs for spike-binding (including S1 Delta) and nucleocapsid-binding antibodies and IgG subclasses (IgG1, IgG2a, IgG2b, and IgG3) were used.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgG1, IgG2a</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgG3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After incubation, the wells were washed with PBST and 100 μL of a 1/5000 dilution of anti-mouse IgG HRP (GE Health Care; Cat # NA9310V), anti-mouse IgG1 HRP (Sigma; Cat # SAB3701171), anti-mouse IgG2a HRP (Sigma; Cat # SAB3701178), anti-mouse IgG2b HRP (Sigma; catalog# SAB3701185), anti-mouse IgG3 HRP conjugated antibody (Sigma; Cat # SAB3701192), or anti-mouse IgA HRP conjugated antibody (Sigma; Cat # A4789) was added to wells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-mouse IgG1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-mouse IgG2a</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-mouse IgG2b</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-mouse IgG3</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-mouse IgA HRP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Calculation of relative ng amounts of antibodies and the Th1/Th2 IgG subclass bias: A standard curve of IgG for OD vs. ng mouse IgG was generated using purified mouse IgG (Sigma Cat #15381; absorbance values were converted into mass equivalents for both anti-S and anti-N antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-S</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-N</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Serum-virus mix was then added in duplicate to seeded hACE2 expressing HEK293 cells (BEI Resources) and incubated at 37°C, 5% CO2 for 72 hours.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Murine immunization and blood/tissue collection: The design of vaccination study performed using CD-1 mice is shown in Figure 2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD-1</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Fluorescent-conjugated anti-mouse antibodies used for labeling included CD8β antibody (clone H35-17.2, ThermoFisher), CD4 (clone RM4-5, BD), IFN-γ (clone XMG1.2, BD), TNF-α (clone MP6-XT22, BD) and IL-2 (clone JES6-5H4; BD), and staining was performed in the presence of unlabeled anti-CD16/CD32 antibody (clone 2.4G2; BD).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ThermoFisher</div><div>suggested: (ThermoFisher; SL 8; Centrifuge, RRID:SCR_020809)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Flow cytometry was performed using a Beckman-Coulter Cytoflex S flow cytometer and analyzed using Flowjo Software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Flowjo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analyses and graph generation: All statistical analyses were performed and graphs generated used in figures were generated using GraphPad Prism software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.30.470527: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Therefore, we used a different approach: firstly, sgDI-tector computes the probability of a random sub-sequence of the viral genome to have a sub-sequence of length L (putative TRS) which appears also in the final part of the leader sequence.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Contamination: The absence of mycoplasma was regularly checked by RT-PCR in all cell lines.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The efficiency of virus amplification was evaluated by titrating the supernatant on Vero-E6 cells, in a standard plaque assay adapted from Matrosovich et al. [Matrosovich et al., 2006].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For SARS-CoV-2 infection ST-CHACE-2 cells were seeded into polylysine-coated (SIGMA) T150 flasks 1 day before infection (20×106 cells/flask).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ST-CHACE-2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Quality control was performed on an Agilent Bioanalyzer.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Agilent Bioanalyzer</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Bowtie version 2.1.0, with default parameters, was used for alignment on the reference genome (hCoV-19/France/GES-1973/2020, GI-SAID accession Id: EPI ISL 414631).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Bowtie</div><div>suggested: (Bowtie, RRID:SCR_005476)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 genome coverages were computed with bedtools genomecov for each strand.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>bedtools</div><div>suggested: (BEDTools, RRID:SCR_006646)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Reactions were performed in a final volume of 20 µL in the presence of 60 nM U3dc4-specific forward (5’-CCTTCCCAGGTAACAAAC) and reverse (5’-GTCTCAGTCCAACATTTTG) primers; or N-specific forward (5’-TAAAGGTTTATACCTTCCCA) or reverse (5’-CGTTCTCCATTCTG-GTTA) primers; or GAPDH forward (5’-CACATGGCCTCCAAGGAG-TAA) and reverse (5’-TGAGGGTCTCTCTCTTCCTCTTGT) primers. sgDI-tector pipeline: from NGS data to sgRNA detection: When sgDI-tector is run, it firstly calls DI-tector [Beauclair et al., 2018] (here used in version 0.6) with default parameters (using bwa v0.7.17, bed-tools v2.17.0 and samtools v1.9) to detect SARS-CoV-2 DVGs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>DI-tector</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>samtools</div><div>suggested: (SAMTOOLS, RRID:SCR_002105)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The data collected and used for this work have been deposited in NCBI’s Gene Expression Omnibus [Edgar et al., 2002] and are accessible through GEO Series accession number GSE180632, at https://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE180632.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gene Expression Omnibus</div><div>suggested: (Gene Expression Omnibus (GEO, RRID:SCR_005012)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code and data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.25.470011: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: The study and corresponding experiments were approved by the local ethics committee (S64089) and all patients gave their written informed consent.<br>Consent: The study and corresponding experiments were approved by the local ethics committee (S64089) and all patients gave their written informed consent.<br>Euthanasia Agents: At day 4 post-infection, animals were euthanized by intraperitoneal injection of 500 μL Dolethal (200 mg/mL sodium pentobarbital, Vétoquinol SA).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Female Syrian hamsters (Mesocricetus auratus) were purchased from Janvier Laboratories and kept per two in individually ventilated isolator cages (IsoCage N Bio-containment System, Tecniplast) at 21°C, 55% humidity and 12:12 day/night cycles.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">No randomization methods were used and confounders were not controlled, though all caretakers and technicians were blinded to group allocation in the animal facility and to sample numbers for analysis (qPCR, titration, and histology).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">No randomization methods were used and confounders were not controlled, though all caretakers and technicians were blinded to group allocation in the animal facility and to sample numbers for analysis (qPCR, titration, and histology).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">Group size was calculated based on the independent t-test with an effect size of 2.0 and a power of 80% (effect size = delta mean/SD = 1 log10 decrease in viral RNA/0.5 log10), resulting in 5-6 animals/group.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">His-tag labeled SARS-CoV-2 RBD (The Native Antigen Company) was biotinylated with the EZ-Link Sulfo-NHS-LC-Biotin kit (Thermofisher Scientific) according to the manufacturer’s protocol, corresponding to 1-3 biotin groups per antibody molecule.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Sulfo-NHS-LC-Biotin</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After the 60 minutes incubation, B cells were washed with FACS buffer and stained with PerCP-cy5.5 anti-human CD19 antibody (Biolegend, 363016)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human CD19</div><div>suggested: (BioLegend Cat# 363016, RRID:AB_2564207)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">FITC anti-human CD3 antibody (Biolegend, 300306) and PE streptavidin (Biolegend, 405203) for 25 minutes on ice.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human CD3</div><div>suggested: (BioLegend Cat# 300306, RRID:AB_314042)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">As a positive and negative control, an anti-SARS-CoV-2 RBD mAb (40150-D004, Sino Biological) and anti-SARS-CoV-2 nucleocapsid antibody (MBS2563841, MyBioSource) were used, respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 nucleocapsid antibody ( MBS2563841</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">First, mouse anti-human IgG (Fc) antibody (Human Antibody Capture Kit, Cytiva) was immobilized on a CM5 chip according to manufacturer instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Monoclonal antibody neutralization assays: a. Production of S-pseudotyped virus and serum neutralization test (SARS2, SARS1, MERS, 229E): VSV S-pseudotypes were generated as described previously56.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Two hours later, the medium was replaced by medium containing anti-VSV-G antibody (I1-hybridoma, ATCC CRL-2700) to neutralize residual VSV-G input.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-VSV-G</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, serial dilutions of antibodies were mixed separately with live SARS-CoV-2 Wuhan, alpha, beta and gamma virus strains, incubated at 37 °C for 1h, and added to the monolayer of Vero E6 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>1h</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody protein treatments (anti-SARS-CoV-2 mAbs or human IgG1 isotype control Trastuzumab/Herceptin® (Roche)) were initiated 24 hours post infection by intraperitoneal injection.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>human IgG1</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, HEK-293T cells (SARS-CoV, SARS-CoV-2 and MERS-S) or BHK-21J cells (229E) were transfected with the respective S protein expression plasmids, and one day later infected (MOI = 2) with GFP-encoding VSVΔG backbone virus (purchased from Kerafast).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-293T</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>BHK-21J</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To quantify nAbs, serial dilutions of serum samples were incubated for 1 hour at 37 °C with an equal volume of S pseudotyped VSV particles and inoculated on Vero E6 cells (SARS-CoV and SARS-CoV-2) or Huh-7 cells (229E and MERS-S) for 18 hours.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Huh-7</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Shortly, 104 VeroE6 cells/well were seeded in 96-well plates one day prior to the titration and inoculated with 10–fold serial dilutions of virus solutions and cultured for 3 days at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Infectious virus was isolated by serial passaging on Huh7 and Vero E6 cells58; passage 6 virus was used for the study described here.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Huh7</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Intramuscular pDNA electroporation: 3B8 was delivered in vivo, encoded in the CMV-driven pcDNA3.4 vectors, as an equimolar mixture of the 3B8 heavy and light chain plasmids (jointly referred to as ‘p3B8’).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.4</div><div>suggested: RRID:Addgene_131198)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Analysis was performed using Graphpad Prism 9.0 (Graphpad Software). b.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Graphpad</div><div>suggested: (GraphPad, RRID:SCR_000306)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Epitope binning graphs were made in Microsoft Excel and clustering was done with ClustVis web tool (</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Microsoft Excel</div><div>suggested: (Microsoft Excel, RRID:SCR_016137)</div></div><div style="margin-bottom:8px"><div>ClustVis</div><div>suggested: (ClustVis, RRID:SCR_017133)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Neutralization IC50 values were determined by normalizing the serum neutralization dilution curve to a virus (100%) and cell control (0%) and fitting in Graphpad Prism (GraphPad Software, Inc.). b.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Graphpad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Both strains were subjected to sequencing on a MinION platform (Oxford pore) directly from the nasopharyngeal swabs</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MinION</div><div>suggested: (MinION, RRID:SCR_017985)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT03831503</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Active, not recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">A Study of INO-A002 in Healthy Dengue Virus-naive Adults</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Reply to the reviewers

      We would like to thank the two reviewers for the valuable comments and suggestions on improvements. We addressed each reviewer’s comments individually. We have carefully revised the manuscript to incorporate new data and to make necessary clarifications.

      Overall we made the following major modifications:

      1. We investigated the relevance of BHRF1 expression in the context of EBV infection, in B cells and epithelial cells. We observed that EBV reactivation leads to MT hyperacetylation and subsequent mito-aggresome formation in both cell types. An EBV+ B cell line deficient for BHRF1 was generated and allowed us to demonstrate the involvement of BHRF1 in this phenotype. These results were added to Figures 2, 3 and Figure 1 – S1 in the revised version of the manuscript.
      2. We better characterized the mechanism leading to MT hyperacetylation, by demonstrating that BHRF1 colocalizes and interacts with the tubulin acetyltransferase ATAT1. These results were added to Figure 5 and Figure 5 – S2 in the revised manuscript.
      3. We generated stable HeLa cells KO for ATG5. Using these autophagy-deficient cells, we demonstrated the involvement of autophagy in BHRF1-induced MT hyperacetylation and mito-aggresome formation. We added these results to Figure 8 in the revised version of the manuscript.
      4. We compared the impact of BHRF1 with other mitophagy inducers on MT hyperacetylation, mitochondrial morphodynamics and the inhibition of IFN production, to demonstrate the specificity of the mechanism of action of BHRF1 (Figure 4 – S1).
      5. We demonstrated that MT hyperacetylation requires mitochondrial fission, using a Drp1-deficient HeLa cell line that we have previously described (Vilmen et al., 2020). This result was added to the revised version of the manuscript in Figure 3 – S2A. Moreover, we confirmed this result in the context of EBV infection (Figure 3 – S2B). ## Reviewer#1 Reviewer #1 (Evidence, reproducibility and clarity)

      Major comments:

      1. In the presented manuscript the authors characterize mainly BHRF1 overexpression in HeLa cells. Does BHRF1 also block type I IFN responses by microtubule hyperacetylation in the context of EBV infection? Do alpha-tubulin K40A overexpressing B cells produce more type I IFN after EBV infection?

      In the revised version of the manuscript, we added several experiments to explore the phenotype of BHRF1 during EBV infection, as requested by the two reviewers. Since EBV infects both B cells and epithelial cells, we used two different approaches. In latently-infected B cells, coming from Burkitt lymphoma (Akata cells), we induced EBV reactivation by anti-IgG treatment. To explore the importance of BHRF1 in this cell type, we constructed a cell line knocked down for BHRF1 expression, thanks to a lentivirus bearing an shRNA against BHRF1. In parallel, HEK293 cells harboring either EBV WT or EBV ΔBHRF1 genome were transfected with ZEBRA and Rta plasmids to induce the viral productive cycle in epithelial cells.

      We demonstrated that EBV infection induces MT hyperacetylation and subsequent mito-aggresome formation, both dependent on autophagy. Moreover, this phenotype requires BHRF1 expression in B cells and epithelial cells. We also observed that the expression of alpha-tubulin K40A in EBV+ epithelial cells blocks mito-aggresome formation induced by EBV reactivation. These results are now presented in Figures 2 and 3 in the revised version of the manuscript.

      Regarding regulation of IFN response during infection, several EBV-encoded proteins and non-coding RNAs have been described to interfere with the innate immune system. For example, BGLF4 and ZEBRA bind to IRF3 and IRF7, respectively, to block their nuclear activity (Hahn et al., 2005; Wang et al., 2009). Moreover, Rta expression decreases mRNA expression of IRF3 and IRF7 (Bentz et al., 2010; Zhu et al., 2014). We therefore think that studying the inhibitory role of BHRF1 on IFN response in the context of EBV reactivation will be arduous. Indeed, the lack of BHRF1 could be compensated by the activity of other viral proteins acting on innate immunity.

      1. The authors document that the observed microtubule hyperacetylation is due to the acetyltransferase ATAT1. How does BHRF1 activate ATAT1? Is there any direct interaction?

      As requested by reviewer#1, we explored a possible interaction of BHRF1 and ATAT1. First, we observed by confocal microscopy that GFP-ATAT1 colocalized with BHRF1 in the juxtanuclear region of HeLa cells (Figure 5 – S2). Second, we demonstrated by two co-immunoprecipitation assays that BHRF1 binds to exogenous ATAT1 (Figures 5E and 5F). These new results have been added to the revised version of the manuscript and clarify the mechanism of action of BHRF1.To go further, we explored whether BHRF1 was able to stabilize ATAT1 because it was recently reported that p27, an autophagy inducer that modulates MT acetylation, binds to and stabilizes ATAT1 (Nowosad et al., 2021). However, BHRF1 expression does not impact the expression of ATAT1 (data not shown).

      1. Furthermore, the authors demonstrate with pharmacological autophagy inhibitors that autophagy is increased in a BHRF1 dependent and microtubule acetylation independent manner but required for microtubule hyperacetylation. How does autophagy stimulate ATAT1 dependent microtubule hyperacetylation? Is this dependency also observed with a more specific ATG silencing or knock-out?

      We generated a stable autophagy-deficient HeLa cell line KO for ATG5, using an ATG5 CRISPR/Cas9 construct delivered by a lentivirus. The lack of ATG5 expression and LC3 lipidation was verified by immunoblot (Figure 8B). We observed that BHRF1 was unable to increase MT acetylation in this autophagy-deficient cell line (Figure 8C) in accordance with our data reported in the original manuscript using treatment with spautin 1 or 3-MA (previously Figure S5C and Figure 8A in the revised version). Moreover, the lack of hyperacetylated MT in BHRF1-expressing cells led to a dramatic reduction of mito-aggresome formation (Figures 8D and 8E). These new results demonstrate that autophagy is required for BHRF1-induced MT hyperacetylation.

      Minor comments:

      1. "Innate immunity" and "innate immune system", but not "innate immunity system" are in my opinion better wordings.

      We thank reviewer #1 for this useful comment. The term “innate immunity system” in the introduction section has been replaced by “innate immune system”. Elsewhere, we used “innate immunity”.

      1. The reader would benefit from a discussion on the role of type I IFNs during EBV infection and how important the authors think their new mechanism could be in this context.

      We thank the reviewer for this suggestion. However, we already discussed the different strategies developed by EBV to counteract IFN response induction, in our previous study, suggesting the importance of IFN in the control of EBV infection (Vilmen et al., 2020). In this study, we have focused the discussion on the role of mitophagy in the control of IFN production.

      Reviewer #1 (Significance):

      The significance of the described pathway for type I IFN production needs to be documented in the context of EBV infection.

      The revised version of the manuscript now explored the role of BHRF1 in the context of EBV infection See above for details (major comment 1).

      Reviewer#2

      Reviewer #2 (Evidence, reproducibility and clarity)

      The work presented is a relatively straightforward cell biological dissection of a subset of the previously described functions of BHRF1, focusing on the mitochondrial aggregation phenotype. The approaches and analysis are performed in cell lines mainly using overexpression and some siRNA experiments and appear well done throughout.

      We thank reviewer #2 for this comment and would like to underline that the revised version of the manuscript includes now a study of BHRF1 in the context of infection in both B cells and epithelial cells, the generation of a stable EBV positive B cells KD for BHRF1 by using shRNA approach and the generation of a stable autophagy-deficient cell line, using CRISPR/cas9 against ATG5.

      Reviewer #2 (Significance):

      The current study unpicks one of the phenotypes induced by BHRF1 over expression: namely the previously reported mitochondrial aggregation phenotype. The findings that peri-nuclear mitochondrial aggregation are dependent on microtubules and retrograde motors are useful but could perhaps have been predicted. Overexpression of many proteins (or indeed chemical treatments) causing cellular and / or mitochondrial stress have been shown to cause mitochondrial perinuclear aggregation.

      To explore the specificity of BHRF1 activity on mito-aggresome formation, we decided to investigate the impact of AMBRA1-ActA, a previously characterized mitophagy inducer, on MT (Strappazzon et al., 2015). We observed that expression of AMBRA1-ActA leads to mito-aggresome formation but does not modulate acetylation of MTs, contrary to BHRF1. This result was added to the revised version of the manuscript (Figure 4 - S1A and S1B). Moreover, chemical treatments with either oligomycin/antimycin or CCCP, which induce mitochondrial stress and mitophagy (Lazarou et al., 2015; Narendra et al., 2008), do not cause mitochondrial juxtanuclear aggregation (Figure 4 - S1C). We also observed that a hyperosmotic shock-induced by NaCl leads to MT hyperacetylation (Figure 4 - S1D) but not to the mito-aggresome formation (data not shown), suggesting that MT hyperacetylation per se is not sufficient to induce the clustering of mitochondria. Altogether, these new results demonstrated the originality of the mechanism used by BHRF1 to induce mito-aggresome formation.

      The findings linking the process to altered tubulin acetylation are more novel and interesting and may add a new dimension to understanding of BHRF1 function. However what is lacking here is really advancing our understanding of how BHRF1 does this.

      We thank the reviewer for underlining the fact that regulation of mitochondrial morphodynamics by BHRF1 via MT hyperacetylation is novel and interesting.

      In the original version of the manuscript, we have demonstrated that autophagy and ATAT1 are required for BHRF1-induced hyperacetylation. In the revised version, we uncovered that BHRF1 interacts and colocalizes with ATAT1 (Figures 5E, 5F and Figure 5 – S2). Moreover, we demonstrated that MT hyperacetylation is involved in the localization of autophagosomes next to the nucleus, thus close to the mito-aggresome. Therefore, we better characterized the mechanism of action of BHRF1 in the revised manuscript.

      Although some downstream processes are identified in the current and previous study it still remains unclear what the exact underlying mechanisms are. Is BHRF1 doing this by disrupting mitochondrial function and making the organelles sick or by causing cellular stress indirectly leading to mitochondrial pathology? Previous studies have shown that cellular stress such as altered proteostasis can also cause stress-induced mitochondrial retrograde trafficking and aggregation. Is BHRF1 causing the same phenotype by generally stressing the cell and if it is more specifically through mitochondrial disruption what is the mechanism? As demonstrated by the authors in their previous work, BHRF1 does a number of things to cell signalling. Which of these are leading to a general disruption of cell signalling versus having specific effects on the cell or mitochondria still seems somewhat unclear.

      We previously reported that BHRF1 expression does not alter the mitochondrial membrane potential (Vilmen et al., 2020). contrary to treatment by O/A or CCCP. Moreover, we observed that these treatments do not induce mitochondrial clustering (Figure 4 – S1). Therefore, BHRF1 modulates mitochondrial dynamics in a specific and regulated manner.

      Our study clearly demonstrated that BHRF1 uses an original strategy to modulate IFN response, via a regulated pathway of successive steps, from mitochondrial fission to mitophagy, via MT hyperacetylation, rather than “a general disruption of cell signalling”.

      It would be interesting to know whether the role of microtubule hyperacetylation and ATAT1 are more generally involved in other previously described processes of stress induced mitochondrial aggregation.

      In the revised version of the manuscript, we observed that AMBRA1-ActA does not change the level of MT acetylation, whereas it induces mito-aggresome formation. These data reinforce the originality of the BHRF1 mechanism.

      Currently while this is a nicely performed follow up study to their 2020 paper, the present study neither provides in depth mechanistic advance of BHRF1 function, nor a better understanding of the molecular steps in a more generally relevant pathway (e.g. mitophagy).

      We disagree with the reviewer’s comment. Indeed, in this new study, we uncovered and characterized a new mechanism of action for BHRF1 via ATAT1-dependent MT hyperacetylation. More generally, we reported for the first time that innate immunity can be regulated by the level of MT acetylation.

      In addition, all the experiments were performed in cell lines and rely on the overexpression of a viral protein. But this is a significant over-simplification of the viral pathological process. It therefore remains unclear how pathophysiologically relevant the findings are (e.g. to EBV pathology) without further extending this element of the work.

      To address this comment, we extended our results in the infectious context, by adding several experiments performed in EBV-infected cell lines (see above reviewer#1 for details). The same phenotype was observed after reactivation of the EBV productive cycle as in BHRF1 ectopic expression. Moreover, we demonstrated that the phenotype is BHRF1-dependent. This suggests the importance of BHRF1 in EBV pathogenesis by participating in innate immunity control.

      An additional minor issue is the authors naming of the process as Mito-aggresome formation. Although this might sound catchy it is somewhat unclear what the biological basis for this is. Aggresomes are defined structures that occur in cells during pathology and due to the peri-nuclear accumulation of misfolded protein. Since the process here is simply the description of aggregated mitochondria next to the nucleus but doesn't seem to have anything to do with protein misfolding it's really unclear how this labelling is helpful to the field. The process of perinuclear mitochondrial aggregation e.g. during mitochondrial stress or damage has been described many times before without the need for calling it a mito-aggresome. This term is likely to cause unhelpful confusion.

      We understand the comment of reviewer #2, but since 2010 the term “mito-aggresome” was previously used in other studies and refers to a clustering of mitochondria next to the nucleus, similarly to what we observed with BHRF1 (D’Acunzo et al., 2019; Lee et al., 2010; Springer and Kahle, 2011, 2011; Strappazzon et al., 2015; Van Humbeeck et al., 2011; Yang and Yang, 2011).

      However, we took into consideration the risk of confusion for the readers, by changing how we introduced the term “mito-aggresome” in the revised version of the manuscript (page 5 line 94).

      References

      Bentz GL, Liu R, Hahn AM, Shackelford J, Pagano JS. 2010. Epstein–Barr virus BRLF1 inhibits transcription of IRF3 and IRF7 and suppresses induction of interferon-β. Virology 402:121–128. doi:10.1016/j.virol.2010.03.014

      D’Acunzo P, Strappazzon F, Caruana I, Meneghetti G, Di Rita A, Simula L, Weber G, Del Bufalo F, Dalla Valle L, Campello S, Locatelli F, Cecconi F. 2019. Reversible induction of mitophagy by an optogenetic bimodular system. Nat Commun 10:1533. doi:10.1038/s41467-019-09487-1

      Hahn AM, Huye LE, Ning S, Webster-Cyriaque J, Pagano JS. 2005. Interferon regulatory factor 7 is negatively regulated by the Epstein-Barr virus immediate-early gene, BZLF-1. J Virol 79:10040–10052. doi:10.1128/JVI.79.15.10040-10052.2005

      Lazarou M, Sliter DA, Kane LA, Sarraf SA, Wang C, Burman JL, Sideris DP, Fogel AI, Youle RJ. 2015. The ubiquitin kinase PINK1 recruits autophagy receptors to induce mitophagy. Nature 524:309–314. doi:10.1038/nature14893

      Lee J-Y, Nagano Y, Taylor JP, Lim KL, Yao T-P. 2010. Disease-causing mutations in Parkin impair mitochondrial ubiquitination, aggregation, and HDAC6-dependent mitophagy. J Cell Biol 189:671–679. doi:10.1083/jcb.201001039

      Narendra DP, Tanaka A, Suen D-F, Youle RJ. 2008. Parkin is recruited selectively to impaired mitochondria and promotes their autophagy. J Cell Biol 183:795–803. doi:10.1083/jcb.200809125

      Nowosad A, Creff J, Jeannot P, Culerrier R, Codogno P, Manenti S, Nguyen L, Besson A. 2021. p27 controls autophagic vesicle trafficking in glucose-deprived cells via the regulation of ATAT1-mediated microtubule acetylation. Cell Death Dis 12:1–18. doi:10.1038/s41419-021-03759-9

      Springer W, Kahle PJ. 2011. Regulation of PINK1-Parkin-mediated mitophagy. Autophagy 7:266–278. doi:10.4161/auto.7.3.14348

      Strappazzon F, Nazio F, Corrado M, Cianfanelli V, Romagnoli A, Fimia GM, Campello S, Nardacci R, Piacentini M, Campanella M, Cecconi F. 2015. AMBRA1 is able to induce mitophagy via LC3 binding, regardless of PARKIN and p62/SQSTM1. Cell Death Differ 22:419–32. doi:10.1038/cdd.2014.139

      Van Humbeeck C, Cornelissen T, Hofkens H, Mandemakers W, Gevaert K, De Strooper B, Vandenberghe W. 2011. Parkin Interacts with Ambra1 to Induce Mitophagy. J Neurosci 31:10249–10261. doi:10.1523/JNEUROSCI.1917-11.2011

      Vilmen G, Glon D, Siracusano G, Lussignol M, Shao Z, Hernandez E, Perdiz D, Quignon F, Mouna L, Poüs C, Gruffat H, Maréchal V, Esclatine A. 2020. BHRF1, a BCL2 viral homolog, disturbs mitochondrial dynamics and stimulates mitophagy to dampen type I IFN induction. Autophagy 17:1296–1315. doi:10.1080/15548627.2020.1758416

      Wang J-T, Doong S-L, Teng S-C, Lee C-P, Tsai C-H, Chen M-R. 2009. Epstein-Barr Virus BGLF4 Kinase Suppresses the Interferon Regulatory Factor 3 Signaling Pathway. J Virol 83:1856–1869. doi:10.1128/JVI.01099-08

      Yang J-Y, Yang WY. 2011. Spatiotemporally controlled initiation of Parkin-mediated mitophagy within single cells. Autophagy 7:1230–1238. doi:10.4161/auto.7.10.16626

      Zhu L-H, Gao S, Jin R, Zhuang L-L, Jiang L, Qiu L-Z, Xu H-G, Zhou G-P. 2014. Repression of interferon regulatory factor 3 by the Epstein-Barr virus immediate-early protein Rta is mediated through E2F1 in HeLa cells. Mol Med Rep 9:1453–1459. doi:10.3892/mmr.2014.1957

  3. Nov 2021
    1. SciScore for 10.1101/2021.11.21.469423: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Each of the six subgenus-level datasets was aligned with MAFFT using default settings (Katoh and Standley 2013).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MAFFT</div><div>suggested: (MAFFT, RRID:SCR_011811)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Identification of potential transcriptional regulatory sequences: SuPER was used to detect transcriptional regulatory sequence leader (TRS-L) sites and a custom Python (Rossum and Drake 2010) script was used to infer transcriptional regulatory sequence body (TRS-B) sites (Yang et al. 2021).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on page 15. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.24.469813: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">In vivo antiviral activities of NV-CoV-2: Dose-response of NV-CoV-2 in rats infected with CoV-NL63: Male and female Sprague Dawley rats, 8 to 9 weeks old, were infected with 104 Cov- NL63 viral particles directly into the lungs.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The biotinylated detection antibody, 5G8-Biotin, used in this assay has been shown to be specific to NV-CoV-2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>5G8-Biotin</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The antigen (NV-CoV-2) is first immobilized onto each well of a 96-well assay plate and then incubated with diluted subject serum samples or positive control, normal serum spiked with rat Anti-NV-CoV-2 antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antigen (NV-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The bound Anti-NV- CoV-2 antibody is then detected by incubating with 1:1 mixture of HRP-conjugated Goat Anti- Rat IgG and IgM antibodies and quantitated with a chromogenic HRP substrate (TMB).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-NV- CoV-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Anti-</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgM</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, LLC-MK2 cells (for CoV NL63 virus) and MRC-5 cells (for CoV 229E virus) were plated in 96-well black, clear bottom plates at a density of 30,000 cells per well in 100 μl media for 24hr prior to infection.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>LLC-MK2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>MRC-5</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In vivo antiviral activities of NV-CoV-2: Dose-response of NV-CoV-2 in rats infected with CoV-NL63: Male and female Sprague Dawley rats, 8 to 9 weeks old, were infected with 104 Cov- NL63 viral particles directly into the lungs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Sprague Dawley</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Effect of Number of Days of Dosing of NV-CoV-2 in Rats Infected with CoV-NL63: Male and female Sprague-Dawley rats, 8 to 9 weeks old, were infected with 2 x 104 Cov- NL63 viral particles directly into the lungs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Sprague-Dawley</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The following parameters were analyzed using the Ponemah 5.20 SP9 and ECG Analysis Module v.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Ponemah</div><div>suggested: (Ponemah, RRID:SCR_017107)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.24.21266807: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      No key resources detected.


      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Limitations: Some limitations and uncertainties in this work have already been addressed, particularly those concerning the viral load and the dose-response relationship. However, there are a number of other aspects that increase uncertainty in it. Firstly, the models assume homogenous instantly mixed indoor air to simplify the estimate of a dose. This assumption is unlikely to be true in some spaces, especially in large spaces where the concentrations of virions in the air is likely be a function of the distance from the infected person. It is unclear at which space volume this assumption becomes less useful, but it is likely to be a few thousand cubic metres. The approach described in Section 2 only considers the far-field transmission of virus, and not near-field transmission, which is likely to be the dominant route of transmission. The concentration of the virus in aerosols and droplets per unit volume of air is several orders of magnitude greater closer to the infected person at distances of < 2 m [3, 9]. However, it is likely that the method of calculating the probability of viral load of infected people, P (L), is also important for the dose received by near-field transmission and should be explored further in the future. The distribution of viral load of an infected person around the median will affect the probability of transmission. We apply a log-normal distribution, see Section 2, but another, such as the Weibull distribution, will affect the transmission probabi...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.22.21266673: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: All convalescent volunteers gave their informed consent to the National Blood services of Magen David Adom.<br>IRB: The study was approved by the ethics committee of the Israeli Ministry of Health (0083-20-WOMC)[20].</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Samples: Serum samples of BriLife® vaccinees were obtained from participants in a randomized, multi-center, placebo-controlled, dose-escalation phase II of an ongoing clinical trial, aimed to evaluate the safety, immunogenicity and potential efficacy of BriLife®, an rVSV-SARS-CoV-2-S vaccine (IIBR-100) in Adults (ClinicalTrials.gov - NCT04608305).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells: Vero clone E6 cells (Vero E6, ATCC CRL-1586(tm)) were grown in growth medium [Dulbecco’s Modified Eagle’s Medium (DMEM) containing 10% fetal bovine serum (FBS), MEM nonessential amino acids (NEAA), 2 mM L-glutamine, 100 Units/ml penicillin, 0.1 mg/ml streptomycin, 12.5 Units/ml nystatin (P/S/N), all from Biological Industries, Israel].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero clone E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Calu3 cells (ATCC HTB-55) were grown in growth medium RPMI supplemented with 10% fetal bovine serum (FBS), MEM non-essential amino acids, 2 mM L-glutamine, 100 units per ml penicillin and 1% Na-pyruvate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu3</div><div>suggested: ATCC Cat# HTB-55, RRID:CVCL_0609)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Recombinant Vesicular Stomatitis Virus Indiana serotype (rVSV-WT) was propagated in Vero cells [1].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: CLS Cat# 605372/p622_VERO, RRID:CVCL_0059)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All virus stocks were tittered on Vero E6 cells by plaque assay as previously described [1].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sera from BriLife® vaccinees or COVID-19 convalescent patients were heat inactivated (HI) (56 °C for 30 min), then diluted in twofold serial dilutions (between 1:20 and 1:1280) in 300 µl of infection medium, mixed with 300 µl of either 300 pfu/ml of SARS-CoV-2 original virus, each variant (alpha, beta, gamma or delta), or rVSV-WT, and incubated at 37 °C, 5% CO2 for 1 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>rVSV-WT</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plaques in each well were numbered, and the serum dilution that neutralizes 50% of the virions (NT50) was calculated using GraphPad Prism 6 software (GraphPad Software Inc.).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04608305</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Evaluate the Safety, Immunogenicity and Potential Efficacy o…</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.22.469552: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The anti-SARS-CoV-2 RBD antibody panel used (CC6.29, CC6.32, CC6.33, CC12.1, CC12.7) was a kind gift from Dennis Burton’s lab at Scripps and were produced and purified according to Rogers et al. (Rogers et al. 2020).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 RBD</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Detection was enabled by addition of 100 µL Goat anti-Human IgG Fc secondary antibody conjugated to horseradish peroxidase (ThermoFisher #A18817), diluted 1:50,000 into PBSM and incubated in the above plate shaker for 1 h at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Human IgG</div><div>suggested: (Thermo Fisher Scientific Cat# A18817, RRID:AB_2535594)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Protein was quantified by absorbance at 280 nm using the theoretical extinction coefficient derived from the protein sequence when all four disulfide bonds are intact (WT: 33850 M-1cm-1, RBD6: 37860 M-1cm-1, RBD8: 37860 M-1cm-1, RBD10: 36370 M-1cm-1).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>M-1cm-1</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To construct plasmids pACL002-pACL006 and pACL009-pACL015 containing all RBD design sequences for yeast surface display, DNA sequences were ordered as gBlocks (IDT) and cloned into pETconV4 using restriction enzymes NdeI and XhoI (NEB).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pACL002-pACL006</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pACL009-pACL015</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To construct plasmid pACL007, the wild-type RBD sequence was amplified from plasmid pJS699 using primers forward_pJS699_RBD_pETconV4 and reverse_pJS699_RBD_pETconV4 to add regions of pETconV4 homology surrounding the RBD sequence.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pACL007</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pJS699</div><div>suggested: RRID:Addgene_168779)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">DNA sequences for plasmids pACL002-pACL006 and Design1_pETconV4-Design7_pETconV4 containing all RBD design sequences were ordered as gBlocks (IDT) and cloned into pETconV4 using restriction enzymes NdeI and XhoI (NEB).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pETconV4</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmid pACL008 was created by inserting the BbvCI restriction enzyme site into the pACL005 plasmid using site-directed mutagenesis.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pACL005</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">RBD designs to be tested further as soluble proteins were codon optimized for P. pastoris (IDT), ordered as gBlocks, and cloned into the pPICZαA secreted expression vector (ThermoFisher V19520) using EcoRI and SacII restriction sites.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pPICZαA</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">RBD designs were produced recombinantly in Pichia pastoris as follows. pPICZα vectors (ThermoFisher V19520) containing WT RBD or RBD designs were linearized by SacI and greater than 5 μl were transformed into electrocompetent P. pastoris X-33 (ThermoFisher C18000) at 2000V using a 2 mm electroporation cuvette (Bulldog Bio) and Eppendorf electroporator and then plated on yeast extract peptone dextrose plus sorbitol plates (YPDS: 1% w/v yeast extract, 2% w/v peptone, 2% v/v glucose, plus 1.0M sorbitol) supplemented with 100 μg/ml zeocin (ThermoFisher 25001).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pPICZα</div><div>suggested: RRID:Addgene_78171)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">These 90 positions were mutated to every other amino acid plus stop codon by comprehensive nicking mutagenesis (Wrenbeck et al. 2016) using NNK primers (Table S2) and template plasmid pACL008.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pACL008</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">RBD designs to be tested further as soluble proteins were codon optimized for P. pastoris (IDT), ordered as gBlocks, and cloned into the pPICZαA secreted expression vector (ThermoFisher V19520) using EcoRI and SacII restriction sites.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>gBlocks</div><div>suggested: (Gblocks, RRID:SCR_015945)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Deep sequencing analysis: All deep sequencing data analysis was performed using the Protein Analysis and Classifier Toolkit (Klesmith and Hackel 2019) available at GITHUB (https://github.com/JKlesmith/PACT).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GITHUB</div><div>suggested: (GitHub, RRID:SCR_002630)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The KD,app for each reaction was calculated using non-linear least squares regression performed using custom Python scripts.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Gel bands were quantified using ImageJ software (Abramoff et al. 2004) to determine the relative density of each band, compared to the average of 3 control (no thermolysin) samples on the same gel.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code and data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.24.469776: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: All animal experiments were performed according to Institute of Laboratory Animal Resources guidelines and the protocol was approved by the National Cancer Institute Animal Care and Use Committee.<br>Euthanasia Agents: All mice were anesthetized via isoflurane inhalation (3 - 5 % isoflurane, oxygen flow rate of 1.5 L/min) prior and during BLI using the XGI-8 Gas Anesthesia System.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">6–8-week-old male and female mice were used for all the experiments.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were washed three times and incubated with the goat anti-human-IgG Fc secondary antibody conjugated with alkaline phosphatase (AP, Southern Biotech) at a 1:1000 dilution in blocking buffer for 1 h at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human-IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody-dependent cellular phagocytosis was determined by flow cytometry, gating on THP-1 cells that were triple-positive for GFP, efluor450 and efluor670 cellular dyes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GFP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Samples were washed, sonicated, and incubated with goat anti-guinea pig C3 antibody conjugated with biotin (Immunology Consultants Laboratory) at RT for 1 h followed by incubation with streptavidin R-Phycoerythrin (PE,</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-guinea pig C3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Before and after injection, serum samples were collected at 0 min, 10min, 1 h, 6 h, 24 h and 48 h and the ACE2-Fc serum concentration was estimated by indirect ELISA in which SARS-CoV-2 RBDwt (200 ng/well) were used as capturing molecule and the goat-anti-human IgG conjugated with AP (1:1000 dilution) were used as secondary antibody.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">IgG1 Fc tag and 8xHis tag) (45), plasmids encoding the respective genes were transfected to 293F cells with the same protocol as described above.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293F</div><div>suggested: RRID:CVCL_D615)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To determine viral titers, hACE2-expressing 293T cells (gift from Dr. Allison Malloy, USUHS) were infected with serial PsV dilutions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: KCB Cat# KCB 200744YJ, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody-dependent cellular phagocytosis was determined by flow cytometry, gating on THP-1 cells that were triple-positive for GFP, efluor450 and efluor670 cellular dyes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>THP-1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Dilutions from infected cell homogenates were applied on Vero E6 monolayer. 24 hour post infection, infected Vero E6 cells were washed with PBS, lysed with Passive lysis buffer and transferred into a 96-well solid white plate (Costar Inc) and nanoluciferase activity was measured using Tristar multiwell Luminometer (Berthold Technology) for 2.5 seconds by adding 20 µl of Nano-Glo® substrate in nanoluc assay buffer (Promega Inc).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">96-well Nunc Maxisorp plates (Sigma) were coated with SARS-CoV-2 RBDwt (residue 319-541) (50ng), RBDB.1.351 (50 ng), S-2P (75 ng), SB.1.1.7 (75 ng), SB.1.351 (75ng), SP.1 (75 ng), SB.1.526 (75 ng) and SARS-CoV RBD (50ng) per well in Tris-buffered saline (TBS) at 4 °C overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SB.1.1.7</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For in vivo PsV-based inhibition assays, 6-8-week-old K18-hACE2 mice were intranasally (i.n) treated with Synagis (control IgG, 25 µg), M27 or M81 (5 or 25 µg) one hour before challenge by SARS-CoV-2 PsVD614G or PsVB.1.617.2 (i.n., ∼108 RLU)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>K18-hACE2</div><div>suggested: RRID:IMSR_GPT:T037657)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For PK studies, C57BL/6J mice were intravenously (i.v.) injected with 100 μg (5 mg/kg) of two engineered ACE2-Fc M81 or M86.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57BL/6J</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To generate SARS-CoV-2 RBDwt (residue 319-541 or residue 319-537, for crystallization), RBDB.1.1.7 (residue 329-527, N501Y) and RBDB.1.351 (residue 329-527, K417N/E384K/N501Y), the respective codon optimized DNA segments fused with an N-terminal secretion peptide and a C-terminal 6xHis tag were cloned into the pACP-tag (m)-2 vector using either EcoRI/NotI for RBDwt (319–541), RBD B.1.1.7 and RBDB.1.351 or BamHI/XhoI for RBDwt (319–537) as restriction enzymes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pACP-tag</div><div>suggested: RRID:Addgene_101126)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Monomeric ACE2wt and engineered ACE2LFMYQY2HA plasmids encoding ACE2 (residue 1-615) with C-terminal HRV-3C-cleavable 8xHis tag (45) were transfected to FreeStyle 293F cells and the resulting protein was purified over Ni-NTA columns (Cytiva).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2LFMYQY2HA</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">GraphPad Prism was used to display the mean and SEM for all groups and used to calculate the area under the curve (AUC) within the concentration range of 0.05-2.5 nM using 5% binding as baseline (Fig. 2D & S2)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Iterative cycles of model building and refinement were done in Coot (79) and Phenix (80).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Coot</div><div>suggested: (Coot, RRID:SCR_014222)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Structural analysis and Fig. generation were performed in PyMOL (81)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMOL</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All samples were acquired on an LSRII cytometer (BD Biosciences) and data analysis performed using FlowJo v10 (Tree Star)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Bioluminescence Imaging (BLI) of SARS-CoV-2 infection: All standard operating procedures and protocols for IVIS imaging of SARS-CoV-2 infected animals under ABSL-3 conditions were approved by IACUC, IBSCYU and YARC.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>YARC</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Images were acquired and analyzed with Living Image v4.7.3 in vivo software package (Perkin Elmer Inc).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Living Image</div><div>suggested: (Living Image software, RRID:SCR_014247)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The data were processed and plotted using GraphPad Prism 8 v8.4.3.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Thus far, the in vivo protective potential of an ACE2-Fc therapeutic has been tested only once in a Syrian hamster model (28) which has several limitations due to its inability to fully recapitulate SARS-CoV-2 pathogenesis and severity. To better test our lead ACE2-Fc variant we utilized a well characterized K18-hACE2 mouse model (67). Due to the constitutive high endogenous human ACE2 expression, this model is highly susceptible to SARS-CoV-2 infection and the disease progression partially recapitulates the severe pathological features of SARS-CoV-2 infection in humans. The model has also been used extensively for evaluating contributions from direct neutralization and Fc-effector activities mediated by nAbs (68) and a non-neutralizing Ab (69). However, a high basal level of hACE2 on target cells in this model, particularly in the brain, poses a significant obstacle for soluble ACE2-based antivirals such as our engineered ACE2-Fc to surmount and achieve protection. Despite these limitations, we detected a strong benefit to the administration of ACE2740 LFMYQY2HA–Fc GASDALIE variant both prophylactically and therapeutically in K18-hACE2 mice. In both settings, ACE2-Fc treatments were associated with markedly improved in vivo efficacy, e.g., a reduction in virus-induced body weight loss, pro-inflammatory cytokine responses and mortality, particularly in the therapeutic context. Given the human Fc-mouse FcγR mismatch may compromise Fc-effector functionality of ACE-Fcs in K18-hA...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on pages 56, 51 and 60. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.23.469755: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: In brief, CD34+ HSPCs were purified from human umbilical cord blood (CB) acquired from healthy donors under informed consent from the Department of Gynecology and Obstetrics, Aarhus University Hospital,</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Individuals for whom there were no cryopreserved peripheral blood mononuclear cells (PBMCs) at baseline, who were pregnant, breastfeeding or had serum total bilirubin x3 above upper limit of normal were excluded from the study.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">(Purified anti-human CD304 (Neuropilin-1), clone 12C2, BioLegend Cat#354502) or isotype control (Ultra-LEAF Purified mouse IgG2a, clone MOPC-173, BioLegend Cat#400264) antibody for 15 minutes prior to stimulation with TLR7 (2.5 μg/mL R837) agonist for 4 hrs in 200 uL, after which the culture volume was topped up to 1 mL.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human CD304</div><div>suggested: (BioLegend Cat# 354502, RRID:AB_2564475)</div></div><div style="margin-bottom:8px"><div>Neuropilin-1</div><div>suggested: (BioLegend Cat# 354502, RRID:AB_2564475)</div></div><div style="margin-bottom:8px"><div>TLR7</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To test whether type I IFN contributes to the pDC-mediated inhibition of SARS-CoV-2 inhibition, antibodies blocking the type I IFN receptor (mouse anti-human IFNAR2 antibody, clone MMHAR-2, PBL Assay Science Cat#21385-1) or isotype control (Ultra-LEAF Purified mouse IgG2a, clone MOPC-173, BioLegend Cat#400264) were added to Calu-3 cells in 50 μL PBS and antibodies neutralizing IFNα (mouse anti-human IFN alpha antibody, clone MMHA-2, PBL Assay Science Cat#21100-2) or isotype control (Purified mouse IgG1, clone MOPC-21, BioLegend Cat#400102) were added to 200 μL HSPC-pDC conditioned medium, 10 minutes prior to addition of conditioned medium to the Calu-3 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IFNAR2</div><div>suggested: (PBL Assay Science Cat# 21385-1, RRID:AB_387828)</div></div><div style="margin-bottom:8px"><div>anti-human IFN</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgG1</div><div>suggested: (BioLegend Cat# 400102, RRID:AB_2891079)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">As secondary antibodies, peroxidase-conjugated donkey-anti-rabbit and donkey-anti-mouse was used (Jackson Immuno Research 711-036-152 and 715-036-150).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>and donkey-anti-mouse</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines: Calu-3 epithelial lung cancer cells (kindly provided by Laureano de le Vega, Dundee University, Scotland, UK) and human lung adenocarcinoma epithelial A549 cells expressing hACE2 (kindly provided by Brad Rosenberg, Icahn School of Medicine at Mount Sinai, New York, USA) were grown as a monolayer in DMEM10 (Dulbecco’s minimal essential medium, DMEM, Life Technologies, supplemented with 10% (v/v) hiFCS, 2 mM L-glutamine, 100 U/mL penicillin, and 100 µg/mL streptomycin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Virus was propagated using VeroE6 cells expressing human TMPRSS2 (41).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To test whether type I IFN contributes to the pDC-mediated inhibition of SARS-CoV-2 inhibition, antibodies blocking the type I IFN receptor (mouse anti-human IFNAR2 antibody, clone MMHAR-2, PBL Assay Science Cat#21385-1) or isotype control (Ultra-LEAF Purified mouse IgG2a, clone MOPC-173, BioLegend Cat#400264) were added to Calu-3 cells in 50 μL PBS and antibodies neutralizing IFNα (mouse anti-human IFN alpha antibody, clone MMHA-2, PBL Assay Science Cat#21100-2) or isotype control (Purified mouse IgG1, clone MOPC-21, BioLegend Cat#400102) were added to 200 μL HSPC-pDC conditioned medium, 10 minutes prior to addition of conditioned medium to the Calu-3 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Limiting dilution assay: To determine the amount of infectious virus in cell culture supernatant or generated virus stocks, a limiting dilution assay was performed. 2×104 VeroE6-TMPRRS2 cells were seeded in 50 μL DMEM5 in a 96 well plate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6-TMPRRS2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell lines: Calu-3 epithelial lung cancer cells (kindly provided by Laureano de le Vega, Dundee University, Scotland, UK) and human lung adenocarcinoma epithelial A549 cells expressing hACE2 (kindly provided by Brad Rosenberg, Icahn School of Medicine at Mount Sinai, New York, USA) were grown as a monolayer in DMEM10 (Dulbecco’s minimal essential medium, DMEM, Life Technologies, supplemented with 10% (v/v) hiFCS, 2 mM L-glutamine, 100 U/mL penicillin, and 100 µg/mL streptomycin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>hACE2</div><div>suggested: RRID:Addgene_1786)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Fluorescent intensity was measured with a BD LSR-Fortessa X-20, using BD FACSDiva</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BD FACSDiva</div><div>suggested: (BD FACSDiva Software, RRID:SCR_001456)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Software, gates were set using fluorescent minus one (FMO) controls and data were analyzed with Flow-Jo software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Flow-Jo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Protein levels were quantified using the Human DuoSet ELISAs for IL-6, IL-8, TNFα, CXCL10 (R&D Systems) or the Human IFN-a pan ELISA kit (Mabtech 3425-1M-6, detecting IFN-a subtypes 1/13, 2, 4, 5, 6, 7, 8, 19, 14, 16 and 17), according to the manufacturer’s instructions on a Synergy SynergyHTX multi-mode platereader (BioTek) using the Gen5 version 3.04 program.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gen5</div><div>suggested: (Gen5, RRID:SCR_017317)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The raw data were processed using the nSOLVER 4.0 software (NanoString Technologies) for Dhigh and Dlow separately to ensure proper normalization of each dataset.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>nSOLVER</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were plotted using Prism 8.2.0 (GraphPad, La Jolla, CA, USA) and R software version 3.5.1 with the following packages installed: ggplot2, circlize, dendextend, ComplexHeatmap and RColorBrewer.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>ggplot2</div><div>suggested: (ggplot2, RRID:SCR_014601)</div></div><div style="margin-bottom:8px"><div>ComplexHeatmap</div><div>suggested: (ComplexHeatmap, RRID:SCR_017270)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Reactome pathway overrepresentation analysis: To assign pathways to the gene clusters identified in pDCs from Dhigh and Dlow 48 hrs after SARS-CoV-2 exposure using unsupervised hierarchical cluster analysis on the NanoString nCounter data, we utilized the Reactome Pathway Browser version 3.7, database release 75 (https://reactome.org/PathwayBrowser); a comprehensive web-based resource for curated human pathways.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Reactome Pathway Browser</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Disease pathways were excluded from the analyses and we used UniProt as the source of entities (maximum pathway size was 400).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>UniProt</div><div>suggested: (UniProtKB, RRID:SCR_004426)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To determine correlation between IFNα production by pDCs and time of exposure to SARS-CoV-2, as well as to compare gene expression changes in Dhigh and Dlow after 4 and 48 hrs after exposure to SARS-CoV-2, and determine correlation between pDC frequency and disease severity, simple linear regression analysis were performed using GraphPad Prism.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.22.469576: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: All animal experiments were approved by the Animal Care and Use Committees at UTMB and Houston Methodist Academic Institute, respectively.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were harvested and stained with antibodies for cell surface markers, including CD80 or CD86 antibodies (BioLegend), and acquired by a BD LSR II flow cytometer (BD Biosciences).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD80</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD86</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">This will be followed by a 1 h incubation with biotinylated HRP conjugated goat anti-mouse IgG subtype antibodies (Southern Biotech). 3,3’,5,5’ tetramethylbenzidine (TMB, BD Biosciences) were added to the well for 15 min and reactions were stopped by sulfuric acid.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For IgA measurement, goat anti-mouse IgA (Southern Biotech) coupled to horseradish peroxidase (HRP) was added as the secondary antibody at a 1:2000 dilution for 1 h at 37C, followed by adding TMB (3, 3, 5, 5’-tetramethylbenzidine) peroxidase substrate (Thermo Scientific) for about 15 min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgA</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were stained with antibodies for CD3, CD4, or CD8, fixed in 2% paraformaldehyde, and permeabilized with 0.5% saponin before adding anti-IFN-γ, or control rat IgG1 (e-Biosciences).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD3</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD4</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD8</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-IFN-γ,</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>rat IgG1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After blocking with 1% BSA plus 5% FBS, cells were incubated with anti-EEA1 antibody (1:500, Abcam) at 4°C overnight, followed by staining with AF488 -labeled goat anti-rabbit secondary antibody (1:1000 dilution, ThermoFisher) at room temperature for 2 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-EEA1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The vector was then packaged into lentivirus to transduce 293FT cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293FT</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viruses: SARS-CoV-2 Beta variant, and Delta variant were obtained from the World Reference Center for Emerging Viruses and Arboviruses (WRCEVA) at the University of Texas Medical Branch (UTMB) and were amplified twice in Vero E6 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero CCL-81 cells (1.2 ×104) in 50 μl of DMEM containing 2% FBS were seeded in each well of black μCLEAR flat-bottom 96-well plate (Greiner Bio-one™).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CCL-81</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The virus-serum mixture was transferred to the Vero CCL-81 cell plate with the final multiplicity of infection (MOI) of 0.5.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero CCL-81</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mice: 6-week-old BALB/c mice, C57BL/(B)6 mice, and K18 hACE2 mice (stock #034860) were purchased from Jackson Lab.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57BL/</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, BM cells isolated from BALB/c mice were cultured for 6 days in medium supplemented with granulocyte-macrophage colony-stimulating factor (GM-CSF) and IL-4 (Peprotech) to generate DCs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/c</div><div>suggested: RRID:IMSR_APB:4790)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vaccine preparation: To express and purify the RBD protein, the amino acid residues of 319 to 541 of SARS-CoV-2 S protein were cloned into the lentivirus vector, pCDH-CMV-MCS-EF1α-RFP (System Biosciences).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCDH-CMV-MCS-EF1α-RFP</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were analyzed using FlowJo software (BD Biosciences).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plates were washed and scanned using an ImmunoSpot 6.0 analyzer and analyzed by ImmunoSpot software to determine the spot-forming cells (SFC) per 106 splenocytes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImmunoSpot</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Values for viral load, cytokine production, antibody titers, and T cell response experiments were compared using Prism software (GraphPad) statistical analysis and were presented as means ± SEM.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Douglas Engelbart In the early 1950s, Doug decided that instead of having a steady job he would focus on making the world a better place, especially through the use of computers to help cope with the world’s increasingly urgent and complex problems.

    1. replacements <- c("A" = "a", "B" = "b", "C" = "c", "D" = "d", "E" = "e", "F" = "f", "G" = "g", "H" = "h", "I" = "i", "J" = "j", "K" = "k", "L" = "l", "M" = "m", "N" = "n", "O" = "o", "P" = "p", "Q" = "q", "R" = "r", "S" = "s", "T" = "t", "U" = "u", "V" = "v", "W" = "w", "X" = "x", "Y" = "y", "Z" = "z")

      An easy way to do it without typing the entire alphabet:

      alphabet <- letters

      names(alphabet) <- LETTERS

    1. SciScore for 10.1101/2021.11.17.21266367: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Ethical Approval: This study was approved by the Institutional Review Board at the University of North Carolina at Chapel Hill.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Similar procedures were conducted at month 1 and 3 with one exception: at month 1, participants were provided a Tasso device (Tasso, Inc., Seattle, WA, USA) for self-administered blood collection (30-80 μl), which they could take home and return at a later time to test for SARS-CoV-2 antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The first was the commercially available Abbott SARS-CoV-2 assay (Abbott, Chicago, IL, USA) to detect IgG antibodies to nucleocapsid antigen using a chemiluminescent microparticle immunoassay (CMIA), which had received an EUA.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>detect IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The CMIA provides qualitative detection of SARS-CoV-2 IgG antibodies on the Abbott Architect instrument.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2 IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The assay plate was washed, then a cocktail of horseradish peroxidase-conjugated secondary Goat Anti-Human IgG, IgA, and IgM secondary antibodies was used to measure antigen-specific total Ig.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-Human IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgM</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>antigen-specific total Ig.</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Using primers based on the Respiratory Diagnostic Clinic assay and human RNA control primers, amplicons were amplified and then quantified using a ThermoFisher QuantStudio 7 system.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ThermoFisher QuantStudio</div><div>suggested: (Primer Express Software, RRID:SCR_017376)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The first was the commercially available Abbott SARS-CoV-2 assay (Abbott, Chicago, IL, USA) to detect IgG antibodies to nucleocapsid antigen using a chemiluminescent microparticle immunoassay (CMIA), which had received an EUA.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Abbott</div><div>suggested: (Abbott, RRID:SCR_010477)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.17.21266404: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Literature Search: We systematically searched seven databases: MEDLINE, Embase, Web of Science, COVID-END, L- OVE, CDSR, and WHO Ovid.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MEDLINE</div><div>suggested: (MEDLINE, RRID:SCR_002185)</div></div><div style="margin-bottom:8px"><div>Embase</div><div>suggested: (EMBASE, RRID:SCR_001650)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">We also searched Web of Science (Core Collection) and the Cochrane Database of Systematic Reviews.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Cochrane Database of Systematic Reviews</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">We downloaded and deduped the records using EndNote 9.3.3 (Clarivate) and uploaded to DistillerSR (Evidence Partners).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>EndNote</div><div>suggested: (EndNote, RRID:SCR_014001)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Numerous studies have investigated the relationship between patient portal utilization and health outcomes, specifically indicating a link between increased portal use and increased rates of patient engagement [Price-Haywood EG, Luo Q. Primary Care Practice Reengineering and Associations With Patient Portal Use, Service Utilization, and Disease Control Among Patients With Hypertension and/or Diabetes. Ochsner J 2017;17(1):103-111 [FREE Full text] [Medline]6-Lyles CR, Sarkar U, Schillinger D, Ralston JD, Allen JY, Nguyen R, et al. Refilling medications through an online patient portal: consistent improvements in adherence across racial/ethnic groups. J Am Med Inform Assoc 2016 Apr;23(e1):e28-e33 [FREE Full text] [CrossRef] [Medline]9]. Notably, engaged individuals more actively participate in the management of their health care [Tulu B, Trudel J, Strong DM, Johnson SA, Sundaresan D, Garber L. Patient Portals: An Underused Resource for Improving Patient Engagement. Chest 2016 Jan;149(1):272-277. [CrossRef] [Medline]10] and report enhanced patient satisfaction [Dendere R, Slade C, Burton-Jones A, Sullivan C, Staib A, Janda M. Patient Portals Facilitating Engagement With Inpatient Electronic Medical Records: A Systematic Review. J Med Internet Res 2019 Apr 11;21(4):e12779 [FREE Full text] [CrossRef] [Medline]11], a finding increasingly critical in patients with chronic diseases [McAlearney AS, Sieck CJ, Hefner JL, Aldrich AM, Walker DM, Rizer MK, et al. High Touch and High Tech (HT2) Proposal: Transforming Patient Engagement Throughout the Continuum of Care by Engaging Patients with Portal Technology at the Bedside. JMIR Res Protoc 2016 Nov 29;5(4):e221 [FREE Full text] [CrossRef] [Medline]12]. Patient portal utilization has been linked to “significant decreases in office visits…, changes in medication regimen, and better adherence to treatment” [Kruse CS, Bolton K, Freriks G. The effect of patient portals on quality outcomes and its implications to meaningful use: a systematic review. J Med Internet Res 2015 Feb 10;17(2):e44 [FREE Full text] [CrossRef] [Medline]13], along with improved chronic disease management and disease awareness [Sarkar U, Lyles CR, Parker MM, Allen J, Nguyen R, Moffet HH, et al. Use of the refill function through an online patient portal is associated with improved adherence to statins in an integrated health system. Med Care 2014 Mar;52(3):194-201 [FREE Full text] [CrossRef] [Medline]8,Lyles CR, Sarkar U, Schillinger D, Ralston JD, Allen JY, Nguyen R, et al. Refilling medications through an online patient portal: consistent improvements in adherence across racial/ethnic groups. J Am Med Inform Assoc 2016 Apr;23(e1):e28-e33 [FREE Full text] [CrossRef] [Medline]9]. Interestingly, even the content of patient messages was recently found to be associated with estimated readmission rates in patients with ischemic heart disease [Sulieman L, Yin Z, Malin BA. Why Patient Portal Messages Indicate Risk of Readmission for Patients with Ischemic Heart Disease. AMIA Annu Symp Proc 2019;2019:828-837 [FREE Full text] [Medline]14]. In these ways, patient portals have been cited as essential components of the solution to the cost and quality health care crisis in the United States [Irizarry T, DeVito DA, Curran CR. Patient Portals and Patient Engagement: A State of the Science Review. J Med Internet Res 2015 Jun;17(6):e148 [FREE Full text] [CrossRef] [Medline]2].

      Value of patient portals

    1. SciScore for 10.1101/2021.11.17.468942: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">First, 1 μl random hexamers (50 ng/μl), 1 μl dNTPs mix (10 mM each), and 11 μl template RNA (diluted 1:10 in DNase/RNase free water) were mixed, incubated at 65°C for 5 min and placed on ice for 1 min.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Inhibition by IFITM2 antibody and Remdesivir: 30,000 iATII cells were seeded as single cells in 96-well plates coated for 1 h at 37 °C with 0.16 mg/ml Matrigel (Corning, Cat#356238) diluted in DMEM/F12 (Thermo Fisher, Cat#11330032), 24 h later cells were treated with increasing concentrations (20, 40, 80 μg/ml) of α-IFITM2 (Cell Signaling, Cat#13530 S) or Remdesivir (Selleck Chemicals Cat#S8932) (10 μM).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IFITM2</div><div>suggested: (Cell Signaling Technology Cat# 13530, RRID:AB_2798248)</div></div><div style="margin-bottom:8px"><div>α-IFITM2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Proteins were stained using primary antibodies against IFITM1 (α-IFITM1, Cell Signaling Cat#13126S, 1:1,000), IFITM2 (α-IFITM2 Cell Signaling Cat#13530 S, 1:1,000), IFITM3 (α-IFITM3 Cell Signaling Cat#59212S, 1:1,000), ACE2 (Rabbit polyclonal anti-ACE2 Abcam, Cat#ab166755, 1:1,000); rat anti-GAPDH (Biolegend Cat#607902, 1:1,000) and SARS CoV-2 N (anti-SARS-CoV-2 N Sino Biologicals Cat#40588-V08B, 1:1,000) and Infrared Dye labeled secondary antibodies (LI-COR IRDye).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IFITM1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>α-IFITM1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IFITM3</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>α-IFITM3</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-GAPDH</div><div>suggested: (BioLegend Cat# 607902, RRID:AB_2734503)</div></div><div style="margin-bottom:8px"><div>anti-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Caco-2 cells (human epithelial colorectal adenocarcinoma, kindly provided by Prof. Holger Barth (Ulm University)) were grown in the same media as Vero E6 cells but with supplementation of 10% heat-inactivated FBS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 strains were propagated on Vero E6 (NL-02-2020, Delta), VeroE6 overexpressing TMPRSS2 (Alpha), CaCo-2 (Beta) or Calu-3 (Gamma) cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">6 h after the second transfection, Calu-3 cells were infected with the various SARS-CoV-2 variants at an MOI of 0.05.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: BCRJ Cat# 0264, RRID:CVCL_0609)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The obtained sequenced reads were demultiplexed and mapped against the SARS-CoV-2 reference genome (NC_045512.2) with BWA-MEM3.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BWA-MEM3</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.15.468633: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Quantifications were done blind.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Authentication: After 48 h, cells expressing mCherry have been validated.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After washing, the cells were incubated 2 minutes in 0.05% PBS-tween and then incubated with the primary antibody, a polyclonal SARS-CoV-anti-N IgG, provided by Nicolas Escriou, Institut Pasteur, Paris (or alternatively with a Human SARS-CoV-2 anti-S IgG provided by Cyril Planchais from the group of Hugo Mouquet Institut Pasteur, Paris), overnight at 4 degrees.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgG provided by Cyril Planchais from the group of Hugo Mouquet Institut Pasteur , Paris) , overnight at 4 degrees</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After washing the cells were then incubated with an anti-rabbit (or an anti-human) HRP-conjugated antibody for 1 hour.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human </div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The primary antibody used were: a rabbit anti-Nucleoprotein (Anti-N, gift from Nicolas Escriou, Institut Pasteur, Paris) (1:500) over night (ON); an anti-human anti-Spike (H2-162, produced by Cyril Planchais from the group of Hugo Mouquet Institut Pasteur, Paris) (1: 100) ON, an anti-mouse J2 (1:50) (Scicons) ON, an anti-sheep nsp3 (1:200) (MRC PPU Reagents).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Nucleoprotein</div><div>suggested: (Bio X Cell Cat# BE0106, RRID:AB_10949017)</div></div><div style="margin-bottom:8px"><div>Anti-N , gift from Nicolas Escriou , Institut Pasteur , Paris </div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human anti-Spike ( H2-162</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-mouse J2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-sheep nsp3</div><div>suggested: (Novus Cat# NB110-61650, RRID:AB_2291744)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The day after, cells were thoroughly washed and incubated for 40 min with an anti-rabbit Alexa-Fluor 633-conjugated secondary antibody (Invitrogen), an anti-human Alexa-Fluor 488-conjugated secondary antibody (Invitrogen), goat anti-mouse Alexa-Fluor 633-conjugated secondary antibody (Invitrogen) at 1:500 in 2% BSA (w/v) in PBS 1X respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: (GenWay Biotech Inc. Cat# GWB-D633F6, RRID:AB_10283907)</div></div><div style="margin-bottom:8px"><div>anti-human Alexa-Fluor 488-conjugated secondary antibody ( Invitrogen)</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-mouse</div><div>suggested: (GenWay Biotech Inc. Cat# GWB-F633A0, RRID:AB_10279445)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For correlative light-and cryo-electron microscopy using the anti-S primary antibody, cells were fixed with PFA 4% for 15 min at 37 °C, quenched with 50 mM NH4Cl for 15 min, and blocked with PBS containing 2% BSA (w/v) for ON at 4 °C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-S</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were labeled with an anti-human AlexaFluor 488-conjugated secondary antibody (Invitrogen) at 1:500 and labelled with HCS Cell Mask TM Blue Stain (Invitrogen, 1:300).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human AlexaFluor 488-conjugated secondary antibody ( Invitrogen )</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The cell-lines used in this assay included Caco-2, CAD, SH-SY5Y and Vero E6.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">250 μl of each dilution was used to infect a confluent monolayer of Vero E6 cells, in a 24 wells multiwell plate, for a total of 6 wells per sample.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Lentiviral Transduction: Transduction of SH-SY5Y and Vero E6 cells with a lentiviral vector expressing pCMV-mcherry: 600.000 SH-SY5Y cells 400.000 Vero-E6 were plated in 60 mm plates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SH-SY5Y</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To evaluate the possibility of SARS-CoV-2 transfer from donor to acceptor cells mediated by secretion, the supernatants from SARS-CoV-2 infected Vero-E6 cells were collected centrifuged at 1000 rpm for 10 min to remove floating cells and added on acceptor cells: SH-SY5Y mCherry.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Lentiviral Transduction: Transduction of SH-SY5Y and Vero E6 cells with a lentiviral vector expressing pCMV-mcherry: 600.000 SH-SY5Y cells 400.000 Vero-E6 were plated in 60 mm plates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV-mcherry</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Transduction of SH-SY5Y cells with a lentiviral vector expressing pCMV-H2B-GFP: 600.000 SH-SY5Y cells were plated in 60 mm plates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV-H2B-GFP</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The whole cellular volume was imaged by acquiring 0.45 µm Z-stacks with an inverted confocal microscope (Zeiss LSM 700) using ZEN software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ZEN</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The 3D rendering of TNTs were performed using IMARIS software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IMARIS</div><div>suggested: (Imaris, RRID:SCR_007370)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: All column graphs and statistical analysis were performed by using GraphPad Prism version 7 software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">PCC was calculated by using JACoP plugins in Fiji.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Fiji</div><div>suggested: (Fiji, RRID:SCR_002285)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on pages 53, 39 and 31. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.16.468777: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">First, 1 µl random hexamers (50 ng/µl), 1 µl dNTPs mix (10 mM each), and 11 µl template RNA (diluted 1:10 in DNase/RNase free water) were mixed, incubated at 65°C for 5 min and placed on ice for 1 min.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero E6 cells (Cercopithecus aethiops derived epithelial kidney, ATCC) and TMPRSS2-expressing Vero E6 cells (kindly provided by the National Institute for Biological Standards and Control (NIBSC), No. 100978) were grown in Dulbecco’s modified Eagle’s medium (DMEM, Gibco, Cat#41965039) supplemented with 2.5% (upon and after viral infection) or 10% (during all other times) heat-inactivated FBS (Gibco, Cat#10270106), 100 units/ml penicillin, 100 µg/ml streptomycin (ThermoFisher, Cat#15140122), 2 mM L-glutamine (Gibco, Cat#25030081), 1 mM sodium pyruvate (Pan Biotech, Cat# P04-8010), 1x non-essential amino acids (Sigma, Cat#M7145) and 1 mg/mL Geneticin (Gibco, Cat#10131-019) (for TMPRSS2-expressing Vero E6 cells).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Caco-2 cells (human epithelial colorectal adenocarcinoma, kindly provided by Prof. Holger Barth (Ulm University)) were grown in the same media as Vero E6 cells but with supplementation of 10% heat-inactivated FBS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">24 h post-seeding, Calu-3 cells were infected with the different variants of SARS-CoV-2 (MOI 0.05).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: BCRJ Cat# 0264, RRID:CVCL_0609)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The obtained sequenced reads were demultiplexed and mapped against the SARS-CoV-2 reference genome (NC_045512.2) with BWA-MEM[36].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BWA-MEM[36</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The mapped reads and the pileup file were used to construct the consensus sequence with the iVar package[38] using default settings.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>iVar</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.15.468720: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: Ethics statement: All animal studies and experiments were approved and performed under the Kansas State University (KSU) Institutional Biosafety Committee (IBC, Protocol #1460) and the Institutional Animal Care and Use Committee (IACUC, Protocol #4508.2) in compliance with the Animal Welfare Act.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Virus challenge of animals: Ten male sheep, approximately 6 months of age, were acquired from Frisco Farms (Ewing, IL) and acclimated for ten days in BSL-3Ag biocontainment with feed and water ad libitum prior to experimental procedures.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Two independent veterinary pathologists (blinded to the treatment groups) examined the slides and morphological descriptions were provided.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Following three washes with PBS-T, 100 μL of HRP-labelled Rabbit Anti-Sheep IgG (H+L) secondary antibody (VWR, Batavia, IL, USA) diluted 1:1000 (100ng/mL) was added to each well and incubated for 1 hour at RT.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-Sheep IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Indirect ELISA was used to detect bovine coronavirus (BCoV) antibodies in sera with Spike (S) recombinant viral protein (LSBio, Seattle, WA, USA) using the methods described above.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BCoV </div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2-specific immunohistochemistry (IHC): IHC was performed as previously described (29) on four-micron sections of formalin-fixed paraffin-embedded tissue mounted on positively charged Superfrost® Plus slides and subjected to IHC using a SARS-CoV-2-specific anti-nucleocapsid rabbit polyclonal antibody (3A, developed by our laboratory) with the method previously described (30).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-nucleocapsid</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Virus isolation was performed by culturing 100 µl of filtered (0.2 µm; MidSci, St. Louis, MO) sample /well in duplicate on Vero E6/TMPRRS2 cells and monitoring for CPE for up to 5 days post inoculation.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6/TMPRRS2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Susceptibility of ovine and bovine cells to SARS-CoV-2: The SARS-CoV-2 USA-WA1/2020 strain was passaged 3 times in Vero-E6 cells to establish a stock virus for infection experiments.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell supernatants were titrated on Vero E6 cells to determine SARS-CoV-2 replication kinetics by virus titers (TCID50/mL).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The mixture was subsequently cultured on Vero-E6/TMPRSS2 cells in 96-well plates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6/TMPRSS2</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Swabs were placed in 2mL of viral transport medium (DMEM, Corning; combined with 1% antibiotic-antimycotic, ThermoFisher), vortexed, and aliquoted directly into cryovials and RNA stabilization/lysis Buffer RLT (Qiagen, Germantown, MD, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ThermoFisher</div><div>suggested: (ThermoFisher; SL 8; Centrifuge, RRID:SCR_020809)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To determine an accurate relative percentage of each SARS-CoV-2 lineage in each sample, BLAST databases were first generated from individual trimmed and filtered sample reads.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BLAST</div><div>suggested: (BLASTX, RRID:SCR_001653)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, McKinney, TX, for 4-7 days at room temperature), trachea, and lungs as well as various other extrapulmonary tissues (liver, spleen, kidneys, heart, pancreas, gastrointestinal tract [stomach, small intestine including Peyer’s patches and colon], cerebrum [including olfactory bulb], tonsils and numerous lymph nodes) were routinely processed and embedded in paraffin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Peyer’s</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.10.468174: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: This work was approved by the Indiana University Institutional Review Board (IRB# 2004155084)</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Of the patients, the average age was 58 years (range 13-93 years), 25 (45%) were female and 27 (49%) had more than one specimen assessed.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Contamination: Cells and Viruses: Vero E6 cells (mycoplasma negative) were grown at 37°C in 5% CO2 in Dulbecco’s modified Eagle’s medium (DMEM) (Sigma-Aldrich, St. Louis, MO) containing 10% fetal bovine serum (FBS) (Wisent Inc.), 2 mM L-glutamine (Thermo Fisher Scientific, Waltham, MA), 50 U/mL penicillin (Thermo Fisher Scientific), and 50 μg/mL streptomycin (Thermo Fisher Scientific).</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Following a one-hour incubation at 37°C, the serum-virus mixture was transferred to 96-well plates containing high-passage Vero E6 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 B.1.617.2 was obtained with contributions from B. Zhou, N. Thornburg and S. Tong (Centers for Disease Control and Prevention, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2 B.1.617.2</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.02.466951: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The blots were then probed with SARS-CoV-2 spike antibody (NR-52947, BEI Resources, NIAID, NIH) in blocking buffer for 12 hr at 4°C, followed by secondary Goat Anti-Rabbit IgG antibody (ab6721, Abcam, RRID:AB_955447) incubation for 2hr.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-Rabbit IgG</div><div>detected: (Abcam Cat# ab6721, RRID:AB_955447)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Actin was labelled using antibody against beta-actin [AC-15] (HRP) (ab49900, Abcam, RRID: AB_867494).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antibody against beta-actin</div><div>detected: (Abcam Cat# ab49900, RRID:AB_867494)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The HEK293 cells were transfected with 100 ng/well of pGL3-Fluc plasmid using Lipofectamine 2000 (Thermo Fisher Scientific) according to the manufacturer’s protocol at around 75-90% confluency in a 96 well plate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells and virus: The following cell lines were used in this study, namely HEK 293T cells (CRL-1573, ATCC, RRID: CVCL_0045)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293T</div><div>detected: (NIH-ARP Cat# 103-306, RRID:CVCL_0045)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, HEK 293T cells stably expressing human ACE2 (NR-52511, BEI Resources, NIAID, NIH, RRID:</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, Vero-E6 cells (CRL-1586, ATCC, RRID: CVCL_0574).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>detected: (IZSLER Cat# BS CL 87, RRID:CVCL_0574)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">NR-52282, BEI Resources, NIAID, NIH) was propagated and quantified by plaque assay in Vero-E6 cells as described before (Case et al., 2020)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cytotoxicity assay: HEK-ACE2 cells were seeded in 0.1 mg/mL poly-L-lysine (P9155-5MG, Sigma-Aldrich) coated 96-well plate to reach 70-80% confluency after 24 Hrs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Virus infection: HEK ACE2 cells were seeded in poly-L-lysine coated 24-well plate to reach 80% confluency at the time of infection.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Nsp1 expression and purification: The gene construct encoding the Nsp1 from SARS-CoV-2 in pCDNA 5-3X-Flag-Nsp1 was amplified and sub-cloned into pET28a with N-terminal His-tag (Schubert et al., 2020; Thoms et al., 2020) using appropriate primers (Supplementary table 1).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCDNA 5-3X-Flag-Nsp1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pET28a</div><div>suggested: RRID:Addgene_114156)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">the cultures were then transferred at 16°C at 120 rpm, and the expression of pET28a-His-Nsp1 and pET28a-His-Nsp1Δ40 were induced by adding 1 mM of Isopropyl β-d-1-thiogalactopyranoside (IPTG) and allowed to grow for 18 hours.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pET28a-His-Nsp1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pET28a-His-Nsp1Δ40</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The HEK293 cells were transfected with 100 ng/well of pGL3-Fluc plasmid using Lipofectamine 2000 (Thermo Fisher Scientific) according to the manufacturer’s protocol at around 75-90% confluency in a 96 well plate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pGL3-Fluc</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plasmid expressing the Nsp1 protein (pcDNA 3.1-Nsp1) was co-transfected at 100 ng/well concentration.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA 3.1-Nsp1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 48 hr incubation, cells were fixed with 4% paraformaldehyde, and crystal violet (C6158, Merck) staining was done to visualize the plaques. Plasmids: pLVX-EF1alpha-SARS-CoV-2-nsp1-2xStrep-IRES-Puro expressing SARS CoV-2 NSP1 was a kind gift from Prof. Nevan Krogan (Gordon et al., 2020).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLVX-EF1alpha-SARS-CoV-2-nsp1-2xStrep-IRES-Puro</div><div>suggested: RRID:Addgene_141367)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Other plasmids used in this study include Plasmids pRL-TK (mammalian vector for weak constitutive expression of wild-type Renilla luciferase), pGL4 (mammalian vector expressing firefly luciferase), pIFN-β Luc (IFN beta promoter-driven firefly luciferase reporter).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pRL-TK</div><div>suggested: RRID:Addgene_11313)</div></div><div style="margin-bottom:8px"><div>pGL4</div><div>suggested: RRID:Addgene_48744)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plasmid pMTB242 pcDNA5 FRT-TO-3xFLAG-3C-Nsp1_SARS2 was a kind gift from Prof. Ronald Beckmann.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pMTB242</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Finally, the library was screened against the 18S rRNA interacting interface of Nsp1-C-ter using the Surflex-dock program, which is available in SYBYL v2.1 (Jain, 2003).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Surflex-dock</div><div>suggested: (Surflex-Dock, RRID:SCR_000196)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The data was analysed by using ThermControl software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ThermControl</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The two subsequent 100 ns runs from MD simulations were further subjected to perform the MM-PBSA by using the python script (mmpbsa.py) to calculate the binding energy of the two drugs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Relative intensity of bands was quantified using Fiji/imageJ.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Fiji/imageJ</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.09.467693: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: Sample collection and studies were performed in accordance with the UK Policy Framework for Health and Social Care Research and with specific Research Ethics Committee approval (REC 20/SC/0310).<br>IRB: Sample collection and studies were performed in accordance with the UK Policy Framework for Health and Social Care Research and with specific Research Ethics Committee approval (REC 20/SC/0310).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Membranes were blocked in milk prior to detection with specific antibodies: 1:1000 ACE2 rabbit (Abcam, Ab108209),1:5000</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells and plasmids: HEK293T-17 (ATCC, CRL-11268™), Calu-3 (ATCC, HTB-55™), A549-ACE2, Vero-E6, Vero-E6-TMPRSS2 and A549-ACE2 expressing the individual IFITM proteins were cultured in DMEM (Gibco) with 10% FBS (Invitrogen) and 200μg/ml Gentamicin (Sigma), and incubated at 37°C, 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: ATCC Cat# HTB-55, RRID:CVCL_0609)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A549 stable cell lines expressing ACE2 (pMIGR1-puro), and IFITMs (pLHCX) were generated and selected as described previously (Winstone et al., 2021)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Passage and titration of SARS-CoV-2: PHE England strain 02/2020 was propagated in Vero-E6-TMPRSS2 cells and titre was determined by plaque assay (Winstone et al., 2021).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6-TMPRSS2</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Approximately 2.5 μg of the in vitro synthesized RNA was used to transfect ∼6 ×105 BHK-hACE2-N cells stably expressing the SARS-CoV-2 N and the human ACE2 genes(Rihn et al., 2021) using the MessengerMax lipofection kit (Thermo Scientific) as per the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK-hACE2-N</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were then incubated until signs of viral replication (syncytia formation) became visible (usually after 2-3 days), at which time the medium was collected (P0 stock) and used further as a source of rescued virus to infect VERO E6 cells to generate P1 and P2 stocks.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VERO E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Generation of Clinical Viral Isolates: Viruses were isolated on Vero.E6 cells (ATCC CRL 1586™) from combined naso-oropharyngeal swabs submitted for routine diagnostic testing by real-time RT-PCR and shown to be from the B.1.1.7 (alpha) variant by on-site whole-genome sequencing (Oxford Nanopore Technologies, Oxford, UK) (Pickering et al., 2021)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero.E6</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viral RNA levels in cells or supernatants were measured 48 hours after infection by RT-qPCR. siRNA knockdown of IFITM2: A549-ACE2 cells were reverse transfected using 20pmol of Non-targeting siRNA (D-001206-13-20) or IFITM2 siRNA (M-020103-02-0010) and 1μL of RNAi max (Invitrogen).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A549 stable cell lines expressing ACE2 (pMIGR1-puro), and IFITMs (pLHCX) were generated and selected as described previously (Winstone et al., 2021)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pMIGR1-puro</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, a set of overlapping cDNA fragments representing the entire genomes of SARS-CoV-2 Wuhan isolate (GenBank: MN908947.3) and the B.1.1.7 alpha variant were chemically synthesized and cloned into pUC57-Kan (Bio Basic Canada Inc and Genewiz, respectively).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pUC57-Kan</div><div>suggested: RRID:Addgene_123653)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To generate Wuhan virus carrying the alpha variant spike, a mixture of the relevant synthetic cDNA fragments of the Wuhan and alpha variants was co-transformed with XhoI-BamHI-cut pEB2 into the Saccharomyces cerevisiae strain TYC1 (MATa, ura3-52, leu2Δ1, cyh2r, containing a knockout of DNA Ligase 4) (Gaida et al., 2011) that had been made competent for DNA uptake using the LiCl2-based Yeast transformation kit (YEAST1-1KT, Merck).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pEB2</div><div>suggested: RRID:Addgene_104001)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viruses were sequenced using Oxford Nanopore as previously described(da Silva Filipe et al., 2021).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Oxford Nanopore</div><div>suggested: (Oxford Nanopore Technologies, RRID:SCR_003756)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.22.465481: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: All studies were approved by the Emory Institutional Review Board (IRB) under protocol numbers IRB00058507, IRB00057983 and IRB00058271.<br>Consent: Informed consent was obtained from the patients when they had decision making ability or from a legal authorized representative (LAR) if the patient was unable to provide consent.<br>Field Sample Permit: All work with infectious virus and respiratory samples from COVID-19 patients was conducted inside a biosafety cabinet within the Emory Health and Safety Office (EHSO)- and United States Department of Agriculture (USDA)-approved BSL3 containment facility in the Health Sciences Research Building at Emory University following protocols approved by the Institutional Biosafety Committee (IBC) and Biosafety Officer. 2.2 Virus and cells: African green monkey (Cercopithecus aethiops) kidney epithelial cells (Vero E6 cells; ATCC® CRL-1586™) were maintained in complete (c)DMEM containing: 1X DMEM supplemented with 25 mM HEPES, 2 mM L-glutamine,1 mM sodium pyruvate, 1X non-essential amino acids (NEAA), 1X antibiotic/antimycotic solution (all from Corning) and 10% heat-inactivated FBS (Gibco), unless indicated otherwise.<br>IACUC: All work with infectious virus and respiratory samples from COVID-19 patients was conducted inside a biosafety cabinet within the Emory Health and Safety Office (EHSO)- and United States Department of Agriculture (USDA)-approved BSL3 containment facility in the Health Sciences Research Building at Emory University following protocols approved by the Institutional Biosafety Committee (IBC) and Biosafety Officer. 2.2 Virus and cells: African green monkey (Cercopithecus aethiops) kidney epithelial cells (Vero E6 cells; ATCC® CRL-1586™) were maintained in complete (c)DMEM containing: 1X DMEM supplemented with 25 mM HEPES, 2 mM L-glutamine,1 mM sodium pyruvate, 1X non-essential amino acids (NEAA), 1X antibiotic/antimycotic solution (all from Corning) and 10% heat-inactivated FBS (Gibco), unless indicated otherwise.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were incubated with an anti-SARS-CoV-2 spike RBD polyclonal antibody (Gentaur) at 1:3000 overnight at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2</div><div>suggested: (Leinco Technologies Cat# LT3000, RRID:AB_2893948)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were washed to remove excess antibody, then incubated with a secondary HRP-conjugated anti-human IgG for 1 h at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sera were assayed at 1:500 dilutions (in assay buffer) and surveyed for anti-SARS-CoV-2 N or RBD antibodies by 1 h incubation on a plate shaker at 800 rpm in the dark.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 N</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Median fluorescent intensity (MFI) using combined or individual detection antibodies (i.e., anti-IgA, anti-IgG, or anti-IgM) was measured and the background value of assay buffer was subtracted from each serum sample result to obtain MFI minus background values (net MFI).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-IgA</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-IgM</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2.3.3 TCID50 assays: Vero E6 cells were seeded in 96-well plates with 2 × 104 cells/well in 5% MEM 24 h prior to infection and checked to verify ≥80% confluency. 10-fold dilutions of stock SCV2-WA1 virus in serum-free MEM (100 μL) were incubated on Vero E6 monolayers in quadruplicates for 2 h absorption at 37°C without rocking.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Supernatants were collected and diluted in Opti-MEM™ to final concentrations of 1:100 the extraction solvent or 1% Triton X-100, and >100 FFU/mL SARS-CoV-2 per well for analysis by FRNA. 2.7 Inactivation for scRNA-seq (10X Genomics): SARS-CoV-2-infected Vero E6 cells (MOI 0.04 for 72 h) or Calu-3 cells (MOI 0.04 for 48 h) were encapsulated for scRNA-seq following the manufacturer’s protocol “Chromium Next GEM Single Cell V(D)J Reagent Kits v1.1 User Guide with Feature Barcode technology for Cell Surface Protein” (document number CG000208; 10X Genomics) targeting 20,000 and 10,000 cells, respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: BCRJ Cat# 0264, RRID:CVCL_0609)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Compound Discoverer 3.2 (ThermoFisher) was used to quantify peak areas and assign annotations based on a local library of reference standards or via matching metabolites to reference spectra in mzCloud (mzcloud.org).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>mzCloud</div><div>suggested: (mzCloud, RRID:SCR_014669)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Splicing-aware aligner STAR (40) was used in FASTQ alignments.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>STAR</div><div>suggested: (STAR, RRID:SCR_004463)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Complimentary (c)DNA was synthesized using the High-Capacity cDNA Reverse Transcription Kit (Applied Biosystems™) per manufacturer’s instructions and diluted 1:5 in nuclease-free water, then 10 μL of diluted cDNA was used with the NEB Luna Universal Probe qPCR Mastermix (New England BioLabs®) following the manufacturer’s protocol and RT-qPCR performed in 384-well plates using a QuantStudio™ 5 Real-Time PCR System (Applied Biosystems™)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>New England BioLabs®</div><div>suggested: (New England Biolabs, RRID:SCR_013517)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.10.468057: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">Lysates were sonicated using a tip sonicator with 3, 5 second bursts, at 70% power with chilling on ice between bursts.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Contamination: A549-ACE cells were grown in RPMI1640 media with 10% FBS and 1% Pen/Strep and maintained free of mycoplasma.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">250uL of equalized lysate were then added to washed, antibody-conjugated protein A/G Dynabeads (2ug antibody conjugated to 15uL/15uL A/G dynabeads, resuspended in 50uL per IP) and IPs were rotated overnight at 4C in a final volume of 300uL.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antibody-conjugated protein</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Slides were incubated in mouse primary antibody solution of anti SARS-CoV-2 nucleocapsid and rabbit anti-H3K9me3 antibody solution overnight at 4°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti SARS-CoV-2 nucleocapsid</div><div>suggested: (BioLegend Cat# 946101, RRID:AB_2892515)</div></div><div style="margin-bottom:8px"><div>anti-H3K9me3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The cells were then gently resuspended in 1 mL FACS buffer with a 1:500 dilution of anti-streptactin antibody and rotated at 4°C for 1 hour, protected from light.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-streptactin</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data analysis and manual inspection was performed with Skyline10 (MacCoss Lab) and IPSA11. Antibodies: Data analysis and availability: Box and whisker plots show center line median, box limits for upper and lower quartiles, whiskers for 1.5x interquartile range, and points are outliers.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IPSA11</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A549ACE2 cells: ACE expressing A549 cells were generated as previously described1.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549</div><div>suggested: NCI-DTP Cat# A549, RRID:CVCL_0023)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A549-ACE cells were grown in RPMI1640 media with 10% FBS and 1% Pen/Strep and maintained free of mycoplasma.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549-ACE</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK cells: HEK293T cells were cultured in DMEM (with 4.5 g/L glucose, L-glutamine and sodium pyruvate), 10% fetal bovine serum (Sigma Aldrich F2442-500ML), and 1% Penicillin-Streptomycin (Gibco 15140122) and maintained free of mycoplasma.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 infections: SARS-CoV-2 (USA-WA1/2020 strain) was obtained from BEI and propagated in Vero-E6 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For RNA-sequencing analysis for HEK-293T cell experiments, GRCh38 assembly was used.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For PTM quantification, HEK cells and human lung tissue were imaged at a single z-plane and A549 cells were imaged with a z-stack through the nucleus.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For ATAC-sequencing analysis, alignments were performed with Bowtie2 (2.1.0)4 using the Hg38 genome using a ChIP-seq pipeline (https://github.com/shenlab-sinai/chip-seq_preprocess).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ChIP-seq</div><div>suggested: (ChIP-seq, RRID:SCR_001237)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For Orf8 ChIP-sequencing analysis, alignments were performed with Bowtie2 (2.1.0)4 using the Hg38 genome using a ChIP-seq pipeline (</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Bowtie2</div><div>suggested: (Bowtie 2, RRID:SCR_016368)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Orf8 reads were mapped using NGS plot.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NGS</div><div>suggested: (PM4NGS, RRID:SCR_019164)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Reads were trimmed using TRIMMOMATIC (Bolger et al., 2014) with the options “ILLUMINACLIP:[adapter.fa]:2:30:10 LEADING:5 TRAILING:5 SLIDINGWINDOW:4:15 MINLEN:15”, and aligned to a hybrid hg38+C. floridanus (v7.5, RefSeq) genome assembly using bowtie2 v2.2.64 with the option “--sensitive-local”.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>TRIMMOMATIC</div><div>suggested: (Trimmomatic, RRID:SCR_011848)</div></div><div style="margin-bottom:8px"><div>RefSeq</div><div>suggested: (RefSeq, RRID:SCR_003496)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Alignments with a mapping quality below 5 (using samtools) and duplicated reads were removed.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>samtools</div><div>suggested: (SAMTOOLS, RRID:SCR_002105)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">STAR was used to generate bam files for subsequent TDF file generation using IGVtools.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IGVtools</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For all RNA-sequencing, reads were aligned using STAR (v2.6.1a) with default parameters and only uniquely mapped reads were retained for downstream analysis.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>STAR</div><div>suggested: (STAR, RRID:SCR_004463)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Reads were counted towards human genes (GENCODE v35) and SARS-CoV-2 genes(WA-CDC-WA1/2020 MN985325.1 assembly) using featureCounts (v1.6.2).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GENCODE</div><div>suggested: (GENCODE, RRID:SCR_014966)</div></div><div style="margin-bottom:8px"><div>featureCounts</div><div>suggested: (featureCounts, RRID:SCR_012919)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data normalization and differential gene expression analysis was performed using DESeq2 R package (v1.26.0).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>DESeq2</div><div>suggested: (DESeq, RRID:SCR_000154)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">GO enrichment analysis for differentially expressed genes was implemented using clusterProfiler R package (v3.14.3), using human genome annotation record in org.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>clusterProfiler</div><div>suggested: (clusterProfiler, RRID:SCR_016884)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Image analysis: Images were analyzed using Image J software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Image J</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Protein alignment: To identify potential histone mimicry SARS-CoV-2 protein sequences were aligned to human histone protein sequences (H2A, H2B, H3.1,H3.2 H4, H2A.X, H2A.Z, macroH2A, and H3.3) using Multiple Sequence Comparison by Log-Expectation (MUSCLE) with default settings.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MUSCLE</div><div>suggested: (MUSCLE, RRID:SCR_011812)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A database search was performed using the human SwisProt sequence and Orf8 sequence with Proteome Discoverer 2.4 (Thermo Scientific) with the following search criteria: carboxyamidomethylation at cysteine residues as a fixed modification; oxidation at methionine, acetylation at lysine, mono-, di-, and tri-methylation at lysine residues as variable modifications; two maximum allowed missed cleavage; 10 ppm precursor MS tolerance; a 0.2 Da MS/MS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Proteome Discoverer</div><div>suggested: (Proteome Discoverer, RRID:SCR_014477)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Fiji was used for image analysis.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Fiji</div><div>suggested: (Fiji, RRID:SCR_002285)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on page 23. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.27.465224: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Placental tissue preparation and Immunohistochemistry: Ethics approval for the use of first trimester human placental tissues for research was obtained from the Human Ethics Committee at Monash Health (RES-19-0000-399A, Melbourne, Australia), all patients provided informed written consent.<br>Consent: Placental tissue preparation and Immunohistochemistry: Ethics approval for the use of first trimester human placental tissues for research was obtained from the Human Ethics Committee at Monash Health (RES-19-0000-399A, Melbourne, Australia), all patients provided informed written consent.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sections were then incubated with primary antibodies (ACE2, ab15438, Abcam,</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Human IgG1 antibodies were purified using Protein-A affinity chromatography.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Human IgG1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Assessment of human antibody binding specificity by ELISA: 96-well flat-bottomed MaxiSorp plates were coated with 50 μl of 125 nM recombinant human or mouse ACE2 protein in PBS at room temperature for one hour.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>mouse ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Goat anti-Human IgG secondary antibody (1:5000).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Human IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For affinity measurements against human ACE2, antibodies were loaded by submerging sensor tips for 200 s and then washed in kinetics buffer for 60 s.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>human ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Primary antibodies used in the study were: anti-HCG (ab9582, abcam, 1:200), anti-dsRNA (MABE1134, Merck, 1:200), anti-ACE2 (ab15348, abcam, 1:200), anti-GATA3 (MA1-028, Invitrogen, 1:100), and anti-HLA G (ab7759, abcam, 1:50).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-HCG</div><div>suggested: (Abcam Cat# ab9582, RRID:AB_296507)</div></div><div style="margin-bottom:8px"><div>anti-dsRNA ( MABE1134</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-GATA3 ( MA1-028</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-HLA G</div><div>suggested: (Abcam Cat# ab7759, RRID:AB_306053)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Secondary antibodies used in the study (all 1:400) were Alexa Fluor 488 goat anti-mouse IgG1 (A21121, Invitrogen, Thermo Fisher Scientific)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgG1</div><div>suggested: (Thermo Fisher Scientific Cat# A-21121, RRID:AB_2535764)</div></div><div style="margin-bottom:8px"><div>A21121</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Median TCID50 in supernatants were determined by 10-fold serial dilution in Vero cells and calculated using the Reed and Muench method.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: CLS Cat# 605372/p622_VERO, RRID:CVCL_0059)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Fabs from positive phage were reformatted into IgG1 expression plasmids and used for transient expression in Expi293 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Expi293</div><div>suggested: RRID:CVCL_D615)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Image Analysis/Cell Quantification: Cell quantification was performed using the particle analysis option of the ImageJ software (http://rsb.info.nih.gov/ij/).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Gene expression analyses: Pre-processing RNA-seq: Raw next generation RNA sequencing (RNA-seq) reads were obtained in FASTQ format, and prior to demultiplexing the forward read FASTQ was trimmed with trimmomatic to 18 nucleotides (nt) (the targeted read length as described above) with the following parameters: SE -phred33 CROP:18 MINLEN:18 (Bolger et al., 2014)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>trimmomatic</div><div>suggested: (Trimmomatic, RRID:SCR_011848)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sequencing reads were then mapped to a customised genome, composed of both GENCODE’s GRCh38.p13 and human SARS-CoV2 (RefSeq - NC_045512.2; see “Custom genome for mapping” below for further details), with STAR v2.5.2b (Dobin et al., 2013) and the parameters: --outSAMattributes All --alignIntronMax 1000000 --alignEndsType</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RefSeq</div><div>suggested: (RefSeq, RRID:SCR_003496)</div></div><div style="margin-bottom:8px"><div>STAR</div><div>suggested: (STAR, RRID:SCR_004463)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Prior to library size normalisation, normalisation factors were calculated with EdgeR’s (v3.32.1) calcNormFactors function (Robinson et al., 2010).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>EdgeR’s</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Hierarchical clustering was performed utilizing base R’s package stats (functions: dist and hclust), with the distance measure canberra and linkage method Ward.D.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>hclust</div><div>suggested: (HCLUST, RRID:SCR_009154)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Dendrogram visualization was performed with dendexted v1.15.1 (parameter: k = 3) (Galili, 2015); 3D visualizations were performed with plotly v4.9.4.1 (Sievert, 2020); heatmap visualizations were performed with ComplexHeatmap v2.6.2 (Gu et al., 2016); all other visualizations were performed with ggplot2 v3.3.5 (Villanueva and Chen, 2019) and where required ggrepel v0.9.1 (Slowikowski et al., 2018)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ComplexHeatmap</div><div>suggested: (ComplexHeatmap, RRID:SCR_017270)</div></div><div style="margin-bottom:8px"><div>ggplot2</div><div>suggested: (ggplot2, RRID:SCR_014601)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Gene ontology and pathway analyses were performed with Metascape (http://metascape.org) (Zhou et al., 2019).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Metascape</div><div>suggested: (Metascape, RRID:SCR_016620)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Although, as demonstrated by our results, this infection model can be of great utility, there are limitations. For example, the decidua contains 10-20% of macrophages but we cannot model their effects in this system (Kreis et al., 2020, Manaster and Mandelboim, 2010). In the future, complex models that include immune cells could be used to enhance current models, as has been done with brain slice cultures and microglia from iPSC derived models (Grubman et al., 2021). Recent studies have reported that host cell factors such as ACE2, TMPRSS2 or cathepsins are vital for SARS-CoV-2 entry and could be utilized as potential therapeutic targets against infection (Dong et al., 2020, Hoffmann et al., 2020). We also reported that blocking viral infection through ACE2 blockade restores the functional phenotype in STs, similar to the rescue of function in lung and cardiac cells through the inhibition of ACE2 or TMPRSS2 activity (Huang et al., 2020, Hoffmann et al., 2021, Pei et al., 2020, Bojkova et al., 2020, Perez-Bermejo et al., 2021). More importantly, this in vitro derived placental model allowed us to generate a quick and effective system. We envision that our model will facilitate a deeper understanding of COVID-19 pathogenesis and will provide a platform for drug discovery and potential treatments.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on pages 35, 19, 36 and 7. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.08.467773: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: Mouse studies: Mouse studies were conducted at Murigenics (Vallejo, CA) under IACUC approved protocols.<br>IACUC: Mouse studies: Mouse studies were conducted at Murigenics (Vallejo, CA) under IACUC approved protocols.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Female Balb/c mice (Envigo), 6–8 weeks old were used for all studies.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Membranes were blocked for 1h in 5% skim milk in TBST and then probed with an anti-S2 mouse monoclonal antibody (GeneTex) at a 1:1000 dilution for 2h-overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-S2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Membranes were washed (0.05% Tween 20 in 1X TBS) and then probed with a Rabbit anti-Mouse HRP antibody (Bethyl labs) for 1h before washing and detection with a SuperSignal West Femto Maximum Sensitivity Substrate (Pierce).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Mouse HRP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A parallel blot using a mouse anti-actin antibody (Thermo Fisher) was used to ensure equivalent protein amounts per well.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-actin</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Extracellular staining was performed in FACS buffer (PBS + 2% FBS + 2mM EDTA) with the following antibodies: CD4 (GK1.5, Biolegend), CD8 (53-6.7, BD).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD4</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD8</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Intracellular staining was then performed in permeabilization buffer with the following antibodies: IFNγ (XMG21.2, Invitrogen), TNFα (MP6-XT22, eBiosciences), IL2 (JES6-5H4, eBiosciences), IL4 (11B11, Biolegend), IL10 (JES5-16E3, Biolegend).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IL2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IL4</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IL10</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>JES5-16E3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The intensity of the light being emitted is inversely proportional to the amount of anti-SARS-CoV-2 neutralizing Spike antibodies bound to the VSVΔG – Spike ΔCT particles.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 neutralizing Spike</div><div>suggested: (Creative Diagnostics Cat# CABT-CS064, RRID:AB_2891088)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were incubated with anti-nucleocapsid protein primary antibody cocktail (clones HM1056 and HM1057) (EastCoast Bio, North Berwick, ME) for 60 minutes at 37°C (Battelle Memorial Institute, Patent Number 63/041,551 Pending, 2020).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-nucleocapsid protein</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plates were washed and the secondary antibody (goat anti-mouse IgG Horse Radish Peroxidase (HRP) conjugate; Fitzgerald, North Acton, MA) was added to the wells, and the plates were incubated for 60 minutes at 37°C1.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Wells were washed and incubated with 25 μL of 1 μg/mL SULFO-TAG labeled anti-species antibody (MSD), diluted in DPBS + 1% BSA (Sigma-Aldrich, St. Louis, MO), for 1 hour at room temperature on an orbital shaker.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MSD</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Western analysis: HEK293F cells seeded at 5e5 cells/mL were infected with an MOI of 1 IU/cell.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293F</div><div>suggested: RRID:CVCL_6642)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The VSVΔG virus was transduced in HEK293T cells previously transfected with the spike glycoprotein of the SARS-CoV-2 coronavirus (Wuhan strain) for which the last 19 amino acids of the cytoplasmic tail were removed (ΔCT).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After the incubation of the serum/plasma-pseudotyped virus complex, the serum/plasma-pseudotyped virus complex was transferred to the plate containing Vero E6 cells (ATCC).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Female Balb/c mice (Envigo), 6–8 weeks old were used for all studies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Balb/c</div><div>suggested: RRID:IMSR_ORNL:BALB/cRl)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The sequence of a E1 (578-3404 bp)/E3 deleted virus (2,125-31,825 bp) was assembled into pUC19 from VR-594-derived and synthetic (SGI-DNA) fragments.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pUC19</div><div>suggested: RRID:Addgene_50005)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The pA68-E4d-Spike plasmids were linearized, purified using a Nucleospin kit (Machery-Nagel) and transfected into 2 mL of 293F cells (0.5 mL/mL) using TransIT-Lenti (Mirus bio).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pA68-E4d-Spike</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Spike sequences were PCR amplified and cloned into PacI/BstBI sites of a pUC02-VEE vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pUC02-VEE</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vector generation: The ChAd68 nucleotide sequence was based on the wild-type sequence obtained by MiSeq (Ilumina sequencing) of virus obtained from the ATCC (VR-594).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MiSeq</div><div>suggested: (A5-miseq, RRID:SCR_012148)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Analysis of flow cytometry data was performed using FlowJo software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data processing was performed using the R programming language and graphed using GraphPad Prism.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT03639714</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Active, not recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">A Study of a Personalized Neoantigen Cancer Vaccine</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT03953235</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">A Study of a Personalized Cancer Vaccine Targeting Shared Ne…</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04776317</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Chimpanzee Adenovirus and Self-Amplifying mRNA Prime-Boost P…</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.16.21266115: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Mary’s Hospital Research Ethics Committee (09/H0712/59).<br>Consent: All participants gave written, informed consent.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mouse IgG2a monoclonal anti-human ICAM-1 antibody (antibody R6.5) was produced from the hybridoma cells (ATCC HB-9580, mouse hybridoma).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Mouse IgG2a monoclonal anti-human ICAM-1 antibody</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human ICAM-1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To block ICAM-1, a receptor responsible for RV-A16 infection of HBECs, anti-ICAM-1 antibodies were added to the apical and basolateral compartment, 3h prior RV-A16 infection at the dose of 10ug/mL (Fig. S1A).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ICAM-1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Protein samples precipitated from the apical supernatants were analyzed with the use of goat anti-IL-1β antibodies (1:1000, R&D Systems, Minneapolis, USA), rabbit anti-caspase-1 (1:1000, Cell Signaling Technology, Danvers, USA), and HRP conjugated anti-goat (1:10,000, Santa Cruz Biotechnology, Santa Cruz, USA), and anti-rabbit (1:10,000, Jackson ImmunoResearch, West Grove, USA) antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-IL-1β</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-caspase-1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, magnetized, and incubated with 10 μg of anti-ASC antibodies (Santa Cruz Biotechnology, Santa Cruz, USA) overnight at 4°C, followed by ASC immunoprecipitation with 100 μl of Protein A beads (Bio-Rad, Hercules, USA) for 2h in RT.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-ASC</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Co-IP samples and input (protein not bound to the beads) were collected and together with the cell lysates were further analyzed with the Western Blot protocol with the use of mouse anti-human RIG-I antibodies (1:200, Santa Cruz Biotechnology, Santa Cruz, USA) or rabbit anti-human MDA5 antibodies (1:1000, Abcam, Cambridge, UK) and HRP conjugated anti-mouse or anti-rabbit antibodies (1:10,000, Jackson ImmunoResearch, West Grove, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human RIG-I</div><div>suggested: (LSBio (LifeSpan Cat# LS-C19644-1000, RRID:AB_839891)</div></div><div style="margin-bottom:8px"><div>anti-human MDA5</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Subsequently, samples were incubated with the goat anti-mouse Alexa Fluor 488 (for ASC), and the goat anti-mouse Alexa Fluor 546 (for IL-1β and RIG-I) secondary antibodies at the concentrations of 1:2000 (Invitrogen, Waltham, USA) for 60 minutes at RT.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>RIG-I</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Primary antibodies for NLRP3 (5 µg/mL, mouse anti-NLRP3, Adipogen, San Diego, USA)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NLRP3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Primary antibodies for IL-1β (10 μg/mL, mouse anti-IL1β, Abcam, Cambridge, UK),</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-IL1β</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Subsequently, samples were incubated with the goat anti-rabbit Alexa Fluor 488 (for caspase-1), and the goat anti-mouse Alexa Fluor 546 (for IL-1β and RIG-I) secondary antibodies for 60 minutes in RT in the concentration of 1:1000 (Invitrogen, Waltham, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, HeLa cells were infected with the virus serial dilutions from 10-2 to 10-8 in duplicates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HeLa</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Co-culture of electroporated BHK-21 cells with susceptible Vero E6 cells produced passage 0 of SARS-CoV-2 virus.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK-21</div><div>suggested: ATCC Cat# CRL-6281, RRID:CVCL_1914)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Passage 0 was used to infect Vero E6 cells to generate passage 1 working stocks, which were used for all experiments.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">THP-1 cell culture: THP-1-XBlue cells (Invivogen, San Diego, USA) were defrosted in 32 mL of RPMI-1640 medium (Sigma-Aldrich, St. Louis, USA) supplemented with the Penicillin/Streptomycin/Kanamycin, MEM vitamins, Na-Pyruvate/MEM Non-essential Amino Acid Solution and heat-inactivated FCS (cRPMI medium) in the 75cm2 T-flask, and cultured for 1 day in the humidified incubator at 37°C with 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>THP-1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>THP-1-XBlue</div><div>suggested: RRID:CVCL_X582)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Gene expression (5ng of cDNA/well) was assessed by RT-PCR using i) SYBR Green PCR Master Mix (ThermoFisher Scientific, Waltham, USA) for DDX58, IFNB, IFNL1, IL1B, MDA5, and ii) TaqMan assays for RV-A16 and SARS- CoV-2 Protein N, Protein S, ORF1AB detection (ThermoFisher Scientific, Waltham, USA) and was performed on the QuantStudio 7 Flex Real-Time PCR System (ThermoFisher Scientific, Waltham, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MDA5</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Quantification of the protein expression was performed in Fiji Software. 128 Briefly, an area of the peak of the protein of interest was measured in triplicates, and average was used to calculate the ratio between expression of the protein of interest and β-actin (protein/β-actin).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Fiji</div><div>suggested: (Fiji, RRID:SCR_002285)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The mRNA expression data are publicly available at the Gene Expression Omnibus platform (https://www.ncbi.nlm.nih.gov/) under the accession number: GSE6114166.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gene Expression Omnibus</div><div>suggested: (Gene Expression Omnibus (GEO, RRID:SCR_005012)</div></div><div style="margin-bottom:8px"><div>https://www.ncbi.nlm.nih.gov/</div><div>suggested: (GENSAT at NCBI - Gene Expression Nervous System Atlas, RRID:SCR_003923)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">05 calculated for the entire gene lists in each project using the edgeR R package130.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>edgeR</div><div>suggested: (edgeR, RRID:SCR_012802)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Differentially expressed probe was identified by the limma R package with empirical Bayes estimation.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>limma</div><div>suggested: (LIMMA, RRID:SCR_010943)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Additionally, top 100 genes upregulated after RV-A16 infection in the HBECs from control individuals and patients with asthma from GSE6114166 were analyzed for the enriched pathways using Metacore software version 20.3.70200</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Metacore</div><div>suggested: (MetaCore, RRID:SCR_008125)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The statistical comparison of protein expression between groups was performed with the Bioconductor limma package131.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Bioconductor</div><div>suggested: (Bioconductor, RRID:SCR_006442)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Additionally, for Target 96 Inflammation panel data are presented as: i) heatmaps of curated signatures of inflammasome-mediated immune responses and antiviral responses (Supplementary Table S10) and ii) protein interactions and pathways analysis prepared using the STRING (version 11.0)132, and further processed with the Cytoscape software (version 3.8.2)133 (Supplementary Table S3).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>STRING</div><div>suggested: (STRING, RRID:SCR_005223)</div></div><div style="margin-bottom:8px"><div>Cytoscape</div><div>suggested: (Cytoscape, RRID:SCR_003032)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code and data.


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      An appropriate balance between activation of RIG-I epithelial inflammasome and subsequent IL-1β/IL-1 receptor (IL1R) signaling with RIG-I-dependent type I/III IFN responses should lead to the limitation of viral replication, efficient virus clearance and timely resolution of airway inflammation52. Indeed, we observed here that in the bronchial epithelium of healthy subjects at early time points during RV infection there was an activation of RIG-I inflammasome and inflammasome-mediated immune responses, together with efficient type I/III IFN and ISG-responses. Importantly all of these responses were actively inhibited or went back to the pre-infection state, already 4 days after in vivo infection. In contrast, in epithelium of patients with asthma, there was enhanced RIG-I inflammasome activation accompanied by augmented inflammasome/IL1R- mediated proinflammatory responses starting early after infection and still non-resolved in vivo 4 days after infection. Overactivation of epithelial RIG-I inflammasome and subsequent increases in mature IL-1β release might be at least partially responsible for the delayed and sustained type I/III IFN/ISG responses. We demonstrated this here by blocking caspase-1 with YVAD which led to an increase in IFN-β (IFNB) and RIG-I (DDX58) mRNA together with IFN-responsive chemokines such as CXCL10, CXCL11, CCL3, and CCL4. Our findings are in line with early observations showing that IL-1β is able to attenuate transcription and translation of type I ...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.05.467523: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: Vaccine-elicited sera were collected at the U.S. Food and Drug Administration with written consent under an approved Institutional Review Board (IRB) protocol (FDA IRB Study # 2021-CBER-045).<br>IRB: Vaccine-elicited sera were collected at the U.S. Food and Drug Administration with written consent under an approved Institutional Review Board (IRB) protocol (FDA IRB Study # 2021-CBER-045).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Donors were 18-73 years old with six males/four females.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Due to a confidentiality agreement with the manufacturers, neutralizing antibodies described are shown with blinded identification codes as follows: single neutralizing antibodies (nAbs A to R), combination of two neutralizing antibodies (cnAbs S to X), and polyclonal neutralizing antibodies (pnAbs III to IV).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Twenty-three therapeutic neutralizing antibodies against SARS-COV-2 spike protein were generously donated by different pharmaceutical companies for the U.S.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-COV-2 spike protein</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2.4. soluble ACE2 production: The production of His-tagged soluble ACE2 was performed in FreeStyle™ 293-F cells and purified using HisPur™ Ni-NTA Resin (Thermo Scientific) as described previously [31]. 2.5.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293-F</div><div>suggested: RRID:CVCL_6642)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For ACE2 neutralization assay, serially diluted recombinant human soluble ACE2 was incubated with indicated pseudovirus (~1×106 RLU / ml) for one hour at 37°C and 100 μl of pseudovirus and soluble ACE2 mixture was added to 293T-ACE2.TMPRSS2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T-ACE2.TMPRSS2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Spike-transfected/β-Gal ω subunit-expressing 293T cells were mixed with β-Gal α subunit-transfected/293T-ACE2.TMPRSS2 cells at 1:1 ratio to a total of 6 x 104 cells per well on a 96-well plate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plasmids and cell lines: Codon-optimized full-length open reading frames of the S genes of SARS-COV-2 variants were cloned into pcDNA3.1(+) or pVRC8400 by GenScript (Piscataway, NJ).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pVRC8400</div><div>suggested: RRID:Addgene_63164)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The HIV gag/pol (pCMVΔR8.2), and Luciferase reporter (pHR’CMV-Luc) plasmids were obtained from the Vaccine Research Center (National Institutes of Health, Bethesda, MD) [28,29].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHR’CMV-Luc</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, pseudoviruses bearing the spike glycoprotein and packaging a firefly luciferase (FLuc) reporter gene were produced in 293T cells by co-transfection of 5μg of pCMVΔR8.2, 5μg of pHR’CMVLuc and 4μg of pcDNA3.1(+) or 0.5 ug of pVRC8400-encoding a codon-optimized spike gene with the desired substitutions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMVΔR8.2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Furin prediction score calculations: The prediction of furin-specific cleavage site in spike proteins were computed using the ProP 1.0 Server hosted at http://www.cbs.dtu.dk/services/ProP/ and the PiTou V3 software hosted at http://www.nuo-lan.net/reference.html. 2.10.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>http://www.cbs.dtu.dk/services/ProP/</div><div>suggested: (ProP Server, RRID:SCR_014936)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistics analysis: One-way analysis of variance (ANOVA) with Dunnett’s multiple comparisons tests (variants compared to WT(D614G)), Mann-Whitney test for the comparison of two groups with unmatched pairs (Pfizer BNT162b2 compared to Moderna) and geometric mean titers (GMT) with 95% confidence intervals were performed using GraphPad Prism software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.13.468472: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: Animals that lost more than 25% of their initial body weight were euthanized in accordance with our animal ethics protocol.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Two groups of ferrets (5 female and 5 male ferrets in the vaccine group and 3 female and 3 male ferrets in the control group) were immunized intranasally with a single-dose 1×106 PFU of dNS1-RBD and CA04-WT virus respectively diluted in 1640 media to a final 500 μL volume.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Proteins were separated on a 10% gel, and then following transfer, blots were incubated with an anti-influenza A NP protein antibody 19C10 generated by our laboratory (1:1000)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-influenza A NP protein</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">and anti-V5 tag antibody (Thermo,1:5000) and visualized with horseradish peroxidase (HRP)-conjugated anti-mouse IgG (Invitrogen, 1:5000)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-V5</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-mouse IgG</div><div>suggested: (LSBio (LifeSpan Cat# LS-C69682-5000, RRID:AB_1653096)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Based on the ELISA results using a sandwich assay with anti-RBD monoclonal antibodies on both sides (Wantai, Beijing, China) and plaque assay results, serial passages 1 to 10 of purified vaccines were confirmed to be stable under current vaccine manufacturing conditions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-RBD</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-RBD IgG measurements: RBD-specific antibody titers in serum samples collected from immunized animals with 1×106 PFU of vaccine were determined by indirect ELISA.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-RBD IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Diluted sera (1:100) were successively diluted in a 2-fold series and applied to each well for 1 h at 37°C, followed by incubation with goat anti-mouse, anti-hamster or anti-human antibodies conjugated with HRP for 1 h at 37°C after 3 washes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse ,</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The cells were stained with murine antibodies for phenotype and activation (CD4 [clone GK1.5, APC/Cy7], CD8 [clone 53-6.7, PerCP/Cy5.5], CD11b [clone M1/70, PE], CD11c [clone N418, BV421],</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD4</div><div>suggested: (Miltenyi Biotec Cat# 130-109-536, RRID:AB_2657974)</div></div><div style="margin-bottom:8px"><div>CD8</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD11b</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD11c</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>BV421</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Immunohistochemical staining was performed by using a mouse monoclonal anti-SARS-CoV-2 N protein antibody.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 N protein</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Human embryonic kidney cells (293T), African green monkey kidney epithelial cells (Vero E6), and Madin-Darby canine kidney cells (MDCK) were maintained in DMEM-high glucose (Sigma Aldrich, USA) supplemented with 10% low endotoxin FBS (Cegrogen Biotech, Germany) and penicillin-streptomycin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MDCK</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Generation and passage of dNS1-RBD viruses: Eight pHW2000 plasmids containing the DelNS1 segment and the other seven influenza virus genomic segments, together with an NS1 expression plasmid, pCX-CA04-NS1-Flag, which derived from the parental influenza virus A/California/04/2009(H1N1) (GenBank: MN371610.1-371617.1), were transfected into 293T cells and incubated overnight at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 titration assay: Live virus titers in homogenized lung tissues and cell cultures were measured by the standard TCID50 method in Vero E6 cells seeded in 96-well plates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Immunization and infection of mice: BALB/c mice were immunized intranasally with 50 μL containing 1×106 PFU of the vaccine prepared as indicated above under isoflurane anesthesia, while the control group was administered CA04-WT or CA04-dNS1 virus.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/c</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For cellular immune response analyses of PBMCs, splenic lymphocytes, pulmonary lymphocytes and lymph node cells, C57BL/6 mice (6-8 weeks old) were immunized intranasally with 1×106 PFU of the vaccine by the one-dose or two-dose regimen as described above (10 animals in each group).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57BL/6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Immunization and infection of hACE2-KI/NIFDC mice: hACE2-KI/NIFDC mice (8-10 weeks old) were divided into three groups and treated intranasally with 1×106 PFU of the vaccine by gently adding 50 μL droplets of virus stock for the vaccine-immunized group (5 animals) at two time points (days 0 and 14), and then, the vaccine-immunized group and unvaccinated group (3 animals each) were challenged with 1×104 PFU of SARS-CoV-2 by the intranasal route 30 days post immunization.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>hACE2-KI/NIFDC</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The sequence encoding the RBD segment was then cloned into the NS1 deletion plasmid pHW2000-DelNS1 as described previously.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHW2000-DelNS1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Generation and passage of dNS1-RBD viruses: Eight pHW2000 plasmids containing the DelNS1 segment and the other seven influenza virus genomic segments, together with an NS1 expression plasmid, pCX-CA04-NS1-Flag, which derived from the parental influenza virus A/California/04/2009(H1N1) (GenBank: MN371610.1-371617.1), were transfected into 293T cells and incubated overnight at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHW2000</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pCX-CA04-NS1-Flag</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The data were analyzed by FlowJo V10.6.0 and GraphPad Prism 9.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Statistical significance was assigned when P values were < 0.05 using GraphPad Prism 8.0 (GraphPad Software, Inc.)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.02.466971: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data sources and curation: Previously published studies were used to verify the abundance of proteins that make up the N-end rule pathway in non-infected and SARS-CoV-2 infected groups: (i) Saccon et al42 (Calu-3, Caco-2, Huh7, and 293FT cell lines, proteomics); (ii) Nie et al43 (autopsy 7 organs, 19 patients, proteomics); (iii) Leng et al44 (lung tissue, 2 patients, proteomics); (iv) Qiu et al45 (lung tissue, 3 patients, proteomics); (v) Bojkova et</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Huh7</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>293FT</div><div>suggested: ATCC Cat# PTA-5077, RRID:CVCL_6911)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To verify modulation of the N-end rule pathway in other viral infections, including MERS-CoV/SARS-CoV/H1N1 influenza virus/Respiratory syncytial virus (RSV), data from the following studies were evaluated: (viii) Zhuravlev et al49 (MRC-5, A549, HEK293FT, and WI-38 VA-13 cell lines, H1N1 influenza virus, transcriptomics), (ix) Li et al50 (A549 and 293T cell lines, H1N1 influenza virus, transcriptomics), (x) Krishnamoorthy et al51 (comparative among coronaviruses, transcriptomics), (xi) Ampuero et al52 (time course of RSV infection in the lung, transcriptomics), (xii) Besteman et al53 (RSV infected neutrophils, transcriptomics), and (xiii) Dave et al54 (RSV infected alveolar cell, proteomics).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MRC-5</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>HEK293FT</div><div>suggested: RRID:CVCL_6911)</div></div><div style="margin-bottom:8px"><div>VA-13</div><div>suggested: RRID:CVCL_A5CQ)</div></div><div style="margin-bottom:8px"><div>A549</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Kidney epithelial cell, African green monkey), Calu-3 (lung adenocarcinoma), Caco-2 (colorectal adenocarcinoma), and ACE2-A549 (lung carcinoma expressing ACE2 to gain cellular entry).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>ACE2-A549</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell culture: Vero CCL-81 cells were cultured in DMEM medium supplemented with 10% fetal bovine serum (FBS), 100 U/ml penicillin-streptomycin, 4.5 g/L glucose, 2 mM L-glutamine, 1 mM sodium pyruvate, and 1.5 g/L NaHCO3</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero CCL-81</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Calu-3 cells were cultured in DMEM medium supplemented with 20% FBS, 1% non-essential amino acids, 4.5 g/L glucose, 2 mM L - glutamine, 1 mM sodium pyruvate, 100 U/ml penicillin-streptomycin and 1.5 g/L NaHCO3.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">THP-1 cells were cultured in RPMI-1640 supplemented with 10% FBS, and 1% penicillin-streptomycin at 37 °C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>THP-1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For comprehensive time course evaluation, Vero CCL-81 and Calu-3 cells were infected with SARS-CoV-2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Bioinformatics analysis: The tidyverse59, biostrings, and seqinr60 packages were used to map potentially arginylated proteins in the Homo sapiens and Chlorocebus sabaeus proteomes (downloaded in May 2021, https://www.uniprot.org/).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>https://www.uniprot.org/</div><div>suggested: (Universal Protein Resource, RRID:SCR_002380)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The String database v.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>String</div><div>suggested: (STRING, RRID:SCR_005223)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Single-cell RNA-seq re-analysis: Expression matrices were loaded into RStudio (v. 4.0.3) with the Seurat package66.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Seurat</div><div>suggested: (SEURAT, RRID:SCR_007322)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The Metaboanalyst platform67 was used to evaluate differently regulated genes between cell clusters identified in the single-cell RNA-seq analysis. 4.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Metaboanalyst</div><div>suggested: (MetaboAnalyst, RRID:SCR_015539)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">(GraphPad Software, San Diego, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Immunoreactive bands were detected with the ChemiDoc XRS Imaging System equipment and protein quantification was performed using the ImageJ software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Graphs were plotted using GraphPad Prism version 8.1 software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.10.468173: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: 2.1 Ethics statement: The use of human cells in this study was approved by the Research Ethical Committee of Haute-Garonne<br>Consent: Written informed consent was obtained from the donors under EFS contract N° 21/PVNT/TOU/INSERM01/2011-0059, according to French Decree N° 2007–1220 (articles L1243-4, R1243-61).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2.6 Chemical products, Proteins, and Antibodies: PAM2CSK4, PAM3CSK4, LPS-RS were purchased from InvivoGen</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Antibodies</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>LPS-RS</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-TLR2 and anti-TLR4 monoclonal antibodies were obtained from eBioscience.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-TLR2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-TLR4</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 5 further washes, the complexes TLR2-E-GST-anti-GST were labeled by 1 hour incubation at room temperature with 100 μl of anti-rabbit IgG antibodies coupled to horseradish peroxidase in PBS-tween 0.05% containing 5% non-fat milk (DAKOTA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-rabbit IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2.2 Cells: Human embryonic kidney cell lines stably transfected with TLR2 (HEK-TLR2), TLR4 (HEK-TLR4) and HEK-TLR2-blue and control HEK cell line (HEK-null) were purchased from InvivoGen and cultured in DMEM supplemented with 10 % FCS, 1% of P/S and selections antibiotics according to the manufacturer’s instructions (InvivoGen).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero E6 and A549 cell lines were cultured in DMEM supplemented with 10% FCS and 1% of P/S. 2.3 Virus infection:</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>A549</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2.11 Cell based biological assays: Primary human monocytes or macrophages cells (106 cells) or HEK-null, HEK-TLR2 or HEK-TLR4 cell lines (2,5. 105 cells) were plated in 24 well plates and treated by E protein or PAM3CSK4 and PAM2CSK2 as positive controls at the indicated concentrations.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-TLR4</div><div>suggested: RRID:CVCL_VI44)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To inhibit the binding of E protein to cell membrane TLR2, E protein (at 200ng/ml) was preincubated with rTLR2 (20 ng/ml) during 1 hour at RT, before being added to HEK-TLR2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-TLR2</div><div>suggested: RRID:CVCL_IM79)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were acquired using FACSCalibur (BD).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FACSCalibur</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2.15 Statistical analyses: Statistical analysis was performed using GraphPad Prism software v.5.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on page 26. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • No conflict of interest statement was detected. If there are no conflicts, we encourage authors to explicit state so.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.08.467648: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: The protocols were approved by the Institutional Animal Care and Use Committees at the University of Colorado School of Medicine (Assurance Number A3269-01) and the University of Maryland School of Medicine (Assurance number D16-00125 (A3200-01)).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Female BALB/c mice were purchased from The Jackson Laboratory. 6-8-week-old mice were immunized with WT PLPs (control), RBDSARS-PLPs, RBDMERS-PLPs, or hCoV-RBD PLPs preparations in 50 μl PBS via i.m. injection in the hind leg.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Slides were examined in a blinded fashion for total inflammation, periarteriolar, and peribronchiolar inflammation and epithelial cell denuding.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">ELISA: SARS-CoV-2 and MERS-CoV RBD-specific antibody responses in mouse and human sera were measured by ELISA.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ELISA</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Samples were removed, and wells were washed three times with PBS-T and probed with secondary antibodies diluted at 1:4000 in PBS-T; goat anti-mouse IgG-HRP (Southern Biotech, 1030-05)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgG-HRP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Following blocking and washing, wells were incubated for 1.5 h at room temperature with either chimeric human anti-SARS-CoV spike antibody clone CR3022 (Absolute Antibody, Ab01680) or mouse anti-MERS-CoV spike antibody clone D12 (Absolute Antibody, Ab00696) prepared in a 2-fold dilution series in PBS-T with a starting dilution of 1:200 and signal was developed as described above.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-MERS-CoV</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were fixed with 1% paraformaldehyde (PFA; Acros Organics, 416780030) and probed with 1 μg/mL of chimeric human anti-SARS-CoV spike antibody (CR3022, Absolute Antibody, Ab01680) in Perm Wash (1X PBS/0.1% saponin/0.1% BSA) for 2 h at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CR3022</div><div>suggested: (Imported from the IEDB Cat# CR3022, RRID:AB_2848080)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plaque assay: Vero E6 cells were seeded in 12-well plates one day prior to virus inoculation.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For virulent virus challenge, mice were anaesthetized by intraperitoneal injection with 50 μL of a mix of xylazine (0.38 mg/mouse) and ketamine hydrochloride (1.3 mg/mouse) diluted in PBS. Immunized BALB/c mice were inoculated intranasally (i.n.) with 104 PFU of SARS-CoV-2 MA10.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/c</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Purification of recombinant hCoV RBD proteins: A pCAGGS expression vector encoding the SARS-CoV-2 spike RBD was obtained from Dr. Florian Krammer</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAGGS</div><div>suggested: RRID:Addgene_18926)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A pTwist-CMV expression vector (Twist Biosciences Technology) encoding the MERS-CoV spike RBD was kindly provided by Dr. Peter S. Kim, Stanford University (83).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pTwist-CMV</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To quantify SARS-CoV-2 subgenomic RNA, we extrapolated viral RNA levels from a standard curve using defined concentrations of a plasmid containing an amplified SARS-CoV-2 subgenomic fragment (pCR-sgN TOPO).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCR-sgN</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">This amplicon was cloned into the pCR4 Blunt TOPO vector (Invitrogen, K2875J10), sequence confirmed, and used in a dilution series of defined gene copies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCR4 Blunt TOPO</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Images were processed in Fiji (85) and measurements were based on 100 particles with values reported as mean ± standard deviation.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Fiji</div><div>suggested: (Fiji, RRID:SCR_002285)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The FRNT50 titers were calculated relative to a virus only control (no serum) set at 100%, using GraphPad Prism 9.1.2 (La Jolla, CA) default nonlinear curve fit constrained between 0 and 100%.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical Analysis: Statistical significance was assigned when P values were < 0.05 using Prism Version 9.1.2 (GraphPad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.04.467077: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Housing conditions and experimental procedures were approved by the ethics committee of animal experimentation of KU Leuven (license P065-2020).<br>Euthanasia Agents: On day 4 pi, animals were euthanized for sampling of the lungs and further analysis by i.p. injection of 500 μL Dolethal (200 mg/mL sodium pentobarbital, Vétoquinol SA).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Female Syrian hamsters (Mesocricetus auratus) were purchased from Janvier Laboratories and kept per two in individually ventilated isolator cages (IsoCage N Bio-containment System, Tecniplast) at 21°C, 55% humidity and 12:12 day/night cycles.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">All caretakers and technicians were blinded to group allocation in the animal facility.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">Group size was calculated on the independent t-test with an effect size of 2.0 and a power of 80% (effect size = deltamean/SD = 1 log10 decrease in viral RNA/0.5 log10), resulting in 5-6 animals/group.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Virus stocks were then grown on Vero E6 cells in (DMEM 2% FBS medium) and passaged two times.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Diluted compounds were then mixed with Vero E6-eGFP cells corresponding to a final density of 25,000 cells/well in 96-well blackview plates (Greiner Bio-One, Vilvoorde, Belgium; Catalog 655090).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6-eGFP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A549-Dual™ hACE2-TMPRSS2 cells obtained by Invitrogen (Cat. a549d-cov2r) were cultured in DMEM 10% FCS (Hyclone) supplemented with 10 μg/ml blasticidin (Invivigen, ant-bl-05), 100</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549-Dual™ hACE2-TMPRSS2</div><div>suggested: RRID:CVCL_A7ZQ)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The simulation results were overlaid with the in vitro EC50 reported in Vero E6 cells and A549-ACE2TMPRSS2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549-ACE2TMPRSS2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Microsomal metabolic stability: Mouse liver microsomes (CD-1 male strain) were purchased from GIBCO.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD-1</div><div>suggested: RRID:MGI:2686808)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The four variants were originally isolated in-house from nasopharyngeal swabs taken from travellers returning to Belgium (baseline surveillance) and were subjected to sequencing on a MinION platform (Oxford Nanopore) directly from the nasopharyngeal swabs 16.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MinION</div><div>suggested: (MinION, RRID:SCR_017985)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All statistical analyses were performed using GraphPad Prism 9 software (GraphPad, San Diego, CA, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The data from the two studies were modelled simultaneously using nonlinear mixed-effects approach in NONMEM, v7.4</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NONMEM</div><div>suggested: (NONMEM, RRID:SCR_016986)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT05047601</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">A Post-Exposure Prophylaxis Study of PF-07321332/Ritonavir i…</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04575597</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Active, not recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Efficacy and Safety of Molnupiravir (MK-4482) in Non-Hospita…</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.02.467026: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Mouse immunizations: Female BALB/c mice aged 6–8 weeks (Central Lab Animal) were intramuscularly immunized with 0.4 μg/ animal VP vaccine at week 0 and boosted with 12 μg/animal GX-19N, in a total volume of 50 μL PBS, into the tibialis anterior muscle with in vivo electroporation with the OrbiJector® system (SL VAXiGEN Inc.) at week 4.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Surrogate virus-neutralization assay: Surrogate virus neutralization test (sVNT) analyzed the binding ability of RBD to ACE2 after neutralizing RBD with antibodies in serum.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The reciprocal of the dilution resulting in a binding inhibition rate of 20% or more (PI20) was defined as the neutralizing antibody titer.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PI20</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">ELISPOT plates were coated with purified anti-mouse IFN-γ capture antibody and incubated overnight at 4 °C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IFN-γ</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The inactivated SARS-CoV-2 vaccine produced from Vero cells contains 4 μg of viral antigens and 0.225 mg of aluminum hydroxide adjuvant in a 0.5-mL dose.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: RRID:CVCL_A5BG)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mouse immunizations: Female BALB/c mice aged 6–8 weeks (Central Lab Animal) were intramuscularly immunized with 0.4 μg/ animal VP vaccine at week 0 and boosted with 12 μg/animal GX-19N, in a total volume of 50 μL PBS, into the tibialis anterior muscle with in vivo electroporation with the OrbiJector® system (SL VAXiGEN Inc.) at week 4.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/c</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vaccines: The COVID-19 DNA vaccine, consisting of GX-19 and GX-21 at a 1:2 ratio, was constructed by inserting the antigen genes of SARS-CoV-2 into the pGX27 vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pGX27</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">GX-19 (pGX27-SΔTM/IC) contains the SARS-CoV-2 spike (S) gene lacking the transmembrane (TM)/intracellular (IC) domain, and GX-21 (pGX27-SRBD-F/NP) is designed to express the fusion protein of the receptor binding domain (RBD) of the spike protein, the T4 fibritin C-terminal foldon (SRBD-Foldon), and the nucleocapsid protein (N).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pGX27-SΔTM/IC</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pGX27-SRBD-F/NP</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Data analyses were performed using GraphPad Prism 7 (GraphPad Software).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.01.466865: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Incubation with primary antibodies anti-SARS-CoV-2 rabbit membrane (M) protein (Rockland) (1:100) was performed for 2 hours at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>primary antibodies anti-SARS-CoV-2 rabbit membrane (M) protein (Rockland)</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 rabbit membrane (M) protein (Rockland)</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antiviral activity was assessed by cytopathic effect (CPE) reduction assay on Vero E6 cells or by RT-qPCR on A549-hACE2 or Calu-3 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: BCRJ Cat# 0264, RRID:CVCL_0609)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Quantitative reverse transcription polymerase chain reaction (RT-qPCR): Viral particles were collected from virus-infected A549 hACE2 cell supernatants at 72 hours post infection (100 μL) and viral RNAs were isolated from the supernatants using the Quick RNA Viral 96 Kit (Zymo Research) according to the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Immunofluorescence and confocal microscopy infected cell imaging: A549-hACE2 cells seeded on glass coverslips were infected with SARS-CoV-2 at a MOI 0.01.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>A549-hACE2</div><div>suggested: RRID:CVCL_A5KB)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The 50% effective concentration (EC50 [the concentration required to inhibit virus-induced cell death by 50%]) and the 50% cytotoxic concentration (CC50) (the concentration that reduces the viability of uninfected cells to 50% of that of untreated control cells) were determined using 4-parameter nonlinear regression with GraphPad Prism v8.0, based on the following calculations: Data are mean ± sd of three biological replicates, each of which consisted of duplicate samples.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">DAPI-stained nuclei surfaces were analyzed using ZEN software (Otsu threshold method) from a grid of 8×8 images taken at 20x magnification.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ZEN</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For intensity analysis, cells were imaged as Z stack with 0.3 μm sections then Z projection images were processed for total intensity per cell using ImageJ/Fiji.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ/Fiji</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical tests were performed using Origin 8.5 software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Origin</div><div>suggested: (Origin, RRID:SCR_014212)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Limitations of this study: Our study is the first to examine antiviral parameters of macrocyclic lactones other than IVM on SARS-CoV-2, nevertheless the data we provide here are only in vitro data, and the recent developments encourage us to emphasize that they should therefore be taken cautiously, and that many steps are to be completed before any result can be translated into clinical practice. Clinical risk-benefit balance is not in favor of the use of any of these molecules at this early stage. In order to try to approach the pharmacokinetic parameters of the molecules concerned, we used the data available for avermectins and milbemycins, often obtained from animal data; which do not directly allow an extrapolation to humans. Nevertheless, the concordance of all the data suggesting the impossibility of reaching even an imperfect pharmacological target of Cmax:EC50 and therefore even less able to reach Cmin:EC90 seemed important to us to avoid inappropriate conclusions being reached drawn from these data. Next steps and conclusion: Altogether our results clearly show that none of these agents is suitable for human use for its anti-SARS-CoV-2 activity per se. Our data show that DOR, MIL, and SEL are not clinically relevant candidates. They are not approved for human use, and therefore should not be used, and there is no rationale in our data to conduct the extensive studies that this would require (toxicology, impurity profile, thorough ADME evaluation). Further steps could...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on page 32. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.31.466651: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: Sample collection, preparation, and storage: All studies were approved by the Institutional Review Board of Washington University in St Louis.<br>IRB: Sample collection, preparation, and storage: All studies were approved by the Institutional Review Board of Washington University in St Louis.<br>Consent: Written consent was obtained from all participants.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">For selection, where a clone spanned both the GC and LNPC compartments, and/or multiple time points, a compartment and a timepoint were first randomly selected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HRP-conjugated goat anti-human IgG (H+L) antibody (Jackson ImmunoResearch, 109-035-088, 1:2500) was used to detect monoclonal antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: (Jackson ImmunoResearch Labs Cat# 109-035-088, RRID:AB_2337584)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HRP-conjugated goat anti-Human IgG Fcγ fragment (Jackson ImmunoResearch, 109-035-190, 1:1500), HRP-conjugated goat anti-human serum IgA α chain (Jackson ImmunoResearch, 109-035-011, 1:2500), and HRP-conjugated goat anti-human IgM (Caltag, H15007, 1:4000) were used to detect plasma antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human serum IgA α chain</div><div>suggested: (Jackson ImmunoResearch Labs Cat# 109-035-011, RRID:AB_2337580)</div></div><div style="margin-bottom:8px"><div>anti-human IgM (Caltag, H15007</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, a mammalian cell codon-optimized nucleotide sequences coding for the soluble version of S (GenBank: MN908947.3, amino acids 1-1,213) including a C-terminal thrombin cleavage site, T4 fold trimerization domain and hexahistidine tag was cloned into the mammalian expression vector pCAGGS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCAGGS</div><div>suggested: RRID:Addgene_18926)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Flow cytometry data were analyzed using FlowJo v.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">V(D)J gene annotation and genotyping: Initial germline V(D)J gene annotation was performed on the preprocessed BCRs using IgBLAST v.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgBLAST</div><div>suggested: (IgBLAST, RRID:SCR_002873)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">1.17.138 with IMGT/GENE-DB release 202113-239.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IMGT/GENE-DB</div><div>suggested: (IMGT/GENE-DB, RRID:SCR_006964)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">BCR analysis: BCR analysis was performed in R v4.1.0 with visualization performed using base R, ggplot2 v3.3.544, and GraphPad Prism v9.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ggplot2</div><div>suggested: (ggplot2, RRID:SCR_014601)</div></div><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Clonal overlap between B cell compartments was visualized using circlize v.0.4.1345.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>circlize</div><div>suggested: (circlize, RRID:SCR_002141)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Phylogenetic trees for S+ clones containing BMPCs were constructed on a by-participant basis using IgPhyML v1.1.346 with the HLP19 model47.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgPhyML</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Gene annotation on human reference chromosomes and scaffolds in Gene Transfer Format (‘gencode.v32.primary_assembly.annotation.gtf’) was downloaded (2021-06-02) from GENCODE v3252, from which a biotype (‘gene_type’) was extracted for each feature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GENCODE</div><div>suggested: (GENCODE, RRID:SCR_014966)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Quality control was performed as follows on the aggregate gene expression matrix consisting of 360,803 cells and 36,601 features using SCANPY v1.7.253 and Python v3.8.8.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      A potential limitation to our analyses of S-binding clones is that our selection strategy may have excluded some low-abundance or low-affinity S-specific clones. Nonetheless, we were able to account for 45% and 67% of all GC B cell and LNPC clones, respectively identified by scRNA-seq. This is the first study to provide direct evidence for the induction of antigen-specific BMPCs by an mRNA-based vaccine in humans. Notably, none of the 11 participants from whom post-vaccination bone marrow specimens were examined had a history of SARS-CoV-2 infection. BMPCs that recognized contemporary seasonal influenza virus vaccine antigens and diphtheria/tetanus vaccine antigens were present at frequencies roughly 10- and 2-fold greater than those against SARS-CoV-2 S, respectively. This is likely due to both the greater number of antigenic targets contained in the former vaccines and the repeated exposures to influenza and tetanus/diphtheria vaccine antigens our study participants likely experienced in comparison to the initial exposure to the novel SARS-CoV-2 S antigen. There are some epitopes within the S protein that are conserved between human seasonal coronaviruses and SARS-CoV-228,29. Cross-reactive B cells targeting these epitopes participate in PB and GC B cell responses to SARS-CoV-2 vaccination6,30. It is unlikely, however, that a substantial proportion of the SARS-CoV-2 S+ BMPCs we observed six months after immunization were part of a pre-existing pool of BMPCs, as in a previou...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.01.466834: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Mouse immunization: Groups of female BALB/c mice (6 to 8 weeks old) (n=5 per group) were obtained from the National Laboratory Animal Center, Taipei, Taiwan.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 S proteins were probed with anti-SARS-CoV-2 primary antibodies (GTX135356, GeneTex) overnight at 4°C, and detected with horseradish peroxidase (HRP)-conjugated goat anti-rabbit IgG (KPL) for 1 h at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>GTX135356</div><div>suggested: (GeneTex Cat# GTX135356, RRID:AB_2887482)</div></div><div style="margin-bottom:8px"><div>anti-rabbit IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Following this, the plates were incubated with 100 μl of HRP) conjugated anti-mouse IgG antibody (1:30000 in dilution buffer) for 1 h at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To determine the Ad titers, HEK293A cells were seeded into 6-well plates at a density of 106 cells/well and incubated at 37°C overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293A</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 pseudotyped lentivirus neutralization assay: To produce SARS-CoV-2 pseudoviruses, a plasmid expressing the full-length S protein (Wuhan-Hu-1, B.1.1.7, or B.1.351) of SARS-CoV-2 was co-transfected into HEK293T cells with packaging and reporter plasmids pCMVΔ8.91 and pLAS2w.FLuc.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: CCLV Cat# CCLV-RIE 1018, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The mixture was then inoculated with an equal volume of 10,000 HEK-293T cells stably expressing the ACE2 gene in 96-well plates, which were seeded one day before infection.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-293T</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mouse immunization: Groups of female BALB/c mice (6 to 8 weeks old) (n=5 per group) were obtained from the National Laboratory Animal Center, Taipei, Taiwan.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/c</div><div>suggested: RRID:IMSR_ORNL:BALB/cRl)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Wild-type S and glycan-masking S genes were first cloned into the pENTR1A vector (Invitrogen), and then cloned into the adenoviral plasmid pAd/CMV/V5-DEST (Invitrogen) using LR ClonaseTM II Enzyme Mix (Invitrogen) to produce the Ad plasmid expressing SARS-CoV-2 S gene.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pENTR1A</div><div>suggested: RRID:Addgene_37431)</div></div><div style="margin-bottom:8px"><div>pAd/CMV/V5-DEST</div><div>suggested: RRID:Addgene_66112)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 pseudotyped lentivirus neutralization assay: To produce SARS-CoV-2 pseudoviruses, a plasmid expressing the full-length S protein (Wuhan-Hu-1, B.1.1.7, or B.1.351) of SARS-CoV-2 was co-transfected into HEK293T cells with packaging and reporter plasmids pCMVΔ8.91 and pLAS2w.FLuc.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMVΔ8.91</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pLAS2w.FLuc</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">These cells were grown in Dulbecco’s modified Eagle medium (DMEM) (Thermo Scienific) supplemented with 10% fetal bovine serum (FBS) (Gibco) and 100 units/ml penicillin/streptomycin (P/S), and maintained in an incubator at 37°C with 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Thermo Scienific</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The exposed loops or the protruding sites of the exposed loops on the NTD and RBD of the S protein were examined using PyMol (The PyMol Molecular Graphics System, version 4.0; Schrödinger, LLC).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMol</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The IC50 values of the neutralization were obtained from the fitting curves using GraphPad Prism v6.01</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.28.465226: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Pseudotyped-virus neutralization assay: Mice were divided into seven groups with 8 female mice in each group and alhydrogel adjuvant (1.25 mg/ml, InvivoGen) was used for the animal study.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In this study, the final protein concentration was diluted into 0.1 mg/ml after mixed with the adjuvant and administrated at 10 μL per mice (BALB/c).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/c</div><div>suggested: RRID:IMSR_ORNL:BALB/cRl)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Protein expression and purification: The constructs of RBD (319-550) and fusion proteins were synthesized and sub-cloned into pZD vector between EcoRI and HindIII.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pZD</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Bright-Lumi™ kit was used for fluorescence detection and the final IC50 (50% neutralization) was calculated on GraphPad Prism.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.24.465080: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: Experimental procedures with human blood were done according to the European Union guidelines and the Declaration of Helsinki and informed consent was obtained from all donors (healthy and patients).<br>Field Sample Permit: Biological collection and informed consent were approved by the Direction de la Recherche Clinique et Innovation (DRCI) and the French Ministry of Research (N°2019-3677).<br>IRB: The study conforms to the principles outlined in the Declaration of Helsinki and received approval by the appropriate Institutional Review Board (Cochin-Port Royal Hospital, Paris<br>IACUC: The WBI Animal Care and Use Committee reviewed and approved all mouse experiments (IACUC NO. 17-006).<br>Euthanasia Agents: The mice were anesthetized and exsanguinated into pre-chilled EDTA tubes.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Mice: Animal experiments were performed blindly by Washington Biotechnology, INC.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After fixation, cells were incubated in Perm-S solution containing the anti-cytokine antibodies and isotopes Ir for 30 min at RT (Maxpar Perm-S buffer;Fluidigm).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-cytokine</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, the cells were fixed for 20 min at RT with 250 μL of the Inside Fix solution then washed and stained in 100 μL of the Inside Perm solution containing PE anti-TNF (clone cA2, Miltenyi Biotec) and APC anti-IL-1β (clone REA1172, Miltenyi Biotec) antibody at 1/50 for 30 min at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-TNF</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-IL-1β</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Simoa digital ELISA specific for TNF-α was developed using a Quanterix Homebrew Assay and two commercially available antibodies[38].</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antibodies[38</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were acquired using a CyTOF2 instrument (Fluidigm) and analyzed using both FlowJo software for cleaning data and the viSNE algorithm in Cytobank to perform main analysis.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div><div style="margin-bottom:8px"><div>Cytobank</div><div>suggested: (Cytobank, RRID:SCR_014043)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pathway analysis was performed using DAVID bioinformatics databank (https://david.ncifcrf.gov).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>DAVID</div><div>suggested: (DAVID, RRID:SCR_001881)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      To overcome these limitations, novel strategies such as Janus kinases (JAK) inhibitors, which are small molecules inhibiting the activity of JAK, showed reasonable success in adult form of arthritis[30][31][32]. As for strategies targeting JAK, we demonstrate that CB treatment exhibits wide-ranging cytokine inhibition in vitro, ex vivo and in vivo. CB acts, however, one step upstream of JAK inhibitors, by blocking the production of inflammatory cytokines rather than blocking cytokine-mediated signaling, which may confer some advantages in terms of therapies efficacies. This is in fact supported by the strong inhibition of disease progression in CB-treated RA mice, validating the concept of targeting CXCR4 with CB-like molecules to treat arthritic diseases. CB indeed holds all the required hallmarks for a promising new drug to treat RA: CB is a small molecule, which does not show any side effects in preclinical models in vivo, targets the widely expressed receptor CXCR4 on immune cells, and acts on cytokine production with a broad anti-inflammatory spectrum. To illustrate the potential benefit of CB in another inflammatory disease context, we studied samples from COVID-19 patients. Hypersecretion of inflammatory cytokines by monocytes and macrophages in lung seems to be central in COVID-19 pathology. Studies of SARS-CoV2 infection have revealed highly inflammatory monocyte/macrophage[9,10],[33] population in the bronchoalveolar lavage of patients with severe but not mild COVID...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on page 27. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.23.465542: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: Rhesus Macaque Model, Immunizations, and Delta Challenge: All experiments conducted according to NIH regulations and standards on the humane care and use of laboratory animals as well as the Animal Care and Use Committees of the NIH Vaccine Research Center and Bioqual, Inc. (Rockville, Maryland).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">6-week-old male Syrian hamsters (Envigo) were housed at Bioqual, Inc.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Total IgG and IgA antigen-specific antibodies to variant SARS-CoV-2 RBD-derived antigens were determined by enzyme-linked immunosorbent assay (ELISA) using MULTI-ARRAY 384-well streptavidin-coated plates (Meso Scale Discovery, MSD).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgA</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Total IgG antibody titers in the BAL were quantitated by using the Human/NHP IgG Kit (MSD) and antibody titers to measles were quantitated by using the Monkey Anti-Measles IgG ELISA Kit (Alpha Diagnostics International) according to the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Total IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Anti-Measles IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were incubated with an anti-SARS-CoV S primary antibody directly conjugated to biotin (CR3022-biotin) for 1 hour at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV S</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CR3022-biotin</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, anti-histidine antibody was immobilized on Series S Sensor Chip CM5 (Cytiva) through primary amine coupling using a His capture kit (Cytiva), allowing His-tagged SARS-CoV-2 S protein containing 2 proline stabilization mutations (S-2P) to be captured on active sensor surface.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-histidine</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The following antibodies were used (monoclonal unless indicated): IgD FITC (goat polyclonal, Southern Biotech), IgM PerCP-Cy5.5 (clone G20-127, BD Biosciences), IgA Dylight 405 (goat polyclonal, Jackson Immunoresearch Inc), CD20 BV570 (clone 2H7, Biolegend), CD27 BV650 (clone O323, Biolegend), CD14 BV785 (clone M5E2, Biolegend), CD16 BUV496 (clone 3G8, BD Biosciences), IgG Alexa 700 (clone G18-145, BD Biosciences), CD3 APC-Cy7 (clone SP34.2, BD Biosciences), CD38 PE (clone OKT10, Caprico Biotechnologies), CD21 PE-Cy5 (clone B-ly4, BD Biosciences), and CXCR5 PE-Cy7 (clone MU5UBEE, Thermo Fisher Scientific).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD20</div><div>suggested: (BioLegend Cat# 348805, RRID:AB_2889063)</div></div><div style="margin-bottom:8px"><div>CD27</div><div>suggested: (BioLegend Cat# 124241, RRID:AB_2800595)</div></div><div style="margin-bottom:8px"><div>CD14</div><div>suggested: (BD Biosciences Cat# 750381, RRID:AB_2874552)</div></div><div style="margin-bottom:8px"><div>CD16</div><div>suggested: (BD Biosciences Cat# 564653, RRID:AB_2744294)</div></div><div style="margin-bottom:8px"><div>CD21</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CXCR5</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The following monoclonal antibodies were used: CD3 APC-Cy7 (clone SP34.2, BD Biosciences), CD4 PE-Cy5.5 (clone S3.5, Invitrogen), CD8 BV570 (clone RPA-T8, BioLegend), CD45RA PE-Cy5 (clone 5H9, BD Biosciences), CCR7 BV650 (clone G043H7, BioLegend), CXCR5 PE (clone MU5UBEE, Thermo Fisher), CXCR3 BV711 (clone 1C6/CXCR3, BD Biosciences), PD-1 BUV737 (clone EH12.1, BD Biosciences), ICOS Pe-Cy7 (clone C398.4A, BioLegend), CD69 ECD (cloneTP1.55.3, Beckman Coulter), IFN-g Ax700 (clone B27, BioLegend), IL-2 BV750 (clone MQ1-17H12, BD Biosciences), IL-4 BB700 (clone MP4-25D2, BD Biosciences), TNF-FITC (clone Mab11, BD Biosciences), IL-13 BV421 (clone JES10-5A2, BD Biosciences), IL-17 BV605 (clone BL168, BioLegend), IL-21 Ax647 (clone 3A3-N2.1, BD Biosciences), and CD154 BV785 (clone 24-31, BioLegend).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD4</div><div>suggested: (Thermo Fisher Scientific Cat# 8822-6853-41, RRID:AB_2575278)</div></div><div style="margin-bottom:8px"><div>CCR7</div><div>suggested: (GenWay Biotech Inc. Cat# GWB-EA1DA7, RRID:AB_10269678)</div></div><div style="margin-bottom:8px"><div>CXCR3</div><div>suggested: (BD Biosciences Cat# 741866, RRID:AB_2871195)</div></div><div style="margin-bottom:8px"><div>PD-1 BUV737</div><div>suggested: (BD Biosciences Cat# 565299, RRID:AB_2739167)</div></div><div style="margin-bottom:8px"><div>CD69</div><div>suggested: (BD Biosciences Cat# 747520, RRID:AB_2744097)</div></div><div style="margin-bottom:8px"><div>IL-2</div><div>suggested: (BioLegend Cat# 500347, RRID:AB_2566470)</div></div><div style="margin-bottom:8px"><div>IL-4</div><div>suggested: (BD Biosciences Cat# 745925, RRID:AB_2871637)</div></div><div style="margin-bottom:8px"><div>IL-13 BV421</div><div>suggested: (BioLegend Cat# 501916, RRID:AB_2616748)</div></div><div style="margin-bottom:8px"><div>IL-17</div><div>suggested: (BioLegend Cat# 512326, RRID:AB_2563887)</div></div><div style="margin-bottom:8px"><div>CD154</div><div>suggested: (BioLegend Cat# 310842, RRID:AB_2572187)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A rabbit polyclonal anti-SARS-CoV-2 antibody (GeneTex, GTX135357) at a dilution of 1:2000 was used for IHC.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells and Viruses: VeroE6 cells were obtained from ATCC (clone E6, ATCC, #CRL-1586) and cultured in complete DMEM medium consisting of 1x DMEM (VWR, #45000-304), 10% FBS, 25mM HEPES Buffer (Corning Cellgro), 2mM L-glutamine, 1mM sodium pyruvate, 1x Non-essential Amino Acids, and 1x antibiotics.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">VeroE6-TMPRSS2 cells were generated at Vaccine Research Center, NIH, Bethesda, MD.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6-TMPRSS2</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The antibody-virus mixture was then added to Vero cells and incubated at 37°C for 1 hour.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, HEK293T/17 cells (ATCC CRL-11268) were transfected with the following: plasmids encoding S proteins from Wuhan-Hu-1 strain (GenBank no. MN908947.3) with a p.Asp614Gly mutation, a luciferase reporter, lentivirus backbone, and the human transmembrane protease serine 2 (TMPRSS2) genes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T/17</div><div>suggested: ATCC Cat# CRL-11268, RRID:CVCL_1926)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">TCID50 Assay: Vero-TMPRSS2 cells (obtained from Adrian Creanga, Vaccine Research Center-NIAID) were plated at 25,000 cells/well in DMEM with 10% FBS and gentamicin, and the cultures were incubated at 37°C, 5.0% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-TMPRSS2</div><div>suggested: JCRB Cat# JCRB1818, RRID:CVCL_YQ48)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">IC50 titers were calculated using a log(agonist) versus normalized-response (variable slope) nonlinear regression model in Prism v9.0.2 (GraphPad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The following antibodies were used (monoclonal unless indicated): IgD FITC (goat polyclonal, Southern Biotech), IgM PerCP-Cy5.5 (clone G20-127, BD Biosciences), IgA Dylight 405 (goat polyclonal, Jackson Immunoresearch Inc), CD20 BV570 (clone 2H7, Biolegend), CD27 BV650 (clone O323, Biolegend), CD14 BV785 (clone M5E2, Biolegend), CD16 BUV496 (clone 3G8, BD Biosciences), IgG Alexa 700 (clone G18-145, BD Biosciences), CD3 APC-Cy7 (clone SP34.2, BD Biosciences), CD38 PE (clone OKT10, Caprico Biotechnologies), CD21 PE-Cy5 (clone B-ly4, BD Biosciences), and CXCR5 PE-Cy7 (clone MU5UBEE, Thermo Fisher Scientific).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BD Biosciences</div><div>suggested: (BD Biosciences, RRID:SCR_013311)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Samples were acquired on an BD FACSymphony cytometer and analyzed using FlowJo version 10.7.2 (BD, Ashland, OR).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All analyses are conducted using R version 4.0.2 and GraphPad Prism version 8.2.0 unless otherwise specified.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      A potential limitation relates to the extent of viral replication following B.1.617.2 challenge. The challenge stock used here was passaged once and fully matched the canonical B.1.617.2 S sequences obtained from humans. However, we did not observe greater sgRNA copy numbers in the upper airway than in previous challenges with B.1.351 or WA1 (Corbett et al., 2021b; Corbett et al., 2021c). Clinical reports have described substantially higher viral titers in the upper respiratory tract from B.1.617.2 infections compared to ancestral strains (Ong et al., 2021; Williams et al., 2021). It is possible that the NHP model does not precisely recapitulate human infection. We and others have previously shown that antibodies are a correlate of protection (Corbett et al., 2021b; Gilbert et al., 2021). These studies are based on a short interval between vaccination and virus exposure or challenge. Here, we did not find a clear immune correlate of protection between binding or neutralizing antibody responses in the blood at the peak of the response or the time of challenge one year later. Additional analysis from human clinical trials with much larger numbers of vaccinated individuals than the 8 NHP in this study will be important for determining whether serum antibody titers remain as a correlate of protection in the long term. Indeed, the data presented here raise the possibility that the correlate of protection may lie in the ability of tissue-resident memory B cells to expand after infe...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.09.467862: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: Mice: All mice were treated in accordance with OSU Institutional Animal Care and Use Committee (IACUC) guidelines and approved protocols.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Statistical analysis: All experiments were performed using randomly assigned mice without investigator blinding.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Statistical analysis: All experiments were performed using randomly assigned mice without investigator blinding.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Authentication: Virus was cultured, prepared and authenticated as we recently reported [25].</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Namely, to establish the viral stocks used in our studies, a virus aliquot was thawed, diluted 1:10,000 in incomplete DMEM (Gibco; supplemented with 4.5 g/L D-glucose, 110 mg/L sodium pyruvate) and added to confluent VeroE6 cells (ATCC).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VeroE6</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">C57BL/6 and hemizygous K18-hACE C57BL/6J mice (strain: 2B6.Cg-Tg(K18-ACE2)2Prlmn/J) were purchased from Jackson Laboratory (Bar Harbor, ME) and housed at OSU within an AALAC-accredited facility (University Laboratory Animal Resources, ULAR).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57BL/6</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>C57BL/6J</div><div>suggested: RRID:MGI:3589388)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Images were processed using FIJI [31] and compiled using BioRender.com ELISA: CoV2 N protein levels in lung homogenates were determined using a commercially available ELISA kit (ADS Biotec), as were protein levels of the cytokines IL1β, IL6 and IFNγ (Biolegend).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FIJI</div><div>suggested: (Fiji, RRID:SCR_002285)</div></div><div style="margin-bottom:8px"><div>BioRender</div><div>suggested: (Biorender, RRID:SCR_018361)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis was performed using GraphPad Prism.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The only exception to this were the t-distributed stochastic neighbor embedding (t-SNE), annotation and graphing associated with our scRNA analysis, which was performed with Cell Ranger and RStudio.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RStudio</div><div>suggested: (RStudio, RRID:SCR_000432)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      The limitations of our study include its being performed in mice, which of course do not recapitulate all aspects of TB or COVID in humans, nor have we examined the long term impact of CoV2 on the host response to Mtb as we terminated our study fourteen days after CoV2 challenge. That said, we believe animal models of TB and COVID are ideal for studies of this nature because—if studies of COVID in individuals with other chronic lung diseases are any guide [22, 23]—it will likely be difficult to tease apart the impact of TB on COVID outcomes in humans given that individuals with TB often have numerous other comorbidities (e.g. malnourishment, HIV) that confound interpretation. Translated to human COVID susceptibility, our results suggest that individuals infected with Mtb generate an immune response that offers a degree of protection from subsequent or secondary infection with CoV2.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Author Response:

      Reviewer #1 (Public Review):

      In their manuscript, Sengupta et al. describe a developmental mechanism that positions a single neuron across multiple layers in the hierarchical C. elegans nerve ring. The authors show that neighborhood placement of the interneuron AIB is established during embryogenesis and is maintained throughout development. AIB is one of the few C. elegans neurons that are divided into distinct pre- and post-synaptic regions, and its axons curiously occupy two physically separated neighborhoods or layers. How this occurs is not known. This study uses time-lapse imaging to show that unlike canonical axon tip outgrowth mediating fasciculation in a target region, AIB's axon occupies two neighborhoods by first growing completely into one, and then gradually unzippering from the first, switching, and zippering onto the second neighborhood. Importantly, axon outgrowth and neighborhood choice are continuously visualized during embryogenesis, an impressive experiment typically constrained by lack of cell-specific reporters during early development as well as the struggle of imaging embryos.

      The authors posit that zippering is mediated by temporally regulated differential adhesive forces between AIB's neighboring pre- and post-synaptic neurons. How this differs from differential adhesion in classic fasciculating neurons is described but could be made much clearer. They proceed to identify the immunoglobulin syg-1/syg-2 receptor-ligand pair to be necessary and sufficient for AIB's axon switch; in syg-1/syg-2 mutants, AIB is not able to position itself in the second neighborhood and remains fasciculated with the first one, suggesting that adhesive forces are dampened in syg-1/syg-2 mutants. Lastly, the authors show that pre-synapse assembly follows zippering, linking AIB axon placement with synaptogenesis, and that this is also compromised in syg mutants.

      The pipeline used to study axon outgrowth at a single-cell level in the embryo at relevant time points is commendable and will be useful to people studying C. elegans nervous system establishment. Although the overall manuscript and data are well-presented, we think the mechanism of retrograde zippering could be better described. Also, syg-1/syg-2 expression needs to be delineated to support the notion of differential adhesion between neighborhoods.

      We have further clarified the novelty of the zippering mechanism, contrasting it with tip-directed outgrowth. We have also performed a thorough analysis of syg-1 expression.

      Reviewer #2 (Public Review):

      A large amount of data is presented in this paper. The experiments are carefully documented and support the conclusions. Of particular importance is the live imaging of the outgrowth of the AIB neurite in the embryo. This is challenging and required the development of a new marker for labelling and the adaptation of a new type of microscope. This enabled the initial and surprising observation that part of the neurite relocates after outgrowth. I'm not sure that the mathematical modeling adds much. The main conclusion is that the modeling is consistent with a "net increase of adhesive forces in the anterior neighbourhood", which is to be expected. The authors then try to identify the relevant adhesion molecules and find that a pair of IgCAMs (syg-1 and syg-2), which are known to act as receptor-ligand pair, are involved. A series of experiments establishes that syg-2 act in the AIB neurons, whereas syg-1 does not. The neurite positioning defects in syg-1 and syg-2 mutants are partially penetrant, suggesting that other adhesion molecules must be involved. While a large percentage of mutant animals show defects, the defects within an individual animal are surprisingly low with only 21.5% +/- 4% of the neurite detached. This would suggest that syg-1/syg-2 aren't even the major adhesion molecules involved here. In further studies, where the authors ablate the RIM neurons (which express syg-1), the authors use a different measure to quantify the defects (minimal distance between neurite segments, Suppl Figure 7). This makes it difficult to compare the results to those of the syg-1 mutants. For the ectopic expression experiments with syg-1 the authors only report the percentage of animal with defects and not the extent of the defects (how much of the neurite was in an abnormal position).

      Overall, this is a very detailed study describing an important novel mechanism for neurite positioning within an nerve bundle.

      We have added in this revised version additional quantifications, including ‘the minimal distance between neurite segments’ measure (the one used for the RIM ablation experiments) in Figure 4-figure supplement 1 for the placement defects in syg-1(ky652) and syg-2(ky671) mutants, allowing direct comparisons between the phenotypes. We have also added a measure for the percentage of the distal neurite that is mispositioned in the ectopic expression experiments (Figure 6-figure supplement 1A). We do not claim that SYG-1/SYG-2 are the only adhesion molecules involved in AIB neurite placement, but that they are required for complete and proper placement of the neurite. We clarify this in the text.

      Reviewer #3 (Public Review):

      This is a very interesting manuscript describing the changes of neurite position in a complex neuropil during development. The experimental system is well chosen because AIB's function within the circuit requires its neurite to be in two different neuropil "neighborhoods". The manuscript included some technically difficult experiments of imaging neurite outgrowth in C. elegans embryos which are very hard to do. The surprising finding here is that neurite position is not sole dependent on its growth cone navigation. In the case of the AIB neuron, the growth cone is anchored after it reaches its destination point and then a segment of the neurite shift direction towards its final position through a zippering action. They also show that this shift in position is driven by adhesion molecules SYG-1 and SYG-2. Overall, I think this is a strong candidate for eLife. I have one main point and a few minor points.

      My main point is about the relationship between synapse formation and neurite zippering. In my opinion, this is an interesting point because it would tell us if the zippering behavior is a consequence of synapse formation or it is a distinct specificity step before synapse formation. From the time course that was described in the paper, it seems that the accumulation of RAB-3 only starts after the zippering has completed. I would suggest the authors to examine at least another synaptic marker like SNB-1 or SYD-2. We have created cell specific endogenous labeling of several active zone markers that can be used for these experiments. If the results hold, then, I think the authors should make it clear in the text that the zippering takes place before synapse formation and serves as a distinct step in achieving the neighborhood specificity.

      We thank the reviewer for generously sending us strains for cell-specific endogenous active zone protein labeling (McDonald et al., 2021) using the SapTrap method (Schwartz and Jorgensen, 2016). We made constructs expressing FLP recombinase downstream of the inx-1 and unc-42 promoters for cell-specific labeling of these active zone proteins in AIB and injected them into the strains. Although we observed cell-specific synaptic signal in larvae with both inx-1p and unc-42p-driven FLP, we were not able to observe signal during embryogenesis, probably due to cell-specific synaptic protein expression levels being low.

      Therefore and to address the reviewer’s question about the temporal order of zippering and synapse formation, we have cell-specifically expressed two active zone proteins in AIB (CLA-1 and SYD-2) and measured their intensities over time in AIB in embryos (Figure 7, Figure 7-figure supplement 1A-F). We find that similar to RAB-3, synaptic signal is not visible until after the end of zippering, and progressively increases over time following zippering. These observations suggest that synapses do not initiate retrograde zippering. We added the time-course of active zone protein localization in AIB in the context of the time course of retrograde zippering (Figure 7J). Consistent with these observations, in a syd-2(ola341) allele identified in our screen, we find that although synapses are mislocalized, AIB neurite placement is unaffected, consistent with the idea that synapse formation is not upstream of zippering-mediated placement (Figure 7-figure supplement 1G-K).

      We acknowledge, however, that our studies are limited by detection of the synaptic proteins, and that, while it does not appear that synaptogenesis leads to zippering, a cooperative and synergistic relationship might exist between the process of zippering and synaptogenesis to hold the neurite position in place. We have added text to better discuss this relationship between zippering and synaptogenesis in light of these findings.

      Minor points

      1. The schematic diagram is somewhat misleading because in the axial view, the anterior and posterior segment of the nerve ring should appear on top of each other. The lateral view is the right view to show the anterior and posterior segments.

      This is a valid point - if we look at the worm directly head-on, the two segments of the neurite would be on top of one another. A slight tilt of the worm head enables visualization of the parts of the neurite in the two neighborhoods. We have now clarified this in the figure legends.

      1. Describe the screen that led to the mutant alleles of syg-1 and syg-2 better. Any other mutants?

      We have described the screen further in Methods and now include another allele, corresponding to syd-2 (Figure 7-figure supplement 1), isolated from the screen.

      1. "Consistent with the importance of adhesion-based mechanisms in the observed phenotypes, ectopic expression of the SYG-1 endodomain in the posterior neighborhood did not result in mislocalization of AIB (Figure 6-figure supplement 1A,B). " This statement is wrong. I suspect the authors meant in syg-2 mutants.

      The statement might have been confusing, but it is not wrong. We have found that ectopic expression of the SYG-1 endodomain, which lacks SYG-1’s extracellular domains, does not cause ectopic placement of the AIB neurite, which is what we described in that statement. We have edited to make it more clear.

      1. For Fig. 7-figure supplement 1, please quantify this phenotype.

      We have now included quantifications for this in Figure 7-figure supplement 3.

      References

      MCDONALD, N. A., FETTER, R. D. & SHEN, K. 2021. Author Correction: Assembly of synaptic active zones requires phase separation of scaffold molecules. Nature, 595, E35. SCHWARTZ, M. L. & JORGENSEN, E. M. 2016. SapTrap, a Toolkit for High-Throughput CRISPR/Cas9 Gene Modification in Caenorhabditis elegans. Genetics, 202, 1277-88.

    1. Author Response:

      Reviewer #1 (Public Review):

      Summary

      Moncunill et al set out to investigate a very important question: why are half of children vaccinated three times with RTS,S AS01 protected from clinical malaria - and half not? To do so they isolated PBMCs before vaccination and one month after third vaccination and stimulated them in vitro with DMSO (vehicle control), two malaria antigens (CSP (part of RTS,S) & AMA1) or HBS (hepatitis B antigen - part of RTS,S).

      They then assessed their transcriptional response by blood transcriptional module analysis and correlated those results with previous published data on antibody titers and T cell cytokine production to find associations. To assess risk of clinical malaria, responses were compared between RTS,S vaccinated children who developed clinical malaria in the one year follow-up (cases) and those who received RTS,S or a comparator vaccine and did not (controls). They found that responses after RTS,S vaccination did not predict protection from clinical malaria. Instead a blood transcriptional module signature related to dendritic cells, inflammation, and monocytes before vaccination may be associated with clinical malaria risk.

      Strengths

      Immune correlates of protection are evaluated in African children (who are the RTS,S target population) in a natural transmission setting.

      Excellent set of controls: children (same age) vaccinated with RTS,S or comparator vaccine alongside each other -> retrospectively stratified by whether the did or did not develop clinical malaria : controls for the effect of a developing immune system and would allow to disentangle RTS,S specific and clinical malaria specific response patterns.

      Weaknesses

      RTS,S is composed of CSP & HBS. yet when PBMCs from children vaccinated three time with RTS,S are stimulated with these peptides no transcriptional differences compared to children receiving a rabies or meningitis vaccine were detected (Figure 2). this lack of recall response impacts all downstream conclusions and comparisons made in the paper.

      The fact that bulk transcriptional profiling of Ag-stimulated PBMCs (and specifically to CSP) did not identify large significant differences in BTM expression between the RTS,S vs. comparator group could be due to several factors. First of all, the frequency of antigen-specific CD4+ T cells was very low among CD4+ T cells (Figure 4 of the manuscript shows that CSP-specific CD4+ T cells comprise < 0.004% of all CD4+ T cells). This low frequency of CSP-specific T cells is consistent with other RTS,S studies [e.g. as we state on line 330, we have previously found that CSP-specific T-cells in RTS,S/AS01 vaccines comprise < 0.10% of all CD4+ T cells (1)]. Moreover, CD4+ T cells themselves comprise approximately 45-57% of all PBMCs (2). Thus, finding an expression signal between the RTS,S vs. comparator group would require the signal to be high enough to be detected in only 0.002% of all PBMCs [0.004% (% CSP-specific CD4+ T cells out of total CD4+ T cells) x 51% (average % of CD4+ T cells out of all PBMCs) = 0.002%]. Thus, lack of detectable recall response does not mean lack of recall response. Moreover, as suggested below, we opted not to focus the rest of the manuscript on the Ag-stimulation results.

      Second of all, the PBMCs were stimulated on site for 12h and then cryopreserved. This stimulation time was chosen based on the kinetics of IFN- and IL-2 mRNA response (3), but other responses may have had different kinetics and thus have already resolved or have not yet occurred by the 12-h cryopreservation. We have added text in the manuscript to discuss these caveats (“Another potential reason for why no BTMs were found to associate with the response to RTS,S/AS01 vaccination or with protection when analyzing CSP-stimulated PBMC is that all PBMC were stimulated on site for 12 hours (this stimulation time was chosen based on the kinetics of the IFN-gamma transcriptional response) and then cryopreserved. Thus, we were unable to detect earlier transient responses that had already resolved by 12 hours, as well as more delayed response that had not yet initiated by 12 hours, if such responses occurred”).

      It should be noted that in all our analyses, the stimulated results were adjusted for DMSO to focus on the antigen-specific response only. This would explain why we detect signal in the DMSO samples but not in response to stimulation. We have realized that this was not very well described in the figure captions and the Methods section and have added more details, including the model description in Methods section. As such, we do not believe that these results impact all downstream conclusions. We believe that the unstimulated results provide significant new insights into the immune and molecular mechanisms of RTS,S vaccine efficacy, not necessarily directly related to the RTS,S-specific acquired immune response. Finally, we would like to highlight the fact that we have improved our model specification to directly account for the pairing of some of the samples using a random effect using the limma package. This has slightly increased statistical power, and as such the number of significantly differentially expressed BTMs in response to stimulation is a bit higher (but still much less than that for the DMSO). Originally, we had decided against the use of a random effect due to the computational cost of estimating the random effect.

      Transcriptional responses 1 month after the final RTS,S vaccination do not predict clinical malaria risk (Figure 3) - this is a key finding, which should be central to the conclusion of this paper.

      Considering that Kazmin et al. (4) showed that the transcriptional response to the third RTS,S/AS01 dose peaks at Day 1 post-injection, with some decline by Day 6 and approximately 90% of the response having waned by Day 21 (with the caveat that Kazmin et al.’s study population was malaria-naïve adults), we do not find it surprising that there were only a few BTMs whose 1 month post-final RTS,S dose associated with clinical malaria risk. However, the point is well-taken about the relative merits of the baseline. We have edited the Discussion to include discussion of the Month 3 correlates results:

      “Compared to the 45 BTMs whose baseline levels significantly associated with clinical malaria risk in RTS,S/AS01-vaccinated African children, fewer BTMs (seven) had levels at one month post-final RTS,S/AS01 dose that significantly associated with clinical malaria risk. Moreover, if a more stringent FDR cutoff had been used (i.e. 5%), six of these seven BTMs would not have been identified. Thus it is entirely possible that, at one month post-final RTS,S/AS01 dose, there is no circulating immune transcriptomic signature predictive of risk. Such a conclusion would not be surprising, given that in malaria-naïve adults, the transcriptional response to the third RTS,S/AS01 dose has been shown to peak at Day 1 post-injection, with some decline by Day 6 and approximately 90% of the response having waned by Day 21 (17). Therefore, it is likely that the sampling scheme in this study (one month post-final dose) misses the majority of the transcriptional response to RTS,S/AS01.”

      The take-home message put forward in the title/abstract (that a monocyte and DC related pre-vaccination signature predicts risk of clinical malaria in RTS,S vaccinated children) is not strongly supported by the data. It is based on blood transcriptional modules related to monocytes being picked out when comparing RTS,S vaccinated cases and controls.

      Thank you for giving us the opportunity to provide further rationale for our focus on the 7 monocyte-related and 4 DC-related BTMs shown in Figure 6B (MAL067 column) out of the 45 total BTMs whose baseline expression associated with clinical malaria risk in RTS,S/AS01-vaccinated children. The reviewer implies that these modules were chosen for focus somewhat randomly or without justification (or, even worse, “cherry picked”), which we would agree would be an imperfect method for drawing conclusions.

      First, we have always ensured to mention that the 45 baseline modules that correlated with risk in RTS,S recipients (Fig 6B, MAL067 column) belonged to many functional annotations, including DC cells and monocytes. (Abstract: “In contrast, baseline levels of BTMs associated with dendritic cells and with monocytes (among others) correlated with malaria risk”) (Main text, lines 519-522: “Compared to the results from the month 3 analysis (7 BTMs), the baseline correlates analysis of MAL067 revealed a larger number (45) of BTMs, spanning many functional categories, whose month 0 levels in vehicle-stimulated PBMC nearly all associated with clinical malaria risk in RTS,S/AS01 recipients .”

      The focus on DC cells and monocytes is due to two reasons: 1) the fact that the DC-related modules and the monocyte-related modules were some of the most significant correlations (lines 522-524: “The BTM with the most significant association with risk was “enriched in monocytes (II) (M11.0)” (FDR = 1.80E-14), followed by “inflammatory response (M33)” (FDR = 2.45E-07) and “resting dendritic cell surface signature (S10)” (FDR = 6.03E-07).”

      Second, the baseline association of DC- and monocyte-related modules appeared to generalize across populations: (Abstract: “A cross-study analysis supported generalizability of the baseline dendritic cell- and monocyte-related BTM correlations with malaria risk to healthy, malaria-naïve adults, suggesting that certain monocyte subsets may inhibit protective RTS,S/AS01-induced responses.”; Main text: “BTMs related to dendritic cells and to monocytes were most consistently associated with risk across these three studies [“resting dendritic cell surface signature (S10)”, “DC surface signature (S5)”, “enriched in dendritic cells (M168)”, “enriched in monocytes (I) (M4.15)”, “enriched in monocytes (II) (M11.0)”, “enriched in monocytes (IV) (M118.0)”, and “monocyte surface signature (S4)” significantly correlated with risk in all three studies].”

      The first two sentences of the Discussion (lines 577-580) explain our focus on monocytes and DCs:

      “Our main finding is the identification of a baseline blood transcriptional module (BTM) signature that associates with clinical malaria risk in RTS,S/AS01-vaccinated African children. In a cross-study comparison, much of this baseline risk signature – specifically, dendritic cell- and monocyte-related BTMs – was also recapitulated in two of the three CHMI studies in healthy, malaria-naïve adults.”

      Finally, we note that the title (“A baseline transcriptional signature associates with clinical malaria risk in RTS,S/AS01-vaccinated African children”) does not restrict to DC-related or monocyte-related BTMs, rather, we chose this title based on the larger number of BTMs, and higher correlations with risk, in the baseline analysis compared to the Month 3 analysis.

      We have revised all instances where we have communicated this less clearly, e.g. “for why we identified a baseline monocyte transcriptional signature of risk” has been changed to “for why we identified monocyte-related BTMs in our transcriptional signature of risk”.

      Many other modules are picked out as well e.g. cell cycle (Figure 6B). An in-depth analysis of the genes in these module and what their up and downregulation can tell us about their function is warranted to support the conclusions.

      Thank you for the suggestion to look at the cell cycle module in Figure 6B. You make a good point that this module is the only module to show a significant association with clinical malaria risk across all 4 of the RTS,S studies and should therefore be further examined. First, we have added this to the text:

      “Only one BTM, “cell cycle and transcription (M4.0)”, was significantly associated with risk across all four studies. Of the 335 genes in this module (M4.0), 130 were also present in one or more of the six “monocyte-related” BTMs shown in Figure 6B (297 genes total across all six BTMs), suggesting that the “cell cycle” and “monocyte” results may actually be picking up the same signal.”

      We have done the gene-level analysis as suggested, resulting in 8 new supplemental figures (Figure 6-figure supplements 1-8) and one new supplemental table (S5). We have also made the following revisions to the text:

      In Results: “To gain insight into specific module-member genes that may be involved in the RTS,S/AS01 baseline risk signature, we performed the same analysis on the gene level, i.e. examined associations with clinical malaria risk for each of the constituent genes in the 45 BTMs shown in Figure 6B. Figure 6-figure supplements 1-8 show the gene-level association results within the eight BTMs that were significantly associated with clinical malaria risk in MAL067 and at least two of the three CHMI studies, and had at least one gene in MAL067 that was significantly associated with risk (these eight correspond to M4.0, S10, S5, M168, M4.3, M11.0, M4.15, and S4). Within MAL067, 35 unique genes were shown to significantly associate with malaria risk (Supplementary Table 5); 9 of these genes (CCNF, MK167, KIF18A, NPL, RBM47, CFD, MAFB, IL13RA1, and CCR1) also had significant association with non-protection in one of the CHMI studies. Although no individual gene was significantly associated with risk across >2 studies, many showed consistent effect (direction and magnitude) across 3 studies. This further supports our choice to focus on modules instead of individual genes as GSEA increases power to detect more subtle but coordinated changes in gene expression data that would be missed otherwise. For this same reason, GSEA has been shown to enhance cross-study comparisons (45).”

      In Discussion: “Our gene-level correlates analyses suggest an alternative hypothesis, however. With the caveat that the gene-level analyses were performed post hoc, high baseline expression of STAB1 (which is present in DC-related, monocyte-related, and cell cycle-related modules) was found to positively associate with clinical malaria risk (Figure 6-figure supplements 1, 2, and 6). STAB1 encodes stabilin-1 (also called Clever-1), a transmembrane glycoprotein scavenger receptor that links extracellular signals to intracellular vesicle trafficking pathways (58). Interestingly, stabilin-1high monocytes show downregulation of proinflammatory genes, and T cells co-cultured with stabilin-1high monocytes showed decreased antigen recall, suggesting that monocyte stabilin-1 suppresses T cell activation (56). Thus one possibility is that stabilin-1high immunosuppressive monocytes circulating at baseline could decrease protective RTS,S-induced T-cell responses, or inhibit another aspect of adaptive immunity. Single-cell transcriptomic profiling of PBMC or purified monocyte subsets in future RTS,S trials in African children in malaria-endemic areas could help test this hypothesis.”

      Impact

      This paper will inform future studies looking for correlates of RTS,S induced protection from clinical malaria in a variety of ways:

      It validates the blood transcriptional module approach (as published by Li S, Rouphael N, Duraisingham S, Romero-Steiner S, Presnell S, Davis C, Schmidt DS, Johnson SE, Milton A, Rajam G, et al: Molecular signatures of antibody responses derived from a systems biology study of five human vaccines. Nat Immunol 2014) to find target cell populations which can then be investigated in much more detail.

      It shows that studying PBMC recall responses after peptide stimulation post final vaccination is not the way forward, since no response is detected (Figure 2). future studies can now take an alternative approach. e.g. since unstimulated PBMCs (vehicle control) from RTS,S vaccinated children were different from those who received a comparator vaccine (Figure 2) RTS,S vaccine signatures could be picked up much more easily by whole blood RNAseq.

      It implicates innate immune cells in shaping an individuals response to a vaccine - an exciting basis for future functional and mechanistic studies.

      We are glad the reviewer appreciates the value of the study.

      Reviewer #2 (Public Review):

      This paper reports a sub-study of the RTS,S/AS01 malaria vaccine Phase 3 trial, which aimed to identify groups of genes (blood transcriptional modules, BTMs) for which expression in DMSO or antigen-stimulated PBMCs was associated with clinical malaria during a 12-month follow-up period. Study subjects were infants and children who received either RTS,S/AS01 or comparator vaccines (meningococcal C for infants, rabies vaccine for children), enrolled in the study in Tanzania and Mozambique (with some additional analyses using samples from Gabonese infants).

      Using PBMCs collected at baseline before vaccination and 3 months later (a month after the third vaccine dose), stimulated with DMSO or parasite antigens, the authors used RNA-sequencing to identify BTMs which were different between recipients of RTS,S/AS01 vs comparator vaccines; which were different between baseline and month 3 in RTS,S/AS01 recipients; and which differed between RTS,S/AS01 recipients with a malaria episode and those without a malaria episode during the follow-up period. This combination of analyses might help to distinguish BTMs specifically associated with RTS,S/AS01 vaccine efficacy from those associated with other factors influencing susceptibility to malaria. To further aid mechanistic understanding the authors examined correlations between BTMs and measures of cellular and humoral immune responses. To try to establish generalisability the authors examined whether BTMs identified in African children were also associated with developing malaria in RTS,S/AS01-vaccinated malaria-naïve adults in the United States who underwent controlled human malaria infection (CHMI).

      Strengths of the study include:

      1) The relatively large number of subjects, the large amount of transcriptomic and immunological data which has been generated (and made publicly accessible), and the extensive analysis to evaluate associations between BTMs and numerous immunological variables.

      2) Clear explanation of both the rationale and methods for most of the analyses

      3) The attempt to validate findings in the CHMI studies

      4) Matching of subjects to try to eliminate the confounding effects of age, study site, and time of vaccination

      Weaknesses of the study include:

      1) Despite the relatively large size of the study, it is hard to know whether it had sufficient power to achieve its main objective, and we are not presented with data to demonstrate how successfully the authors managed to match subjects for age, timing of vaccination and follow-up duration

      We have added the following to our “limitations” paragraph in the Discussion: “Fourth, despite the relatively large size of the study, our statistical power was limited by the number of malaria cases with available samples; sampling additional controls would not have increased our statistical power.”

      Moreover, we now also provide the new Supplementary Table 1, which provides complete information on participant match ID, site, age cohort, sex assigned at birth, and time of vaccination.

      2) The comparator group to the RTS,S/AS01 vaccine is not a single vaccine, but two vaccines, but the presentation of the data makes it difficult to identify what effect this may have had on the results

      Indeed, comparators received a rabies vaccine or the meningococcal C conjugate depending on the age cohort. However, we think that the impact on the study results and conclusions is minimal since the main results are based on baseline gene expression and its association with malaria risk within RTS,S vaccinees. Correlates of malaria risk in comparators are done separately. Comparator vaccination may be a confounding factor for age cohort, but we are not analyzing the effect of age cohort on the transcriptional profile. Comparators are only included in the analysis of RTS,S immunogenicity at post-vaccination (RTS,S vs Comparators, Fig 2A, Comparison (1)) and we have adjusted analyses by age cohort and hence by comparator vaccine. The fact that the comparators received different control vaccines only stresses that the BTMs found to be associated with RTS,S vaccination are specific to the RTS,S vaccine.

      Moreover, as an alternative way to identify RTS,S-specific transcriptional responses, we also include Comparison (2), which compares Month 3 to Month 0 transcription levels within RTS,S vaccinees. We include in the text extensive discussion of the merits and drawbacks of each comparison:

      “Two comparisons were done to characterize the transcriptional response to RTS,S/AS01 vaccination: Comparison (1): comparing gene expression in month 3 samples from RTS,S/AS01 vs comparator recipients (month 3 RTS,S/AS01 vs comparator); and Comparison (2): comparing gene expression in month 3 vs month 0 from RTS,S/AS01 recipients (RTS,S/AS01 month 3 vs month 0). Each comparison has its own advantages: Comparison (1) allows the identification of RTS,S/AS01-specific responses while taking into account other environmental factors to which the children are exposed, such as malaria exposure (albeit malaria transmission intensity was low during the study at both sites). Moreover, the very young ages of the trial participants mean that RTS,S/AS01-induced changes may be confounded with normal developmental changes in participant immune systems, further underscoring the value of Comparison (1), as it does not involve comparison across two different time points. On the other side, an advantage of Comparison (2) is that it takes into consideration each participant’s intrinsic baseline gene expression. Comparison (1) uses data from both infants and children, whereas Comparison (2) can only yield insight into RTS,S/AS01 responses in children (as baseline samples were not collected from infants).”

      3) A very "liberal" false-discovery rate (FDR) threshold has been used throughout to define significant associations. An FDR of 0.2 indicates that 20% (or 1 in 5) results which are considered significant will be false-discoveries. This means that the "significant" results must be interpreted with a high degree of caution. Typically researchers use lower FDR thresholds, like 0.05 or 0.01, although one may argue for different thresholds under different circumstances

      While it is not uncommon to use a threshold of 20% for immune correlates studies [e.g. (5-10)], we agree with you that it is important to clearly state the chosen FDR rate and to discuss conclusions in the context of the FDR rate used. We see we could improve our manuscript in this respect. We have added the following:

      Results: “Compared to the 45 BTMs whose baseline levels significantly associated with clinical malaria risk in RTS,S/AS01-vaccinated African children, fewer BTMs (seven) had levels at one month post-final RTS,S/AS01 dose that significantly associated with clinical malaria risk. Moreover, if a more stringent FDR cutoff had been used (i.e. 5%), six of these seven BTMs would not have been identified. Thus it is entirely possible that, at one month post-final RTS,S/AS01 dose, there is no circulating immune transcriptomic signature predictive of risk…”

      Discussion: “Finally, while it is not uncommon to use an FDR cutoff of 20% in high-dimensional immune correlates studies [e.g. (65-70)], our results should be interpreted with the requisite level of caution. However, we do note that many of our significant modules in the baseline risk analysis would have survived even lower FDR cutoffs (in many cases even a 1% cutoff), giving us a fair degree of confidence in our results. For example, of the seven monocyte-related BTMs whose baseline levels associated with risk, all would have survived a 5% FDR cut-off, and three even a 1% cut-off; likewise, of the four dendritic cell-related BTMs whose baseline levels associated with risk, all would have survived a 5% FDR cut-off, and three even a 1% cut-off.”

      Moreover, we have revised Figures 2, 3, and 6 so that it is easy to discern whether a specific BTM correlation would also pass more stringent FDR cutoffs, through the addition of 1, 2, or 3 asterisks where appropriate: “|FDR| < 0.2 (), < 0.05 (), < 0.01 ().” Note that, most central to the key message of the paper, many of the monocyte-related, DC-related, and cell cycle-related BTMs would have passed more stringent FDR cutoffs, with many even passing a 1% FDR cutoff (as discussed above).

      4) A perplexing finding, which is not addressed in detail, is the large number of BTMs which differ between RTS,S and comparator vaccine groups after DMSO stimulation of PBMCs, but these are not seen when PBMCs are stimulated with parasite antigens in DMSO (and a similar finding for month 3 vs month 0 samples from RTS,S recipients). This raises some concern about the stimulation experiments, because one might expect that the DMSO vehicle in the antigen preparations would trigger a similar response to DMSO alone.

      It should be noted that in all our analyses, the stimulated results were adjusted for DMSO to focus on the antigen-specific response only. This would explain why we detect signal in the DMSO samples but not in response to stimulation. We have realized that this was not very well described in the figure captions and the Methods section and have added more details, including the model description in Methods section. As such, we do not believe that these results impact all downstream conclusions. We believe that the unstimulated results provide significant new insights into the immune and molecular mechanisms of RTS,S vaccine efficacy, not necessarily directly related to the RTS,S-specific acquired immune response. We would also like to highlight the fact that we have improved our model specification to directly account for the pairing of some of the samples using a random effect using the limma package. This has slightly increased statistical power, and as such the number of significantly differentially expressed BTMs in response to stimulation is a bit higher (but still much less than that for the DMSO). Originally, we had decided against the use of a random effect due to the computational cost of estimating the random effect.

      The fact that bulk transcriptional profiling of Ag-stimulated PBMCs did not identify almost any significant differences in BTM expression between the RTS,S vs. comparator group could be due to several factors. First of all, the frequency of antigen-specific CD4+ T cells was very low among CD4+ T cells (Figure 4 of the manuscript shows that CSP-specific CD4+ T cells comprise < 0.004% of all CD4+ T cells). This low frequency of CSP-specific T cells is consistent with other RTS,S studies [e.g. as we state on line 330, we have previously found that CSP-specific T-cells in RTS,S/AS01 vaccinees comprise < 0.10% of all CD4+ T cells (1)].

      Moreover, CD4+ T cells themselves comprise approximately 45-57% of all PBMCs (2). Thus, finding an expression signal between the RTS,S vs. comparator group would require the signal to be high enough to be detected in only 0.002% of all PBMCs [0.004% (% CSP-specific CD4+ T cells out of total CD4+ T cells) x 51% (average % of CD4+ T cells out of all PBMCs) = 0.002%]. Thus, lack of detectable recall response does not mean lack of recall response. Moreover, as suggested below, we opted not to focus the rest of the manuscript on the Ag-stimulation results.

      Second of all, the PBMCs were stimulated on site for 12h and then cryopreserved. This stimulation time was chosen based on the kinetics of IFN-g and IL-2 mRNA response (3), but other responses may have had different kinetics and thus have already resolved or have not yet occurred by the 12-h cryopreservation. We have added text in the manuscript to discuss these caveats (“Another potential reason for why no BTMs were found to associate with the response to RTS,S/AS01 vaccination or with protection when analyzing CSP-stimulated PBMC is that all PBMC were stimulated on site for 12 hours (this stimulation time was chosen based on the kinetics of the IFN-g transcriptional response) and then cryopreserved. Thus, we were unable to detect earlier transient responses that had already resolved by 12 hours, as well as more delayed response that had not yet initiated by 12 hours, if such responses occurred.”.

      The authors partly achieved their aims. They identified BTMs differentially expressed between RTS,S/AS01 and the comparator vaccines, and between baseline and month 3 in RTS,S/AS01 recipients. They also identified BTMs at month 3 associated with developing malaria, and BTMs at baseline associated with developing malaria. These latter BTMs were partly replicated in the CHMI study subjects. Higher expression of BTMs associated with monocytes and dendritic cells were most consistently identified across the different analyses and their expression in stimulated baseline samples was most consistently associated with development of clinical malaria in RTS,S/AS01 recipients. However there were inconsistencies in associations between some of the studies, and it is possible that the "consistent" monocyte and dendritic cell BTMs would not be so consistent if a more stringent FDR threshold was used. However the authors conclusions are largely quite measured and for the most part they do not over-interpret the significance of their findings.

      We have added the following to the Discussion: “Finally, while it is not uncommon to use an FDR cutoff of 20% in high-dimensional immune correlates studies [e.g. (65-70)], our results should be interpreted with the requisite level of caution. However, we do note that many of our significant modules in the baseline risk analysis would have survived even lower FDR cutoffs (in many cases even a 1% cutoff), giving us a fair degree of confidence in our results. For example, of the seven monocyte-related BTMs whose baseline levels associated with risk, all would have survived a 5% FDR cut-off, and three even a 1% cut-off; likewise, of the four dendritic cell-related BTMs whose baseline levels associated with risk, all would have survived a 5% FDR cut-off, and three even a 1% cut-off.”

      Overall the work provides some evidence that baseline immunological status, particularly related to monocyte and dendritic cell responses and possibly their role in or response to baseline inflammation, may be a determinant of how well the RTS,S vaccine works to prevent malaria. This provides a basis for further work to optimise the effectiveness of the vaccine. The usefulness of PBMC stimulation to predict an individual's response to vaccination will be limited because this is not a method which can be used at scale in resource limited settings, but the concept that vaccine response could be enhanced by modifying pre-vaccine immunological or inflammatory status is potentially important. The data published with this study will be a valuable resource and will undoubtedly be used by others to address similar questions. Increasing the efficacy of malaria vaccines remains an extremely important goal, and identifying possible mechanisms which restrict the efficacy of RTS,S is important.

      References:

      1. Moncunill G, De Rosa SC, Ayestaran A, Nhabomba AJ, Mpina M, Cohen KW, Jairoce C, Rutishauser T, Campo JJ, Harezlak J, Sanz H, Diez-Padrisa N, Williams NA, Morris D, Aponte JJ, Valim C, Daubenberger C, Dobano C, McElrath MJ. RTS,S/AS01E Malaria Vaccine Induces Memory and Polyfunctional T Cell Responses in a Pediatric African Phase III Trial. Front Immunol. 2017;8:1008.
      2. Kleiveland CR. Peripheral Blood Mononuclear Cells. In: Verhoeckx K, Cotter P, López-Expósito I, Kleiveland C, Lea T, Mackie A, et al., editors. The Impact of Food Bioactives on Health: in vitro and ex vivo models. Cham: Springer International Publishing; 2015. p. 161-7.
      3. Schultz-Thater E, Frey DM, Margelli D, Raafat N, Feder-Mengus C, Spagnoli GC, Zajac P. Whole blood assessment of antigen specific cellular immune response by real time quantitative PCR: a versatile monitoring and discovery tool. J Transl Med. 2008;6:58.
      4. Kazmin D, Nakaya HI, Lee EK, Johnson MJ, van der Most R, van den Berg RA, Ballou WR, Jongert E, Wille-Reece U, Ockenhouse C, Aderem A, Zak DE, Sadoff J, Hendriks J, Wrammert J, Ahmed R, Pulendran B. Systems analysis of protective immune responses to RTS,S malaria vaccination in humans. Proc Natl Acad Sci U S A. 2017;114(9):2425-30.
      5. Liu C, Martins AJ, Lau WW, Rachmaninoff N, Chen J, Imberti L, Mostaghimi D, Fink DL, Burbelo PD, Dobbs K, Delmonte OM, Bansal N, Failla L, Sottini A, Quiros-Roldan E, Han KL, Sellers BA, Cheung F, Sparks R, Chun TW, Moir S, Lionakis MS, Consortium NC, Clinicians C, Rossi C, Su HC, Kuhns DB, Cohen JI, Notarangelo LD, Tsang JS. Time-resolved systems immunology reveals a late juncture linked to fatal COVID-19. Cell. 2021;184(7):1836-57 e22.
      6. Andersen-Nissen E, Fiore-Gartland A, Ballweber Fleming L, Carpp LN, Naidoo AF, Harper MS, Voillet V, Grunenberg N, Laher F, Innes C, Bekker LG, Kublin JG, Huang Y, Ferrari G, Tomaras GD, Gray G, Gilbert PB, McElrath MJ. Innate immune signatures to a partially-efficacious HIV vaccine predict correlates of HIV-1 infection risk. PLoS Pathog. 2021;17(3):e1009363.
      7. Lu P, Guerin DJ, Lin S, Chaudhury S, Ackerman ME, Bolton DL, Wallqvist A. Immunoprofiling Correlates of Protection Against SHIV Infection in Adjuvanted HIV-1 Pox-Protein Vaccinated Rhesus Macaques. Front Immunol. 2021;12:625030.
      8. Haynes BF, Gilbert PB, McElrath MJ, Zolla-Pazner S, Tomaras GD, Alam SM, Evans DT, Montefiori DC, Karnasuta C, Sutthent R, Liao HX, DeVico AL, Lewis GK, Williams C, Pinter A, Fong Y, Janes H, DeCamp A, Huang Y, Rao M, Billings E, Karasavvas N, Robb ML, Ngauy V, de Souza MS, Paris R, Ferrari G, Bailer RT, Soderberg KA, Andrews C, Berman PW, Frahm N, De Rosa SC, Alpert MD, Yates NL, Shen X, Koup RA, Pitisuttithum P, Kaewkungwal J, Nitayaphan S, Rerks-Ngarm S, Michael NL, Kim JH. Immune-correlates analysis of an HIV-1 vaccine efficacy trial. N Engl J Med. 2012;366(14):1275-86.
      9. Fletcher HA, Snowden MA, Landry B, Rida W, Satti I, Harris SA, Matsumiya M, Tanner R, O'Shea MK, Dheenadhayalan V, Bogardus L, Stockdale L, Marsay L, Chomka A, Harrington-Kandt R, Manjaly-Thomas ZR, Naranbhai V, Stylianou E, Darboe F, Penn-Nicholson A, Nemes E, Hatherill M, Hussey G, Mahomed H, Tameris M, McClain JB, Evans TG, Hanekom WA, Scriba TJ, McShane H. T-cell activation is an immune correlate of risk in BCG vaccinated infants. Nat Commun. 2016;7:11290.
      10. Young WC, Carpp LN, Chaudhury S, Regules JA, Bergmann-Leitner ES, Ockenhouse C, Wille-Reece U, deCamp AC, Hughes E, Mahoney C, Pallikkuth S, Pahwa S, Dennison SM, Mudrak SV, Alam SM, Seaton KE, Spreng RL, Fallon J, Michell A, Ulloa-Montoya F, Coccia M, Jongert E, Alter G, Tomaras GD, Gottardo R. Comprehensive Data Integration Approach to Assess Immune Responses and Correlates of RTS,S/AS01-Mediated Protection From Malaria Infection in Controlled Human Malaria Infection Trials. Front Big Data. 2021;4:672460.
    1. SciScore for 10.1101/2021.11.15.21265879: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: Prior to the collection of samples, authorization for the entry of field personnel was coordinated with those responsible for markets, supermarkets, banking agencies and transport units in each district.<br>IRB: Ethical aspects: The study protocol was reviewed and approved by the INS Institutional Research Ethics Committee with the code OI-034-20.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero-E6 cells were cultured in DMEM (Dulbecco’s Modified Eagles Medium) culture medium supplemented with streptomycin 100 mg/L, ampicillin 25 mg/L, 20% inactivated fetal bovine serum (SFB) and kept at 37 °C in a humid atmosphere of 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Analysis of data: The information registered in data collection sheets, as well as the results of the molecular tests were entered into an Excel database.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Excel</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The analysis was carried out in the statistical program SPSS V25.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SPSS</div><div>suggested: (SPSS, RRID:SCR_002865)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      The study also has limitations, such as that the collection of samples was carried out in the months of November and December, a period in which the number of new cases was less than 1,000 in Lima, Peru, according to the National Center for Epidemiology, Prevention and Control of Diseases. It is important to indicate that the World Health Organization mentions that the biological basis for the possibility of infection through contact with surfaces and food is related to fomites, which is still considered a concept with contradictory evidence (27). Furthermore, the study was carried out only in districts of Lima, Peru, and not in other regions of the country; however, it should be considered that these districts were the ones that showed the highest number of infections in the most critical period of the pandemic in Peru. Another limitation, is the lower isolation of virus from samples with higher Ct value, Ct > 31 by RT-PCR method. The rt-PCR Ct value correlate strongly with cultivable virus and likelihood of infectiosness, In this sense, a higher number of positive samples, will offer us the probability of a greater number of virus isolation (11). An additional aspect to consider is that, in the study period, frequent cleaning of the surfaces to be studied was observed, which could have had an impact triggering lower possibilities of obtaining positive results, but not on the elimination of their detection as has been described in previous experiences (23). Peru has been one...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Author Response:

      Reviewer #1:

      Reviewer 1 expresses some concerns regarding concentrations of soluble proteins during our experiments. This is a good point and, in response, we are rewriting the manuscript to more clearly describe the metastable nature of the soluble protein pool. The key feature of our reaction mixture is that it contains both profilin and capping protein, which work together to suppress filament assembly. Spontaneously nucleated filaments are rapidly capped at their barbed ends. Profilin then effectively prevents elongation from the pointed ends of these filaments and they disassemble. We will cite relevant work that establishes and discusses these synergistic activities. Young et al. (1990) found that factors that cap >90% of filament barbed ends increase the critical concentration from that of the barbed end to that of the pointed end, and several groups demonstrated that profilin and barbed-end capping proteins work together to suppress filament assembly and promote disassembly of filaments with free pointed ends (e.g. DeNubile, 1985; Blanchoin, 2000; Pernier, 2016). This combination produces a large pool of monomeric actin that is capable of transiently elongating any newly formed barbed ends. We previously described this pool as ‘metastable’ (Pollard, 2000) while others have described it as ‘dynamically stable’ (Pernier, 2016). Only the branched actin networks formed by the micro-patterned nucleation promoting factors have an appreciable lifetime and consume a significant fraction of the soluble proteins, because filaments can only be formed by continual rounds of nucleation and only remain stable when their pointed ends are capped by the Arp2/3 complex (Blanchoin, 2000). In addition, the total amount of protein incorporated into the micro-patterned branched networks is only a small fraction of the total protein present in the reaction mix. This is demonstrated by the fact that the network growth rate is constant over the course of each experiment. We will mention this in the revised manuscript and provide the following simple calculation to emphasize this point: The concentration of actin in our reaction mixes is 5 µM, with a total volume of 150 µl. The maximum concentration of actin in our networks is 1.25 mM, but the maximum total volume of these networks is only <0.002 µl (based on a total of 400 WAVE1 patches with an average area of 50 µm^2, generating networks with a maximum height of <100 µm). The fraction of actin used up during an experiment, therefore, is less than 0.3%.

      REFERENCES:

      Blanchoin L, Pollard TD, Mullins RD. (2000) Interactions of ADF/cofilin, Arp2/3 complex, capping protein and profilin in remodeling of branched actin filament networks. Curr Biol. 10(20):1273-82.

      DeNubile MJ, Southwick FS. (1985)Effects of Macrophage Profilin on Actin in the Presence and Absence of Acumentin and Gelsolin J. Biol. Chem. 260(12):7402-7409.

      Pernier J, Shekhar S, Jegou A, Guichard B, Carlier MF. (2016) Profilin Interaction with Actin Filament Barbed End Controls Dynamic Instability, Capping, Branching, and Motility. Dev Cell. 36(2):201-14.

      Young CL, Southwick FS, Weber A. (1990) Kinetics of the Interaction of a 41-Kilodalton Macrophage Capping Protein with Actin: Promotion of Nucleation during Prolongation of the Lag Period. Biochemistry, 29:2232-2240.

      Reviewer #2:

      Reviewer #2’s comments about the molecular mechanism underlying the force-induced increase in free barbed ends make it clear that our explanation was not as clear as it should have been. We will provide more detailed derivations for our mathematical methods, but in the meantime, we hope that the following explanation will clear up any misunderstanding.

      Reviewer 2 rightly notes that “…for both capping and branching, the authors find that they decrease the same way with increasing loads - as they should: this is imposed by their being at steady state, where the birth rate of growing barbed ends (branching) must match their death rate (capping).” This steady state condition is actually the starting point for our analysis. At steady state the overall rates of nucleation and capping must be equal (Rcapping = Rnucleation). Importantly, the overall rate of nucleation is a complicated function that depends on the occupancy of the WH2 domains, the surface-associated Arp2/3 complex, and the local density of polymeric actin. On the other hand filament capping in our system appears to be a simple bimolecular interaction between soluble capping protein and free barbed ends. We demonstrated this by showing that the average filament length (i.e. the ratio of polymeric actin to capping protein in the growing network) varies as a simple inverse function of the capping protein concentration. This means that the overall rate of nucleation (Rnucleation) must equal the product of the capping protein concentration ([CP]), the surface density of free barbed ends (E), and an appropriate capping rate constant (kc). This yields,

      kc[CP]E = Rnucleation

      Which can be rearranged to give the density of free barbed ends,

      E = Rnucleation/(kc*[CP])

      As the reviewer notes, this equation describes a density, not a unitless number. Note that a sudden decrease in per-filament capping rate (e.g. a decrease in the rate constant, kc) with no change in overall nucleation rate will cause the number of free barbed ends to increase until the overall rate of capping (kc[CP]E) once again matches the overall rate of nucleation. This equation is an “iron law” imposed by the steady-state (or quasi-steady state) character of the system, and it means that any increase in the density of free barbed ends must reflect EITHER an increase in the overall rate of nucleation OR a decrease in the per-filament capping rate (or possibly both). Our direct measurements of the overall nucleation rate (the quantity in the numerator) rule out the first possibility, meaning that the per-filament capping rate MUST go down with applied force. Furthermore, our measurements demonstrate that this capping rate displays the same force sensitivity as actin filament elongation. The best explanation for this phenomenon is that the insertion of a capping protein onto a filament barbed end is subject to the same constraints as the insertion of an actin monomer. This could have been predicted from Brownian Ratchet theory, but as the reviewer points out, it was not. Our “bulky capping protein” experiments are a direct test of whether Brownian Ratchet theory can account for the force sensitivity of filament capping, and they demonstrate that it can.

      In summary, we stand by our original explanation, namely that applied forces cause a decrease in the rate at which individual filaments are capped (via a change in the rate constant for filament capping, kc). This decrease, which can be explained by Brownian Ratchet Theory, leads directly to an increase in the steady-state barbed end density.

    1. SciScore for 10.1101/2021.11.08.21266035: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Study protocols were approved by the Central Adelaide Clinical Human Research Ethics Committee (#13050) and the Women’s and Children’s Health Network Human research ethics (protocol HREC/19/WCHN/65), Adelaide, Australia.<br>Consent: All participants provided written informed consent in accordance with the Declaration of Helsinki and procedures were carried out following the approved guidelines.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">In this study, whole blood specimens from 43 participants (19 male, 24 female) of (95% CI, 44.8-55.4) years of age (figure S1) who presented mild COVID-19 symptoms according to NIH guidelines (https://www.covid19treatmentguidelines.nih.gov/overview/clinical-spectrum/) were sampled and processed at two time points 6 months apart after PCR positive test.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">Randomisation: Since all samples that were available in South Australia were used in the study, no randomisation was performed in the experiments.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">Blinding: No experiments were blinded in this study.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">Statistics, replicates and sample-size estimation: All mild-COVID-19 patient samples available at the time points reported in the study from the South Australian cohort (n=43) were used in this study and, therefore, no pre hoc power calculations were carried out to determine the sample size.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Secondary antibodies were diluted in 5% skim milk in PBST as follows: Goat anti-Human IgG (H+L) Secondary Antibody, HRP (1:30,000;</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Human IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Goat anti-human IgA HRP antibody (1:5,000; Sigma) and incubated for 1 hour at room temperature, followed by four washes with PBS-T.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgA</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were pre-treated with 0.555 µg/mL of anti-CD40 blocking antibody (HB14, Miltenyi Biotec) for 15 min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-CD40</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Recombinant proteins were overexpressed in Expi293 cells (Thermo Fisher) and 72 hrs later purified by Ni-NTA affinity and size-exclusion chromatography.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Expi293</div><div>suggested: RRID:CVCL_D615)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">36 In brief, SARS-CoV-2 pseudo-particles were generated by co-transfecting expression plasmids containing SARS-CoV-2 Spike (kindly provided by Dr Markus Hoffmann)37 and the MLV gag/pol and luciferase vectors (kindly provided by Prof. Francois-Loic Cosset)38,39 in CD81KO 293T cells (kindly provided by Dr Joe Grove),40 using mammalian Calphos transfection kit (Takara Bio)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: CCLV Cat# CCLV-RIE 1018, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">41 293T-ACE2 cells were seeded 24 h earlier at 1.5 × 104 cells per well in 96-well white flat-bottom plates (Sigma-Aldrich).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were washed, resuspended in FACS wash buffer and the data acquired on BD FACSAria™ III.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BD FACSAria™</div><div>suggested: (BD FACSAria II Cell Sorter, RRID:SCR_018934)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data analysis was performed using FlowJo version 10.7.1 (TreeStar).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">36 ID50 for serum was calculated using a non-linear regression model (GraphPad Prism).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All statistical analyses were performed using GraphPad Prism 9.0.0 (San Diego, CA, US).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      One caveat of these studies is that high rates of transmission of SARS-CoV-2 in the communities where the studies were conducted (e.g. Italy, UK or USA) increased the likelihood of virus re-exposure in that cohort, precluding the ability to draw firm conclusions on the duration and protective effects of primary SARS-CoV-2 immunity. Controlled, in-depth studies in convalescents have also been conducted, but vaccination and almost ubiquitous high SARS-CoV-2 infection rates have reduced the opportunities to recruit convalescents long after COVID-19 disease, and importantly, in the absence of re-infection. Conversely, vaccination programs allow for more controlled studies and deeper immune analysis and facilitate conducting experimental procedures to test immune fitness against VoC. However, to date, the majority of vaccinees have received Spike-based vaccines, which are not well-suited as a proxy for what SARS-CoV-2 immunity may look like in the long-term, or its adaptability to VoC. Here, we have taken advantage of the relatively unique situation in South Australia, where local transmission of SARS-CoV-2 was eliminated early on in the pandemic in 2020, enabling us to conduct a 12-month longitudinal study of SARS-CoV-2 immunity in mild-COVID-19 convalescents and test their immune fitness against the current VoC. Total RBD IgG titers and other circulating Ig isotypes against SARS-CoV-2 Spike and RBD antigens decrease over the months following COVID-19 disease, with the strongest ...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.11.08.21266069: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: This study was also approved by Yale Human Research Protection Program Institutional Review Boards (FWA00002571, protocol ID 2000027690, 2000029277).<br>Consent: Informed consent was obtained from both the patient and healthcare workers</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Contamination: The cell line was obtained from the ATCC and has been tested negative for contamination with mycoplasma.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Flow cytometry: As described previously, antibody clones and vendors used for flow cytometry analysis were as follows: BB515 anti-hHLA-DR (G46-6) (1:400</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-hHLA-DR ( G46-6 )</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were washed three times with PBS-T (PBS with 0.1% Tween-20) and 50 μl of HRP anti-Human IgG Antibody (GenScript #A00166, 1:5,000) diluted in dilution solution added to each well.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Human IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Diluted NP samples were added on a monolayer of Vero E6 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">15 μg of each mutant transcript was electroporated into BHK cells using the Electro Square Porator Device (BTX)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK</div><div>suggested: RRID:CVCL_HA32)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Electroporated cells were seeded into a T75 flask containing 1:2 ratio of BHK-N:Vero-E6 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK-N:Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Replication kinetics of icSARS-CoV-2 mutants: Isolates from initial stocks were expanded and used to infect Vero-E6 cells with 0.01 MOI of each E802D and E802A mutant virus to assess their replication kinetics.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">This study was also approved by Yale Human Research Protection Program Institutional Review Boards (FWA00002571, protocol ID 2000027690, 2000029277).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Yale Human Research Protection Program</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Variants were examined longitudinally with a modified Python script adapted from LAVA (https://github.com/greninger-lab/lava).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were analysed using FlowJo software version 10.6 software (Tree Star).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Walter, E. B., Talaat, K. R., Sabharwal, C., Gurtman, A., Lockhart, S., Paulsen, G. C., Barnett, E. D., Muñoz, F. M., Maldonado, Y., Pahud, B. A., Domachowske, J. B., Simões, E. A. F., Sarwar, U. N., Kitchin, N., Cunliffe, L., Rojo, P., Kuchar, E., Rämet, M., Munjal, I., … Gruber, W. C. (2021). Evaluation of the BNT162b2 Covid-19 Vaccine in Children 5 to 11 Years of Age. New England Journal of Medicine, NEJMoa2116298. https://doi.org/10.1056/NEJMoa2116298

    2. BACKGROUNDSafe, effective vaccines against coronavirus disease 2019 (Covid-19) are urgently needed in children younger than 12 years of age.METHODSA phase 1, dose-finding study and an ongoing phase 2–3 randomized trial are being conducted to investigate the safety, immunogenicity, and efficacy of two doses of the BNT162b2 vaccine administered 21 days apart in children 6 months to 11 years of age. We present results for 5-to-11-year-old children. In the phase 2–3 trial, participants were randomly assigned in a 2:1 ratio to receive two doses of either the BNT162b2 vaccine at the dose level identified during the open-label phase 1 study or placebo. Immune responses 1 month after the second dose of BNT162b2 were immunologically bridged to those in 16-to-25-year-olds from the pivotal trial of two 30-μg doses of BNT162b2. Vaccine efficacy against Covid-19 at 7 days or more after the second dose was assessed.RESULTSDuring the phase 1 study, a total of 48 children 5 to 11 years of age received 10 μg, 20 μg, or 30 μg of the BNT162b2 vaccine (16 children at each dose level). On the basis of reactogenicity and immunogenicity, a dose level of 10 μg was selected for further study. In the phase 2–3 trial, a total of 2268 children were randomly as-signed to receive the BNT162b2 vaccine (1517 children) or placebo (751 children). At data cutoff, the median follow-up was 2.3 months. In the 5-to-11-year-olds, as in other age groups, the BNT162b2 vaccine had a favorable safety profile. No vaccine-related serious adverse events were noted. One month after the second dose, the geometric mean ratio of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) neutralizing titers in 5-to-11-year-olds to those in 16-to-25-year-olds was 1.04 (95% confidence interval [CI], 0.93 to 1.18), a ratio meeting the pre-specified immunogenicity success criterion (lower bound of two-sided 95% CI, >0.67; geometric mean ratio point estimate, ≥0.8). Covid-19 with onset 7 days or more after the second dose was reported in three recipients of the BNT162b2 vac-cine and in 16 placebo recipients (vaccine efficacy, 90.7%; 95% CI, 67.7 to 98.3).CONCLUSIONSA Covid-19 vaccination regimen consisting of two 10-μg doses of BNT162b2 ad-ministered 21 days apart was found to be safe, immunogenic, and efficacious in children 5 to 11 years of age. (Funded by BioNTech and Pfizer; ClinicalTrials.gov number, NCT04816643.)A B S T R A C T Evaluation of the BNT162b2 Covid-19 Vaccine in Children 5 to 11 Years of AgeE.B. Walter, K.R. Talaat, C. Sabharwal, A. Gurtman, S. Lockhart, G.C. Paulsen, E.D. Barnett, F.M. Muñoz, Y. Maldonado, B.A. Pahud, J.B. Domachowske, E.A.F. Simões, U.N. Sarwar, N. Kitchin, L. Cunliffe, P. Rojo, E. Kuchar, M. Rämet, I. Munjal, J.L. Perez, R.W. Frenck, Jr., E. Lagkadinou, K.A. Swanson, H. Ma, X. Xu, K. Koury, S. Mather, T.J. Belanger, D. Cooper, Ö. Türeci, P.R. Dormitzer, U. Şahin, K.U. Jansen, and W.C. Gruber, for the C4591007 Clinical Trial Group*
    1. not only in Finland

      digital inequality during the pandemic is an issue not only in Finland, but also in the Netherlands https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7446757/ van Deursen, A. J. (2020). Digital Inequality During a Pandemic: Quantitative Study of Differences in COVID-19–Related Internet Uses and Outcomes Among the General Population. Journal of Medical Internet Research, 22(8), e20073. https://doi.org/10.2196/20073

      Katz, V. S., Jordan, A. B., & Ognyanova, K. (2021). Digital inequality, faculty communication, and remote learning experiences during the COVID-19 pandemic: A survey of U.S. undergraduates. PloS One, 16(2), e0246641. https://doi.org/10.1371/journal.pone.0246641

      Covid-19 is increasing digital inequality: We need human connectivity to close the digital divide. (2020, April 13). Oxford Law Faculty. https://www.law.ox.ac.uk/research-and-subject-groups/oxfordshire-digital-inclusion-project/blog/2020/04/covid-19-increasing

      Covid-19 is increasing digital inequality: We need human connectivity to close the digital divide. (2020, April 13). Oxford Law Faculty. https://www.law.ox.ac.uk/research-and-subject-groups/oxfordshire-digital-inclusion-project/blog/2020/04/covid-19-increasing

      Burgess, G. (2020, August 13). Beyond the pandemic: Tackle the digital divide. University of Cambridge. https://www.cam.ac.uk/stories/BeyondThePandemic_digitaldivide

      Robinson, L., & Schulz, J. (2020). Digital inequalities in time of pandemic: COVID-19 exposure risk profiles and new forms of vulnerability | First Monday. First Monday, 25(7). https://doi.org/10.5210/fm.v25i7.10845

    1. SciScore for 10.1101/2021.11.04.21265948: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: The protocol was approved by the Oregon Health and Science University Institutional Review Board (OHSU IRB# 21230).<br>Consent: All participants gave written informed consent before enrolling in the study.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plates were washed 3 times with wash buffer and 100 μL of 1:3000 dilution of anti-human IgG (H+L) HRP (Novus, NBP1-73319) detection antibody was added and incubated at RT for 1 hour.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: (Novus Cat# NBP1-73319, RRID:AB_11029224)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For subjects with low frequency of antigen-specific antibody secreting cells frequency was determined by number of positive wells divided by the total number of IgG positive secreting wells, multiplied by one million, giving a frequency per million PBMCs stimulated.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antigen-specific</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were incubated at room temperature (RT) for 1 hour, washed 4 times with wash buffer, and 50 uL of 1:3000 dilution of anti-human IgG-HRP (BD Pharmingen, 555788) detection antibody was added and incubated at RT for 1 hour.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG-HRP</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data was acquired on an LSR Fortessa (Becton Dickenson) and analyzed using FlowJo software (Becton Dickenson).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Study limitations include a small sample size and lack of long-term follow up to identify long-lived humoral response. None of the 16 subjects enrolled in this study tested positive for SARS-CoV-2 prior to enrollment in the study/vaccination, however, although testing for prior infection via evaluation of RBD antibodies in the serum was performed prior to vaccination in 12 of the 16 subjects, evaluation and anti-nucleocapsid antibodies which is more specific for prior infection was not performed in any subjects. Long-term clinical outcomes to evaluate vaccine efficacy in relation to vaccine response is also needed. In conclusion, the results of this study provide a thorough evaluation of the humoral and cellular immune response to initial 2-dose mRNA COVID-19 vaccine series in CLL patients. Our results highlight the limitations of serology studies alone in defining vaccine-mediated immune responses, particularly in this immune-dysregulated patient population. Larger longitudinal studies which incorporate clinical outcomes in vaccinated CLL patients as well as study the impact of a third, booster or heterologous vaccine are needed.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. they can “geek out” together by swapping ideas, techniques and critiques related to projects that tap their deepest interests and aspirations (Ito et al., 2009Ito, M., Baumer, S., Bittanti, M., boyd, danah, Cody, R., Herr-Stephenson, B., … Tripp, L. (2009). Hanging out, messing around, and geeking out: Kids living and learning with new media. Cambridge, MA: MIT Press. [Google Scholar]).

      Geeking out leads to incredibly versatile affinity members within a short period of time.

    1. D'altra parte, il rifiuto di consentire al genitore, cittadino di u n o Stato m e m b r o o di u n o Stato terzo, che effettivamente ha la custodia di u n figlio al quale l'art. 18 CE e la direttiva 9 0 / 3 6 4 riconoscono u n diritto di soggiorno di soggiornare con tale figlio nello Stato m e m b r o ospitante priverebbe di qualsiasi effetto utile il diritto di soggiorno di q u e s t ' u l t i m

      la svolta

    1. SciScore for 10.1101/2021.11.01.21265764: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">At the Integrated Research Facility (IRF) - Frederick, the virus was passaged by inoculating grivet kidney epithelial Vero cells (ATCC #CCL-81) at a multiplicity of infection (MOI) of 0.01 under high containment (BSL-3) conditions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: ATCC Cat# CCL-81, RRID:CVCL_0059)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The resulting viral seedstock was harvested and quantified by plaque assay using Vero E6 cells (ATCC #CRL-1586) with a 2.5% Avicel overlay and stained after 48 hours with a 0.2% crystal violet stain.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">ADAPT was then run on the S gene alignment with the following parameters: 35-65% GC content, max.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ADAPT</div><div>suggested: (ADAPT, RRID:SCR_006769)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Infected cells were incubated for 48 or 72 hours in Dulbecco’s Modified Eagle Medium with 4.5g/L D-glucose, L-glutamine, and 110 mg/L sodium pyruvate (DMEM, Gibco) containing 2% heat-inactivated fetal bovine serum (SAFC Biosciences) in a humidified atmosphere at 37°C with 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SAFC</div><div>suggested: (SAFC, RRID:SCR_008554)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Single-step SARS-CoV-2 SHINE reactions: RPA primer and crRNA optimizations were performed using the following SHINE conditions: 1X original SHINE buffer (20 mM HEPES pH 8.0 with 60 mM KCl and 3.5% PEG-8000), 45 nM LwaCas13a protein resuspended in 1X SB (such that the resuspended protein is at 2.26 µM), 125 nM polyU quenched FAM reporter, 2 mM of each rNTP, 1 U/µL murine RNase inhibitor, 1 U/µL NextGen T7 RNA polymerase, 0.1 U/µL RNase H (NEB), 2 U/µL Invitrogen SuperScript IV (SSIV) reverse transcriptase (Thermo Fisher Scientific), an assay specific concentration of forward and reverse RPA primers (detailed below), and 22.5 nM crRNA.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NextGen</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">BinaxNow COVID - 19 Antigen self-test - clinical samples: BinaxNow COVID-19 Antigen self-tests (Abbott) were purchased from Walmart.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Abbott</div><div>suggested: (Abbott, RRID:SCR_010477)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data panels were primarily generated using Prism 8 (GraphPad).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      SHINEv2 addresses these limitations. Lyophilization considerably simplifies the assay and facilitates its transportation and storage. SHINEv2 can be distributed overseas without a loss in performance. Moreover, the use of an equipment-free and ambient-temperature sample lysis method further increases the user-friendliness of the assay. SHINEv2 involves as few steps from the user as antigen-capture tests, while providing a 50-fold boost in sensitivity7,42,43. Importantly, SHINEv2 demonstrates perfect (100%) concordance with RT-qPCR, the gold standard for SARS-CoV-2 diagnosis, in samples with RNA levels above our analytical LoD of 200 copies/μL. This level of sensitivity could enable the detection of every potentially infectious individual, including those missed by antigen-capture tests10,46. SHINEv2 can accurately identify several clade-specific mutations in the Alpha, Beta, Gamma and Delta SARS-CoV-2 VOCs, and it can be rapidly adapted to respond to emerging viral variants as well as other viruses in current and future outbreaks. Thus, SHINEv2 can provide critical information to inform public health responses, and it fills a major gap in point-of-need diagnostics. At the population level, SHINEv2 could be used to prioritize testing and vaccine rollout in highly-affected communities or to select subsets of samples for further viral sequencing. SHINEv2 could also assist clinicians in selecting the right treatment (e.g. monoclonal antibody cocktails) for patients with severe CO...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. McNamara, L. A., Wiegand, R. E., Burke, R. M., Sharma, A. J., Sheppard, M., Adjemian, J., Ahmad, F. B., Anderson, R. N., Barbour, K. E., Binder, A. M., Dasgupta, S., Dee, D. L., Jones, E. S., Kriss, J. L., Lyons, B. C., McMorrow, M., Payne, D. C., Reses, H. E., Rodgers, L. E., … Schrag, S. J. (2021). Estimating the early impact of the US COVID-19 vaccination programme on COVID-19 cases, emergency department visits, hospital admissions, and deaths among adults aged 65 years and older: An ecological analysis of national surveillance data. The Lancet, 0(0). https://doi.org/10.1016/S0140-6736(21)02226-1

    1. Author Response:

      Reviewer #2 (Public Review):

      In this manuscript, Markello and colleagues exhaustively characterize the impact and relative importance of the many data-processing decisions that go into constructing whole-brain transcriptomic maps from microarray data in the Allen Human Brain Atlas. The authors motivate the need for and have developed an open-source toolbox, abagen, for standardizing workflows in imaging transcriptomics. The authors propose a taxonomy of analyses commonly performed on these data in the literature; they then use abagen to compute the distributions of statistical outcomes for three prototypical analyses across 750,000 combinatorial choices of end-to-end data-processing pipelines. Informed by these findings, the authors then place into context several specific pipelines reported in recent and influential studies.

      The paper is well-written and the authors are successful in illustrating and attempting to address the need for standardized and systematic research in the burgeoning field of imaging transcriptomics. The abagen toolbox is an important contribution and is to my knowledge the current state-of-the-art. The code is clean, flexible, and very well-documented. The chief weakness of this paper is the lack of clear guidance on best practices. Readers should, however, be sympathetic to the fact that there is currently a lack of ground-truth data against which to benchmark different data-processing pipelines.

      Even after reading the paper thoroughly, it's still not completely clear to me whether the analyses in this study are performed for cortex only, or at the whole-brain level (or bi- or uni-laterally for that matter). I'm assuming this study is cortex-only as you say in the methods that "the brain atlas used in the current manuscript represents only cortical parcels." But abagen supports joint cortical+subcortical atlases too. It'd be helpful to readers to make this explicit.

      To ensure comparability across both the volumetric and surface-based versions of the Desikan-Killiany parcellation examined in our analyses, we investigated bilateral cortical samples (i.e., we omitted samples from the cerebellum, subcortex, and brainstem). We have clarified this in the manuscript (“Materials and Methods” section, “Data” subsection, “Parcellations” subsubsection):

      “To facilitate comparison between volumetric- and surface-based parcellations, samples from the cerebellum, subcortex and brainstem were omitted.”

      Along similar lines, do you expect any of the main findings of this study to change when deriving whole-brain maps?

      We anticipate that examining whole-brain gene expression—rather than just cortical expression as in the current manuscript—would likely strengthen the primary findings of our analyses for several reasons. Primarily, there are known differences in gene expression values between cortical and subcortical / brainstem / cerebellar tissue samples in the AHBA (Arnatkevic̆ iūtė et al., 2019). We expect that differentially normalizing these samples across pipelines would therefore result in greater differences between effect estimates for the three examined analyses. In a similar vein, we expect that the rankings of parameter importance would likely remain stable, especially at the extremes. It is possible that some parameters related to normalization (e.g., normalize matched, normalize structures) may move up in rankings; however, overall, the qualitative interpretation of these results is likely to remain unchanged.

      We have revised the Discussion to highlight this consideration (paragraph #4):

      "Although we only considered cortical tissue samples in the current analyses, we expect that including non-cortical samples would further reinforce these results (Arnatkevic̆ iūtė et al., 2019) as known differences in microarray expression values between cortex and subcortical structures will likely emphasize the impact of different normalization procedures across pipelines."

      Arnatkevic̆ iūtė, A., Fulcher, B. D., & Fornito, A. (2019). A practical guide to linking brain-wide gene expression and neuroimaging data. Neuroimage, 189, 353-367.

      Would it make sense to use PET maps or another type of neuroimaging data as a (pseudo-)benchmark in a future study?

      This is a great question and an area of ongoing research, including in our own group. The few studies that have compared PET data with the AHBA have shown that the spatial correlation between gene expression and receptor density is highly variable, with correspondence strongly dependent on the genes and receptors being considered (Beliveau et al., 2017, Martins et al., 2021). This is likely due to the fact that gene expression (as measured by mRNA) is not equivalent to protein synthesis and that PET tracers vary in their specificity and sensitivity for specific receptors. Our group is currently collating a large sample of PET datasets from multiple tracers to demonstrate this lack of correspondence (work forthcoming; presented by Hansen et al., 2021). Given this, we would be hesitant to suggest such a comparison as a benchmark.

      Comparisons of microarray expression data with the RNAseq data also included in the AHBA (as performed in Arnatkeviciute et al., 2019) are also feasible; however, given that some of the pipelines in the current manuscript utilize the RNAseq data to determine probe selection we felt that using this as a benchmark would be biased. Alternatively, a different dataset (e.g., PsychENCODE) could be used; unfortunately, in these datasets the precise spatial location of collected samples are uncertain, and for that reason we would also hesitate to use them as a reference.

      Martins, D., Giacomel, A., Williams, S. C., Turkheimer, F. E., Dipasquale, O., Veronese, M., & PET templates working group. (2021). Imaging transcriptomics: Convergent cellular, transcriptomic, and molecular neuroimaging signatures in the healthy adult human brain. bioRxiv. Beliveau, V., Ganz, M., Feng, L., Ozenne, B., Højgaard, L., Fisher, P. M., ... & Knudsen, G. M. (2017). A high-resolution in vivo atlas of the human brain's serotonin system. Journal of Neuroscience, 37(1), 120-128. Hansen, J. Y., Markello, R. D., Palomero-Gallagher, N., Dagher, A., Misic, B. (2021). Correspondence between gene expression and neurotransmitter receptor and transporter density in the human cortex. In 13th International Symposium of Functional Neuroreceptor Mapping of the Living Brain.

      What about a cross-validation strategy where data are selectively withheld during processing and then predicted after the fact? This may only be possible for a subset of genes and/or pipelines, but it could nonetheless be informative.

      A cross-validation strategy is feasible; however, it will depend on what exactly you are trying to assess. What features are being omitted (i.e., samples or genes) will be strongly influenced by the research question and null hypothesis being tested. For example, when examining the distance-dependent relationship of correlated gene expression, you could leave some tissue samples out and "predict" the fit of these samples (e.g., as in Hansen et al., 2021). As the reviewer suggests, a cross-validation strategy will thus only be possible for some specific research questions, but not generally for entire pipelines.

      One alternative that would be applicable in many cases would be to examine the robustness of the observed effects via a leave-one-donor-out strategy, whereby analyses are repeated six times, omitting one donor each time, to ensure that none of the donors are unduly influencing analytic estimates (Vogel et al., 2020; Arnatkevic̆ iūtė et al., 2019). This may require careful interpretation, however, as different donors contribute variable numbers of samples, and so gene expression estimates will have variable spatial coverage across folds.

      We have added the following text to the Discussion to expand on these points (paragraph #9):

      "One potential solution to this could be to examine the robustness of pipelines based on a leave-one-donor-out strategy (e.g., Vogel et al., 2020; Arnatkevic̆ iūtė et al., 2019), wherein analyses are repeated six times, omitting one donor each time, to ensure that none of the donors are unduly influencing analytic estimates. This approach is likely to become more useful as data from more individuals becomes available, but at present may be a worthwhile approach for assessing whether chosen processing parameters are appropriate."

      In the discussion, you claim that "the optimal set of processing parameters will very likely vary based on research question." I'd like to see this elaborated on a bit further, at least for the most important parameters. For example, when would it make more sense to use one form of gene normalization over the other? What are the implicit assumptions underlying each choice?

      This is an important aspect of processing for the AHBA data: not only do we believe that the optimal set of processing parameters will vary based on research questions, but which processing parameters are most important may also be influenced.

      Gene normalization is a great example. Some genes have very low expression values whereas others have very high expression, and this variability can influence downstream analysis. For example, consider the distance dependent correlated gene expression (CGE) analysis shown in the manuscript: CGE values derived from non-normalized gene expression values will be high because the correlation will be driven by these differences in expression levels across genes rather than common patterns of expression. Normalizing expression values will therefore result in CGE values being more broadly distributed and better capturing shared spatial expression patterns.

      More generally, gene-expression values in the AHBA are imperfect; it is an open problem in transcriptomics to obtain measures of expression that are comparable across genes. Throughout the literature, research has shown that the binding strength of in situ hybridization depends on properties of the RNA sequence used in the binding process, making it difficult to compare "raw" values across different genes. As such, gene normalization allows for a more fair comparison of expression patterns across probes.

      However, even if we were able to obtain perfect measurements that were comparable across genes, there are contexts where researchers may want to retain the variance contributed by genes to accurately reflect their relative expression levels. For example, since many genes measured in the AHBA are not brain-specific, normalization will amplify their noisy expression patterns, potentially obscuring more relevant expression information. This can be avoided by sub-selecting genes in a hypothesis-driven manner, but, as before, this will depend on the research question.

      Within the forms of gene normalization examined (i.e., z-scoring, scaled robust sigmoid normalization), we believe that scaled robust sigmoid is the optimal choice as it is less sensitive to outliers, which are known to exist in the imaging microarray-based transcriptomics data (Fulcher et al., 2019; Arnatkevic̆ iūtė et al., 2019).

      We have added text to the Discussion to expand on these points (paragraph #9):

      “For instance, in most applications gene normalization is appropriate, as it ensures that downstream analyses are not driven by a small subset of highly expressed genes. However, in other applications it may be desirable to retain the variance contributed by genes to accurately reflect their relative expression levels. For example, many genes in AHBA are not brain-specific, so normalization will amplify their expression patterns, potentially obscuring more relevant expression information. This can be avoided by sub-selecting genes in a hypothesis-driven manner and skipping the normalization step altogether.”

      Is there anything to be said about the order of operations? There seem to be several steps in Table 1 which could conceivably be interchanged. If nothing else, this procedural ambiguity is yet another good reason to standardize workflows.

      We believe that the importance of processing order is strongly dependent on which processing steps are being considered. For example, intensity-based filtering of probes must always be performed before probe selection—reversing the order of these operations would, in the majority of cases, be problematic because it would potentially result in the selection of noisy probes to be carried through to analysis. However, the order of other steps (i.e., sample versus gene normalization) could arguably be reversed with no ostensible detriment. We agree with the reviewer that this ambiguity is a good reason to standardize these workflows, and believe that the order of operations implemented in abagen and described in the manuscript is a principled solution to this problem.

      We have added text to the Discussion to clarify this point (paragraph #5):

      “Note that there are some processing steps that should be performed in a specific sequence, and others whose order could potentially be interchanged. For example, intensity-based filtering of probes must always be performed before probe selection—reversing the order of these operations would, in the majority of cases, be problematic because it would potentially result in the selection of noisy probes to be carried through to analysis. However, the order of other steps (e.g., sample versus gene normalization) could arguably be reversed with no ostensible detriment. This procedural ambiguity is a salient example of the need to standardize workflows.”

      I particularly liked the analysis in Figure 2A and thought it made a nice contribution to the paper.

      We appreciate the reviewer's kind words, especially given their extensive foundational work in this field.

      Reviewer #3 (Public Review):

      The work Standardizing workflows in imaging transcriptomics with the Abagen toolbox is a major meta analysis pipeline workflow for comparing and integrating parameter choices in imaging transcriptomics using the Allen Human Brain Atlas (AHBA). The release of the AHBA has strongly increased the interest in determining transcriptomic associations in brain imaging studies, yet there is much variability in the analysis, methods used, and subsequent interpretation.

      This work is illustrative of an important trend in informatics analysis allowing strong metadata control by users so as to access, and implement optimal choices of parameters and to study there distribution. The work implemented as an open source Python toolkit is likely to be of importance to analysts working in these areas.

      It would be helpful to clarify and specifically define the term pipeline as a specific set of parameter, normalization, and other choices that are selected. Whereas this term is in common use in the field, in the present work the meaning is specific to a set of selectable options. Of course the any number of such variable selections could be implemented in the Abagen toolbox, it will help for clarity to more clearly define this term up front.

      We have added text to the Results clarifying what we mean when we refer to "pipeline" (“Results” section):

      “We refer to each unique set of processing choices and parameters as a “pipeline”.

      Similarly, we have added text to the Methods to clarify this as well:

      “Each unique set of these 17 processing choices and parameters constitutes a pipeline, yielding 746,946 unique pipelines."

      My major consideration in this work concerns are two issues. The first is how to characterize and summarize the results of pipeline output produced by Abagen. The manuscript illustrates the workflows and various means of summarizing results but does not offer guidance into preferred interpretation of relative value of the results. Whereas we may argue that the primary purpose of Abagen is to run the various pipelines, allowing downstream interpretation to the user, it would be helpful to understand how the Abagen toolbox organizes, summarizes, and sets this output options up for interpretation. This appears to be only weakly addressed in the present manuscript.

      The primary output of abagen is a single brain region x gene expression matrix based on a researcher-specified atlas. We believe this is the simplest and most fundamental output object of the AHBA that can facilitate a range of analyses, including those we examined in the paper (i.e., correlated gene expression, gene co-expression, and regional gene expression or gene-ofinterest analyses).

      In the manuscript, we examined the outputs of various pipelines only to highlight the potential variability of results as a function of parameter selection; however, in most use cases, we would recommend that researchers only use abagen to run a single pipeline, yielding one brain region x gene expression matrix that they can carry forward to their desired analyses. Selecting different parameters when using abagen will modify the shape or values of this matrix, but not the structure.

      To clarify this we have added the following text to the Results (section "Standardized processing and reporting with the abagen toolbox"):

      "The main output of abagen is a single brain region (or tissue sample) x gene expression matrix. Changing the parameters may modify the shape of the matrix (e.g., different atlases will yield different numbers of regions or samples) or different values (e.g., different processing choices may yield different numbers of genes), but not the structure."

      The second point I of importance I believe is more description of the available functionality in the toolbox, perhaps as more of a specific use case analysis. The authors provide substantial documentation on installing and working with Abagen, and but some more direct indication of how the toolkit would be used would be valuable.

      We agree that it is important to clearly lay out the functionality of the toolbox in the manuscript. We have modified the following paragraph to the Results (Standardized processing and reporting with the abagen toolbox) to elaborate on the tools made available to researchers in abagen:

      “The abagen toolbox supports two use-case driven workflows: (1) a workflow that accepts an atlas and returns a parcellated, preprocessed regional gene expression matrix (Fig. 4a); and, (2) a workflow that accepts a mask and returns preprocessed expression data for all tissue samples within the mask (Fig. 4b). Workflows can be called via a single line of code from either the command line or Python terminal, and take approximately one minute to run with default settings using the Desikan-Killiany atlas. The main output of abagen is a single brain region (or tissue sample) x gene expression matrix. Changing the parameters may modify the shape of the matrix (e.g., different atlases will yield different numbers of regions or samples) or different values (e.g., different processing choices may yield different numbers of genes), but not the structure. The outputs of these workflows can be used generally to examine the three prototypical research questions enabled by the AHBA: correlated gene expression, gene co-expression, and regional expression of genes of interest more broadly (Fornito et al., 2019, Trends Cogn Sci). Beyond its primary workflows, abagen has additional functionality for post-processing the AHBA data (e.g., removing distance-dependent effects from expression data, calculating differential stability estimates; Hawrylycz et al., 2015, Nat Neuro), and for accessing data from the companion Allen Mouse Brain Atlas (e.g., providing interfaces for querying the Allen Mouse API; https://mouse.brain-map.org/; Lein et al., 2007, Nature).”

      As we envision the abagen software to continue to develop in the coming years, we have purposefully omitted the inclusion of code examples in the current manuscript as the API is liable to change over time. To ensure that these examples stay up-to-date with the abagen API, we only include code in the online abagen documentation (https://abagen.readthedocs.io; citable via Zenodo; https://zenodo.org/record/3726257), which can be continuously updated along with the software package.

    1. Author Response:

      Reviewer #1 (Public Review):

      1. The authors use a surrogate marker for "slow" vs "fast" MNs: immediate vs delayed firing in response to rectangular current injection. They switch their language to call these motoneurons slow and fast, but they should be more cautious about doing so, given that firing is a surrogate marker that has not been fully studied and characterised across this time period. We do not know if developmental changes in Kv1 might also contribute to the effects on spiking seen here. I agree, there is delayed firing from the outset, which is interesting in itself given the rather homogenous other properties. But that doesn't mean that Kv1 expression is stable and thus non-contributory to the changes in firing described.

      As suggested in the editorial summary, we have changed all reference to fast and slow motoneurons to delayed and immediate firing motoneurons up until the discussion. Furthermore, we have expanded our discussion highlighting potential roles for Kv1 in shaping motoneuron rheobase across development as an interesting direction for future study. Page 19, Lines 630-639.

      1. The focus of the manuscript is on MN recruitment, but recruitment is never defined, despite being used in the title, through the abstract and key points, as well as throughout the manuscript. What they are looking at is response to current injected at the soma vs recruitment during a behaviour when synaptic inputs are bombarding an extensive dendritic tree. Thus, this manuscript does not look at recruitment per se, but rather activation of action potentials in response to intra-somatic stimulation. Accordingly, the term "recruitment" would be best kept to the Discussion.

      We have changed the wording in the title from ‘recruitment’ to ‘active properties’ in the title, changed references to recruitment current to rheobase in the results section, and re-addressed recruitment in the discussion. Further, we have highlighted the importance of where synaptic inputs terminate on motoneurons and implications for recruitment with emphasis placed on the compartmental localization between synaptic terminals and compartmental clustering of voltage-sensitive ion channels on Page 21, Lines 688-692.

      I also note that the "size" principle relates more to electrical than physical size in the 21st century; I agree that the two are correlated, but the authors may not want to stick to arguments about physical size.

      We have tried to clarify when we are referring to electrical or physical size within the revised text.

      1. Figure 6 is problematic, possibly in the way it's presented. It seems to me, but not clear, that the authors suggest that Ih is active at rest, more so in "F" than "S," and that therefore "F" are more depolarised and have smaller mAHPs. So (a) how come RMP didn't seem to come out in the PC analysis earlier? (b) would that not suggest that "F" would be "recruited" earlier? (Or is it that there is reduced sodium channel availability because of the depolarisation - what are the differences in spike amplitude and rate of rise?) (c) shouldn't the mAHP be larger if the cell is more depolarised and further from the potassium equilibrium potential? On the last note, maybe it's that Ih makes the mAHP smaller, but with the kinetics of Ih, wouldn't the decay be faster, but in Fig 6 the decay seems faster when Ih is blocked? Finally, Fig 6E suggests changes in the fAHP and delayed depolarisation (and spike width?) - how to these come into the picture? If the fAHP is thought to result from a high conductance state, and if therefore one were to align the voltages based on this potential, then the mAHPs would be about the same amplitude? The authors likely have explanations, but I'm afraid that I can't follow it.

      We agree that some aspects of Figure 6 were not ideal, particularly those related to RMP and mAHP. For example, we had attempted to utilise measures of mAHP to help provide evidence that Ih was active at rest. However, upon reflection, the data provided in the original manuscript did not achieve this as clearly as the new data we have added, where we now measure Ih at resting membrane potential. Furthermore, the subset of data utilised in the previous Figure 6B misleadingly suggested a slightly more depolarised RMP in delayed MNs. However, as noted in supplementary table 1, delayed firing MNs in fact have a more hyperpolarised RMP compared to immediate firing MNs. We have therefore removed some of these problematic aspects of the figure that lacked clarity and have become less important towards the main points we were attempting to make, given the new data we have added. The simple explanation for RMP not coming out as a strong contributor in the PCA is likely because this parameter is not a prime contributor of variance across MN type or through development. We did not find any difference in spike amplitude or rise time between subtypes (these data are summarized in Supplementary File 1). As is common practice, we injected bias current to measure parameters included in the overall PCA from approximately -60mV. However, in hindsight, this could have reduced potential effects of RMP on some of the properties related to activation.

      1. A number of labs have looked at development of MN properties, and it would be useful to compare properties seen across different labs, for example Quinlan (e.g. PMID: 21486770) and Whelan (e.g. PMID: 20457856, which is only mentioned in the manuscript) (and for that matter, mine - e.g. PMID 10564356, PMID: 32851667 although I don't want to self-promote).

      We have highlighted the consistencies between our results and those reported by others, including Whelan, Heckman, Zytnicki, and Brownstone Labs. This statement can be found on page 3, Lines 104-106.

      We have also included a comparison table in the supplemental information (Supplementary File 3) and referenced this table in the discussion on Line 528.

      1. In the Discussion, the authors might want to discuss propensity of F vs S MNs to express PICs / sustained firing as described in the Heckman lab (albeit particularly in cat; see PMID 9705452, for e.g.). How do these data correspond?

      It is interesting to note that the properties of PICs that we measured (ie. onset and amplitude) in immediate and delayed firing motoneurons are similar to those of fully and partially bistable motoneurons described by Lee and Heckman. In particular, we find that higher input resistance, immediate firing motoneurons have smaller PIC amplitude than delayed firing motoneurons but their PICs are activated at more hyperpolarized membrane potentials. This is consistent with fully bistable motoneurons, which are higher input resistance, and have smaller PICs that are activated at more hyperpolarized voltages compared to the partially bistable motoneurons. While we did not see bistability in the samples of motoneurons that we studied, a key difference is that we studied intrinsic properties in the absence of neuromodulation, which is a key factor for promoting bistability in motoneurons. Modulation of PICs might contribute to this propensity for bistability; however, modulation of outward currents is also very likely. We have highlighted these similarities and differences in our discussion on PICs and can be found on Page 19, Line 591-596.

      Reviewer #4 (Public Review):

      1) During the 1st postnatal week, authors suggest that fast and slow MNs cannot be distinguished neither on their passive properties nor the rheobase and therefore their recruitment is mainly based on the size. The conclusion that the recruitment is not linked to MN functional differences is difficult to follow since the main distinction between MN subtypes is based upon the presence of a delayed firing, an active property that regulates the recruitment of MNs (Leroy et al., 2014). However, the square current pulse adopted to discriminate between delayed and immediate firing in Figure 1 was replaced with a ramped depolarization protocol on which the authors measured the rheobase (Figure 3A1). This suggests that the slow depolarization in immature motoneurons might minimize the activation of ionic conductance(s) responsible for the delayed firing and thus may bias the measure of the rheobase (the minimal current amplitude of infinite duration). In line with this, the recruitment of a motoneuron has been shown to depend on the rate of membrane potential depolarization preceding a spike (Krawitz et al., 2001). Rather than using a slow ramp depolarization, it therefore seems more appropriate to assess MN rheobase with the current pulse protocol used to distinguish between MN subtypes. With this kind of measure, differences in the excitability of MN subtypes related to active conductances may come out earlier during development.

      The reviewer raises an interesting point, which is consistent with one also raised by Reviewer 1. We have now included additional analysis in which we calculated rheobase values from the long (5 s) square current steps that were used to identify delayed and immediate firing MNs. These rheobase measurements made using current steps correlate strongly with rheobase measured from slow ramps (W1: r=0.87 p < 1.0 e-15; W2: r = 0.95 p < 1.0 e-15; W3: r= 0.92 p < 1.0 e-15). This is consistent with findings from Leroy et al. (2014) and Buisas et al., (2012), who both also demonstrated similar rheobase values in response to ramps and current steps. Importantly, we also find similar developmental changes in rheobase across motoneuron subtypes when assessed with a current step - showing no difference in rheobase values between delayed and immediate firing cells at week 1, with differences emerging in week 2 due to a progressive increase in rheobase in delayed firing motoneurons at 2nd and 3rd weeks. These findings are included as a new Supplementary Figure (Figure 3 – Figure Supplement 1) and summarized in the results on Page 6, lines 173-178.

      2) During the 2nd postnatal week, the study suggests that "PICs contribute to the emergence of orderly recruitment amongst MN subtypes". This interpretation appears too definitive because the study did not provide direct evidence for that.

      This is a good point. We did not directly test the contribution of PIC maturation to the staggering of rheobase currents between weeks 1 and 2. We have revised this statement to soften our claim, restricting differences in PIC activation to the second week. This revision can be found on Page 9, Line 319-329.

      The authors describe a more hyperpolarized activation of PICs in slow MNs suggesting that the early recruitment of PICs in slow MNs may help them to fire before fast MNs. By a pharmacological approach the authors show that the sodium PIC mediated by Nav1.6 channels sets the activation threshold of PICs and that their blockade increases the rheobase (recruitment current). However, since pharmacological investigations have been done only in fast MNs, it is not very informative on the putative role of the sodium PIC (and PICs in general) on the orderly recruitment of MN subtypes. Similar experiments should be extended to slow MNs to compare the effects with those observed on fast MNs. If sodium PIC plays a significant role in the differential recruitment of MN subtypes, its blockade should induce an overlap in the recruitment of slow and fast MNs.

      We initially focused specifically on the roles of PICs in shaping recruitment of delayed firing motoneurons during weeks 2 and 3, because we were trying to account for changes in rheobase that occur within delayed firing motoneurons during this period of postnatal development. However, in response to the useful comments here and above, we have now conducted an additional set of experiments to determine the relative contribution of NaV1.6 (n = 12 MNs, 7 animals) and L-type calcium channels (n = 10 MNs, 7 animals) to PIC and rheobase in immediate firing motoneurons. These results have been integrated into Figure 4, the results section, and discussion.

      Furthermore, voltage clamp recordings to characterize PICs in MN subtypes have been done without blocking potassium conductances. Therefore it is difficult to determine if differences in PICs between MN subtypes are related to inward currents or opposing outward currents.

      We agree that we cannot rule out contributions of other currents to our measures of PIC in voltage clamp given that we did not block potassium conductances. This is indeed an interesting point. However, our approaches are consistent with previously published approaches (Quinlan, et al., 2011, Verneuil, et al., 2020), which may be useful for the purposes of cross-study comparisons. Of note, Quinlan, et al., (2011), did measure PICs in the presence and absence of TEA (n = 18), with no differences in PIC amplitude or onset found. However, recent work from the Brocard Lab has found opposing contributions of M-currents to measures of PICs in voltage clamp in Hb9 interneurons. This would therefore be an interesting direction for future study amongst motoneuron subtypes. As highlighted below, and in our revised manuscript, it is quite possible that outward currents may oppose and diminish the actions of Ih. This is also likely true for PICs and would be an interesting direction for future study. We have included an additional statement in our discussion on Page 19, Lines 630-639 to acknowledge this potential interaction and contribution to maturation of motoneuron recruitment.

      3) During the 3rd postnatal week, the authors suggest that fast MNs display a prominent Ih current at rest that provides a depolarizing shunt delaying their recruitment compared to slow MNs. However, data appear not enough conclusive for such interpretation. First, the relationship between the resting membrane potential (RMP) and the amplitude of Ih (the larger the Ih, the more depolarized the RMP) depicted in Figure 6B from a small sample of MNs is not consistent with values reported in the supplementary table 1. Indeed, fast motoneurons supposed to have a prominent Ih current display a more hyperpolarized RMP compared to slow MNs. The opposite would be expected according to the authors' hypothesis. A similar concern can be raised regarding the strong relationship between the amplitude of Ih and that of the AHP illustrated in Figure 6F, which is not in line with the lack of difference in the amplitude of the AHP between slow and fast MNs in week 3 (see supplementary table 1).

      As discussed above in response to similar comments from another reviewer, we realise that the data presented in our original manuscript (Figure 6) regarding the relationships between RMP, Ih and mAHP lacked clarity and perhaps depicted a subset of recordings that was not representative of the complete dataset reported in our supplementary table (as pointed out by the current reviewer). Furthermore, these data did not achieve our main objective of supporting the existence of a resting Ih current as well as the new data we have included - where we directly measure Ih at resting membrane potentials. Given the addition of these new data, and the potential oversimplification of our attempts to relate RMP, Ih and mAHP (e.g. Ih is unlikely to be the main contributor to RMP), the latter has been removed from the revised manuscript.

      In addition, we have expanded our discussion to highlight potential roles for Ih in shaping recruitment of fast motoneurons during periods of inhibition, such as during rhythmic activity, where the membrane potential often dips below -70 mV. Fast fatigable (MMP9+) motoneurons have been shown to receive a greater density of inhibitory synaptic inputs, particularly those derived from V1 interneurons, compared to slow (ERRB+) motoneurons (Allodi et al., 2021), and this differential synaptic weighting may create greater opportunity for Ih to be engaged and contribute to staggering recruitment as our pharmacology data suggests. This addition can be found on Page 20 Lines 657-663.

      Second, the inward current recorded in fast MNs to hyperpolarization at -70 mV appears not significantly affected by the Ih blocker ZD7288 (Figure 5J, and 5L) suggesting that Ih is not recruited at rest in this class of MNs.

      We realize that displaying the full IV plots for Ih at weeks 2 and 3 in addition to before and after application of ZD7288 (at week 3) may not have effectively illustrated the magnitude of Ih measured at -70 mV given the wide range of current values, which vary 10-fold between measures made at -70 and -110mV. We have modified our graphs in Figure 5 to better illustrate the magnitude of Ih measured at -70 mV and -110 mV. We hope that these modified graphs better capture our observations. We have further simplified Figure 5 to reduce redundancy in results that are summarized in Supplementary File 2 and the Results text. We have also included additional traces and analysis in Figure 6 that highlight a significant ZD-sensitive sag potential detected in delayed but not immediate firing motoneurons when hyperpolarizing the membrane potential from -60 mV to resting potential. These data can be found on Page 13, Lines 434-439, and in figure 6A, B. These results have been further supported by an additional set of recordings of delayed (n= 13) and immediate (n = 11) firing motoneurons obtained from week 3 animals, where Ih was measured during a voltage step (in VC) from a holding potential of -50 mV down to the respective resting potential of each cell (Del: IhRMP = -96 ± 60 pA; Imm: IhRMP: -0.13 ± 11 pA; t(23) = 4.8, p = 8.7e-5). These results have been included on Page 13, Lines 431-434.

      On the other hand, ZD7288 hyperpolarizes the RMP in fast MNs (Figure 6A) and reduces the amplitude of their sags recorded at -70mV (Figure 5M). Similar discrepancies are more striking for slow MNs. Slow MNs did not display inward current sensitive to ZD7288 above -80 mV (Figure 5N). However, ZD7288 unexpectedly hyperpolarizes their RMP (Figure 6C). How the authors can explain such discrepancies? An interestinsting, but unexpected observation is the hyperpolarization of the RMP by ZD7288 in immediate firing motoneurons, even though, we were unable to detect measurable Ih or sag at potentials at resting membrane potential in immediate firing motoneurons. We have two explanations for these observations.

      1.) One possibility is that, as pointed out above regarding our measures of PICs, we did not block other conductances during our voltage clamp protocols for measuring Ih. It is therefore possible that immediate firing (and even delayed firing) motoneurons express other ion channels that oppose Ih and may mask its true magnitude and effects on membrane potential. Indeed, this has previously been demonstrated for a variety of currents (eg. Kjaerulff and Kiehn, 2001; MacLean et al., 2003; Picton et al., 2018; Buskila et al., 2019). If this is true, then it is possible that the relatively smaller Ih in immediate firing motoneurons may have been masked, whereas the relatively larger Ih in delayed firing motoneurons may have been more apparent. In support of this possibility, we note that many of the immediate firing motoneurons demonstrate a slow hyperpolarization of the membrane potential during current steps intended to measure sag. Interestingly we also find this phenomenon in delayed firing motoneurons (that demonstrated depolarizing sag potentials at baseline), in the presence of ZD7288. We have included an example in the modified figure 6 to highlight this phenomenon. We have included additional discussion to highlight these caveats and possibilities (Page 20 Lines 664-675).

      2.) Alternatively, voltage and space clamp errors, may have caused an underestimate of Ih. While we expect space clamp errors to be greater in the largest motoneurons, such as the delayed firing motoneurons, it is possible that such errors may have been sufficient to mask the small, albeit significant Ih in immediate firing motoneurons. It is possible that blockade of this small Ih by ZD7288 in immediate firing motoneurons may have hyperpolarized their RMP due to their high input resistance. This has been highlighted on Page 20 Lines675-679

      Finally, there is a mismatch in values reported in supplementary table 2 and figures 5G and 5I. In the table, both Ih amplitude and Ih density (at -70mV) appear significantly different between slow and fast MNs in week 3, but not in figures 5G and 5I. Altogether, these results appear inconsistent.

      We have modified our graphs to better illustrate the range of inward currents measured at -70 and -110 mV, which due to such high variance (in some cases 10 fold comparing those measured at -70 and -110 mV), were not as apparent when showing the full IV plot. We have modified our graphs in Figure 5 to better reflect the data summarized in Supp Table 2, and capture our observations. Both the data in the table and the plots have been analyzed using the same 2 way anova with cell type and age as factors.

      Regardless of inconsistencies, data should be replicated at least with a second Ih blocker such as Ivabradine hydrochloride or Zatebradine hydrochloride.

      We have performed an additional set of experiments in delayed (n = 8) and immediate (n = 3) firing motoneurons with ivabradine. These new results are included in text on Page 14, Lines 457-465. 10 µM Ivabradine produced a 45% reduction in Ih, and consistent with ZD7288, hyperpolarized the RMP of both delayed and immediate firing motoneurons and caused a significant decrease in rheobase of delayed firing motoneurons.

      Minor concerns: 1) Does the pharmacological blockade of Nav1.6 channels 4,9-AH-TTX induce changes in the spiking threshold as already reported in cortical neurons (Hargus et al., 2013)? Such an effect may contribute to the higher rheobase observed in fast MNs under 4,9-AH-TTX (Figure 4M).

      We have included an analysis of spike threshold before and after application of 4,9-AH-TTX. In line with previous reports from cortical neurons (Hargus et al., 2013), 4,9-AH-TTX significantly depolarized the spike threshold of delayed and immediate firing motoneurons and could contribute to the higher rheobase observed in delayed firing motoneurons following blockade of Nav1.6. The results from this analysis have been included in text and can be found on page 9, Line 306-310.

      2) The study reported a more depolarized PIC in fast MNs during the 2nd postnatal week but the acceleration onset voltage in response to a current ramp depolarization (attributed to the activation of PICs), is similar between slow and fast MNs at the same age (Figure 4C). This is in discrepancy with figure 4G, where a significant effect on PIC onset voltage is shown within the same time points.

      Indeed, there are differences between delayed and immediate firing motoneurons in the onset voltage of the PIC measured in voltage clamp at week 2 and these findings are not mirrored by differences in the accelerating phase of the membrane potential depolarization as measured from depolarizing current ramps in current clamp mode. We believe that this difference likely reflects that measurements made in current clamp are indirect estimates of PICs, whereas voltage clamp protocols provide more direct and likely more sensitive measurements. This is highlighted on Page 8, Line 263-265.

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      Manuscript number: RC-2021-01041 Corresponding author(s): Gregory P. Way, PhD

      1. General Statements

      On behalf of the authors, I’d like to thank the Review Commons team for sending our manuscript out for review. I’d also like to thank the three anonymous reviewers for providing valuable feedback that will improve the clarity, focus, and analysis interpretation presented in our manuscript.

      To prompt the editorial team, our paper provides two well-controlled innovations:

      We are the first to train variational autoencoders (VAEs) on classical image features extracted from Cell Painting images. VAEs are commonplace in, and have contributed major discoveries to, other biomedical data types (e.g. transcriptomics), but they have been underexplored in morphology data. In our paper, we trained and optimized three different VAE variants using Cell Painting readouts and compared these variants against shuffled data, against PCA (a nonlinear dimensionality reduction algorithm commonly used as a VAE control), and against L1000 (mRNA) readouts from the same perturbations. We found that cell morphology VAEs train with different settings than gene expression data, and that they generate interpretable latent spaces that depend on the chosen VAE variant.

      We tested special VAE properties to predict polypharmacology cell states in a novel way. Polypharmacology is a major reason why drugs fail to reach the bedside. Off-target effects cause unintended toxicity, and lead to adverse clinical events. In our paper, we used VAE latent space arithmetic (LSA) to predict polypharmacology cell states; in other words, what cells might look like if we perturbed them with a compound that had two mechanisms of action (MOA). We compared our results to shuffled data, PCA, and to LSA performed with VAEs trained using L1000 readouts. We found that cell morphology and gene expression provide complementary information, and that we could predict some polypharmacology cell states robustly, while others were more difficult to predict.

      We found value in all of the reviewer comments. We intend to conduct all but four of the proposed analyses to supplement our aforementioned innovations.

      In the following revision plan, we include all reviewer comments exactly as they were written. The reviewers often had overlapping suggestions. In these cases, we grouped together similar reviewer comments and responded to them once.

      We include three sections: 1) A description of the revisions we plan to conduct in the near future; 2) A description of changes we have already made; and 3) A description and rationale of changes we will not pursue.

      Lastly, we would like to highlight that all reviewers provided positive feedback in their reviews. They discussed our paper as “conceptually and technically unique” and were positive about our methods section, stating that we did a “good job making everything available and reproducible”. Our methods section is complete, and we provide a fully reproducible and versioned github repository. We will release a second version of our github repository when we complete our revision plan to maintain clarity for our submitted version and the peer-reviewed version.

      1. Description of the planned revisions

      2.1. Address UMAP interpretability to provide a deeper description of MOA performance

      Reviewer 1: Instead of using UMAP embedding, it would be better to compare reconstruction error or show a reconstructed image with the original image to claim that models reliably approximate the underlying morphology data.

      Reviewer 1: Rather than just stating that the VAE's did not span the original data distribution and saying beta-VAE performed best by eye, some simple metrics can be drawn to analyze the overlap in data for a more direct and quantified comparison. Researchers should also explain what part of the data is not being captured here. Some analysis of what the original uncaptured UMAP represents is important in understanding the limitations of the VAEs' capacity.

      Reviewer 2: The authors compare generation performance based on UMAP. In the UMAP space, data tend to cluster together even though they might be far from each other in the feature space. I would like to see more quantitive metrics on how well these methods capture morphology distributions. You can compute metrics like MMD distance, kullback leibler (KL), earthmoving distance, or a simple classifier trained on actual MoA classes tested on generated data.

      We agree with the reviewers that evaluating reconstruction loss in addition to providing the UMAP coordinates would improve understanding of VAE limitations and enable a better comparison of VAE performance. We will analyze reconstruction loss across models and include these data as a new supplementary figure, which will enable direct comparisons across models and across different MOAs.

      We also agree that UMAP interpretation can be misleading. While currently state-of-the-art, UMAP has mathematical limitations that prevent interpretation of global data structures. However, there are emerging tools, including a new dimensionality reduction algorithm, called PaCMAP, which aims to preserve both local and global structure (Wang et al, 2021). We will explore this tool to determine, both mathematically and empirically, which is most appropriate for our dataset by cross-referencing the visualization with our added supplementary figure describing per-MOA reconstruction loss.

      We would also like to emphasize that we trained our VAEs using CellProfiler readouts from Cell Painting images and not the raw Cell Painting images themselves. As this was one of our primary innovations, this detail is extremely important. Therefore, we have improved clarity and added emphasis to this point in the manuscript introduction and discussion (see section 3).

      2.2. More specific comparisons of MOA predictions to shuffled data and improved description of MOA label accuracy

      Reviewer 1: It is difficult to know the clear threshold for successful performance is on figures like Figure 7 and SFigure 9, but by and large, it appears that the majority of predicted combination MOAs were not successful. Without the ability to either A) adequately predict most all combinations from individual profiles that were used in training or B) an explanation prior to analysis of which combination will be able to predict, it is difficult to see this method being used since the combinatorial predictions are more likely not informative.

      Reviewer 1: The researchers justify the poor performance compared to shuffled data, by saying that A) MOA annotations are noisy and unreliable and B) they MOAs may only manifest in other modalities like what was seen in the L1000 vs morphology predictability. While these might be true, knowing this the researchers should make an effort to clean and de-noise their data and select MOAs that are well-known and reliable, as well as, selecting MOAs for which we have a known morphological or genetic reaction.

      Reviewer 3: Figure 6 is missing error bars (standard deviation of the L2 distance) and, as such, is hard to draw conclusions from.

      We thank the reviewers for raising this concern. We agree that it is critical, and we appreciate the opportunity to address it.

      All three of these comments relate to being unable to draw conclusions from our results when most A∩B predictions appear to have no difference from shuffled controls. Therefore, to address this comment, we will update our LSA evaluation to compare each MOA to a matched set of randomly shuffled data. Specifically, in our existing comparison, we realized a methodological fallacy in how we're displaying these data shuffles. We should be comparing specific MOA combinations to their corresponding shuffled results instead of comparing all to all, which will artificially decrease performance when there are polypharmacology predictions that fail to recapitulate the ground truth cell states.

      We have connected with Paul Clemons, the senior director Director of Computational Chemical Biology Research at the Broad Institute of MIT and Harvard, who has informed us that the Drug Repurposing Hub annotations are among the most well documented. Therefore, while we know that biological annotations are often incomplete, our original text overemphasized the amount of noise contributed by inaccurate labels. We therefore added the following sentence to the discussion to clarify this important point:

      “However, the Drug Repurposing Hub MOA annotations are among the most well-documented resources, so other factors like different dose concentration and non-additive effects contribute to weak LSA performance for some compound combinations (Corsello et al, 2017).”

      We will also update our supplementary figure to account for specific MOA shuffling and include additional text comparing Cell Painting and L1000 showing which MOAs perform best in which modality.

      2.3. More detailed evaluation of MOA performance across drug variance and drug classes

      Reviewer 1: With the small number of combinations that are successfully predicted, to build confidence in the performance, it would be necessary to explain the reason for the differences in performance. Further experimentations should be done looking into any relationship between the type of MOAs (and their features) and the resulting A|B predictability. Looking at Figure 7, the top-performing combinations are comprised entirely of inhibitor MOAs. If the noisiness of the data is a factor, there should be some measurable correlation between feature noisiness and variation and the resulting A|B predictability from LSA.

      We agree with the reviewer that further experimentation would be helpful to gain confidence in our LSA performance. We plan to perform two different analyses to address this question. First, we will compare profile reproducibility (median pairwise correlations among MOAs) to MOA predictability. This will provide insight to determine the relationship between MOA measurement variance and performance. Second, we will split MOAs by category (e.g. inhibitor, activator) and test if there are significant performance differences between categories across VAE models in both L1000 and Cell Painting data. This will tell us if there are certain trends in the type of MOAs we’re able to predict. If there is, this would be useful knowledge since it could suggest that certain types of MOAs are associated with a more consistent cell state.

      2.4. Higher confidence in LSA overfitting assessment

      Reviewer 1: To show that the methodology works well on unseen data, researchers withheld the top 5 performing A|B MOAs (SFig 9) and showed they were still well predicted. This is not the most compelling demonstration since the data to be held out was selected with bias as the top-performing samples. It would be much more interesting to withhold an MOA that was near or only somewhat above the margin of acceptability and see how many holdouts affected the predictability of those more susceptible data points. From my best interpretation, the hold-out experiment also only held out the combination MOA groups from training. It would be better if single MOAs (for example A) which were a part of a combination of MOA (A|B) were also held out to see if predictability suffered as a result and if generalizability did extend to cells with unseen MOAs (not just cells which had already highly performing combinations of seen MOAs).

      We believe our original analysis was extremely compelling. Even if we removed the top MOAs from training, we were still able to capture their combination polypharmacology cell states through LSA. We find this similar to removing all pictures of sunglasses in an image corpus of human faces, but still being able to reliably infer pictures of people wearing sunglasses. Specifically, this tells us that our model is learning some fundamental data generating function that our top performing MOAs tap into regardless of if they are present or not in training.

      However, we agree with the reviewer that withholding intermediate-performing MOAs would also be informative, but for a separate reason. Unlike the best predicted MOAs, the intermediate MOAs are likely more susceptible to changes in the training data, so it would be interesting to determine if intermediate MOAs’ performance is a result of overfitting instead of truly learning aspects of the data generating function. We plan to perform this new analysis and add the results to Supplementary Figure 8 as a subpanel and add a full description of the approach to the appropriate methods subsection.

      2.5. Additional metrics to evaluate LSA predictions to provide more confident interpretation

      Reviewer 2: The predictions are evaluated using L2 distances, which I find not that informative. I would like to see other metrics (correlation or L1 or distribution distances in previous comments)

      We agree with the reviewer that using more than one metric would be helpful because oftentimes a single metric does not tell a complete story. We will add a panel to the LSA supplementary figure (Supplementary Figure 7), using Pearson correlation instead. While L2 distances will tell us how close predictions are to ground truth, Pearson correlations will tell us how consistent, on average, we are able to predict feature direction.

      2.6. Adding a performance-driven feature level analysis to categorize per-feature modeling ability

      Reviewer 2: I would like to see feature-level analysis, which features are well predicted and which ones are more challenging to predict?

      We agree with the reviewer that feature level analysis would be interesting to study. We believe that understanding which features are easy and hard to model could give insight into why certain MOAs (which could be associated with more signal in certain Cell Painting features) are predicted better than others.

      However, we are concerned that it is difficult to have an objective measurement of which features are easier to model because features that have less variation might be easier to model. So, we will analyze the correlation between individual feature reconstruction loss vs. feature variance across profiles. We will color-code the points to represent feature groups or channels. This analysis will not only demonstrate the relationship between feature variance and modeling ability, but also provide insight into the difficulty of modeling individual CellProfiler features.

      1. Description of the revisions that have already been incorporated in the transferred manuscript

      3.1. Documenting positive feedback as provided by the three reviewers

      Reviewer 1: With access to the dataset, the posted GitHub, and documentation in the paper, I believe that the experiments are reproducible.

      Reviewer 1: The experiments are adequately replicated statistically for conventions of deep learning.

      Reviewer 1: This paper proposes a conceptually and technically unique proposal in terms of application, taking existing technologies of VAEs and LSA and, and as far as I know, uses them in a novel area of application (predicting and simulating combination MOAs for compound treatments). If this work is shown to work more broadly and effectively, is seen through to it completion, and is eventually successfully implemented, it will help to evaluate the effects of drugs used in combination on gene expression and cell morphology. An audience in the realm of biological deep learning applications as well as an audience working in the compound and drug testing would be interested in the results of this paper. Authors successfully place their work within the context of existing literature, referencing the numerous VAE applications that they build off of and fit into the field of (Lafarge et al, 2018; Ternes et al, 2021, etc...), citing the applications of LSA in the computer vision community (Radford et al, 2015, Goldsborough et al, 2017), and discussing the biological context that they are working in (Chandrasekaran et al, 2021).

      Reviewer 2: The main novelty of the work is applying VAEs on cell painting data to predict drug perturbations. The final use case could be guiding experimental design by predicting unseen data. However, the authors do not show such an example and use case which is understandable due to the need for doing further experiments to validate computational results and maybe not the main focus of this paper. The authors did a good job of citing existing methods and relevant. The potential audience could be the computational biology and applied machine learning community.

      Reviewer 3: The manuscript is beautifully written in a crystal clear manner. The authors have made a visible effort towards making their work understandable. The methods section is clear and comprehensive. All experiments are rigorously conducted and the validation procedures are sound. The conclusions of the paper are convincing and most of them are well supported by the data. Both the data and the code required to reproduce this work are freely available. Overall, the article is of high quality and relevance to several scientific communities.

      We thank the reviewers for their encouraging remarks and overall positive sentiment. As early-career researchers, we feel empowered by these words.

      3.2. Moved Figure 2 to supplement and removed Figure 5

      Reviewer 1: Fig 2 is not informative so it can go to supplementary.

      Reviewer 2: I liked the paper's GitHub repo, the authors did a good job making everything available and reproducible. As a suggestion, you can move the learning curves in two the sup figures cause they might not be the most exciting piece of info for the non-technical reader.

      Reviewer 3: I would suggest removing Figure 5 (or moving it to the supplementary) as it revisits the content of Figure 1 and does not bring much extra information.

      We agree that Figure 2 might not be informative to a non-technical reader, so we have accepted this suggestion by both reviewers 1 and 2, and we have moved Figure 2 to supplementary.

      We agree with the reviewer and have removed Figure 5.

      3.3. Clarified our data source as CellProfiler readouts, not raw Cell Painting images

      Reviewer 1: In Fig 4, it would be useful to show a few sample representative images with respect to CellProfiler feature groups.

      Reviewer 1: Figure 6, what does it means original input space? Does it mean raw pixel image? As researchers extracted CellProfiler feature groups already, it would be interesting to compare mean L2 distance based on CellProfiler features so that whether VAE improves performance or not (compared to handcrafted features) as a baseline.

      Reviewer 3: While what "morphological readouts" concretely mean becomes clearer later on in the paper, it would be useful to give a couple of examples early on when introducing the considered datasets.

      We thank the reviewer for these suggestions, which bring to light a common source of confusion, which we must alleviate. We are working with CellProfiler readouts (features extracted using classical algorithms) of the Cell Painting images and not the images themselves. We have made several edits throughout the manuscript to improve clarity and remove this confusion, including the introduction, in which we clearly state our model input data:

      “Because of the success of VAEs on these various datasets, we sought to determine if VAEs could also be trained using cell morphology readouts (rather than directly on images), and further, to carry out arithmetic to predict novel treatment outcomes. We derive the cell morphology readouts using CellProfiler (McQuin et al, 2018), which measures the size, structure, texture, and intensity of cells, and use these readouts to train all models.”

      This decision comes with tradeoffs: The benefit of using CellProfiler readouts instead of images is that they are more manageable but we might lose some information. We more thoroughly discuss this important tradeoff in the discussion section:

      “We determined that VAEs can be trained on cell morphology readouts rather than directly using the cell images from which they were derived. This decision comes with various trade-offs. Compared to cell images, cell morphology readouts as extracted by image analysis tools (e.g. CellProfiler) are a more manageable data type; the data are smaller, easier to distribute, substantially less expensive to analyze and store, and faster to train (McQuin et al, 2018). However, it is likely some biological information is lost, because these tools might fail to measure all morphology signals. The so-called image-based profiling pipeline also loses information, by nature of aggregating inherently single-cell data to bulk consensus signatures (Caicedo et al, 2017).”

      3.4. Clarified future directions to infer cell health readouts from simulated polypharmacology cell states

      Reviewer 1: Authors also make the claim that they can infer toxicity and simulate the mechanism of how two compounds might react. This is a claim that would not be supported even if the method were able to successfully predict morphology or gene profiles. Drug interaction and toxicity are quite complex and goes beyond just morphology and expression. VAEs predicting a small set of features would not be able to capture information beyond the readouts, especially when dealing with potentially unseen compounds for which toxicity is not yet known. For example, two compounds might produce a morphology that appears similar to other safe compounds but has other factors that contribute to toxicity. Further, here they show no evidence of toxicity or interaction analysis.

      The reviewer is correct that such a claim is unsupported by our research. Our message was actually that inferring toxicity could be a potential future application of our work. Specifically, for example, we can apply orthogonal models of cell toxicity that we previously derived using other data (Way et al, 2021a) to our inferred polypharmacology cell states. We thank this reviewer for noticing our lack of clarity, and we have made changes in the discussion to make it clear that inferring toxicity is something we may do in the future and is not something that is discussed in the manuscript:

      “In the future, by predicting cell states of inferred polypharmacology, we can also infer toxicity using orthogonal models (e.g. Way et al. 2021) and simulate the mechanisms of how two compounds might interact.”

      3.5. Clarified our method of splitting data, and noting how a future analysis will answer overfitting extent

      Reviewer 2: Could authors outline detailed data splits? Which MoA are in train and which are held out from training? As I understood, there were samples from MoAs that were supposed to be predicted in the calculation of LSA? Generally, the predicted MoA should not be seen during training and not in LSA calculation.

      We now more explicitly detail how we split our data in the methods:

      “As input into our machine learning models, we split the data into an 80% training, 10% validation, and 10% test set, stratified by plate for Cell Painting and stratified by cell line for L1000. In effect, this procedure evenly distributes compounds and MOAs across data splits.”

      We also thank the reviewer for this comment, because they express an important concern about making sure that we are not overfitting to the data. We have explained in the manuscript that because of lack of data, MOAs were repeated in training and LSA. However, we believe overfitting is not playing a large role in model performance. Through our hold 5 out experiment, we are able to show that our models are able to predict the same MOAs irrespective of whether they were in the training data, indicating that we did not overfit to the distribution of certain MOAs.

      Reviewer 1 also suggested that we do the hold 5 out experiment on A∩Bs that were barely predicted. After we do that, we will explicitly demonstrate the extent of overfitting.

      3.6. Introduced acronyms when they first appear in the manuscript

      Reviewer 3: The Kullback-Leibler divergence is properly introduced in the methods part, but not at all in the introduction (it directly appears as "the KL divergence"). To enhance readability, it would be better to fully spell it before using the acronym, and maybe give a one-sentence intuition of what it is about before pointing out to the methods part for more details.

      We thank the reviewer for bringing this to our attention. We have carefully reviewed the entire manuscript and have corrected such instances of clear introductions to acronyms.

      3.7. Fixed minor text changes

      Reviewer 3: In Figure 1, I would recommend changing "compression algorithms" to "dimension reduction algorithm" or "embedding algorithm". In a compression setting, I would expect the focus to be on the number of bits of information each method requires (or the dimension of the resulting embedding) to encode the data while guaranteeing a certain quality threshold. This is obviously not the case here as the dimension of the embedding is fixed and the focus is on exploring how the embedding is constructed (eg how much it decorrelates the different features, etc) - which may be misleading.

      Reviewer 3: I recommend using "A n B" or "A & B" or "(A, B)" to denote the combination of two independent modes of action A and B. The current notation "A | B" overloads the statistical "A given B" which appears in the VAE loss and is therefore misleading.

      We agree with the reviewer, and aim to minimize all sources of potential confusion. We have made the change in the figure.

      We also agree that our current notation can be confusing. We have updated all instances of “A|B” with “A ∩ B”.

      3.8. Added hypothesis of MMD-VAE oscillations to supplementary figure legend

      Reviewer 3: Do the authors have a hypothesis of what may be causing MMD-VAE to oscillate during validation when data are shuffled? This seems to be the case on two of the three considered datasets (Figure 2 and SuppFigure 1) and is not observed for the other models. Including a few sentences on that in the text would be interesting.

      We believe a big reason for this is because of the fact that the optimal MMD-VAE had a much higher regularization term, which puts a greater emphasis on forming normal latent distributions, than the optimal Beta or Vanilla VAE. Forcing the VAE to encode a shuffled distribution into a normally distributed latent distribution would be difficult to do consistently across different randomly shuffled data subsets, and therefore might cause oscillations in the training curve across epochs when the penalty for that term is high. As these observations may be interesting to a certain population of readers, we have incorporated this explanation into the supplementary figure legend (which is where this figure is shown):

      “Forcing the VAE to consistently encode a shuffled distribution into a normally distributed latent distribution would be difficult, and therefore might cause oscillations in the training curve across epochs.”

      3.9. Explained our selection of VAE variants

      Reviewer 3: The different types of considered VAE and their differences are very clearly introduced. It may however be good to motivate a bit more the focus on beta-VAE and MMD-VAE among all the possible VAE models. This is partly done through examples in the second paragraph of page 2, but could be elaborated further.

      We thank the author for their encouraging remarks. We have made edits to the manuscript’s introduction, explaining why we chose these two variants out of all the possible choices:

      “We trained vanilla-VAEs, β-VAEs, and MMD-VAEs only, and not other VAE variants and other generative model architectures, such as generative adversarial networks (GANs), because these VAE variants are known to facilitate latent space interpretability.”

      1. Description of analyses that authors prefer not to carry out

      4.1. We will not explore additional latent space dimensions in more detail, as this is out of scope

      Reviewer 1: As both reconstructed and simulated data did not span the full original data distribution, it might be better to look at reconstruction error and increase the dimension of latent space.

      We thank the reviewer for bringing up this important point. Our VAE loss function consists of the sum of reconstruction error and some form of KL divergence. Specifically, this reviewer is suggesting that if we only minimize reconstruction error (or focus more on reconstruction over KLD by lowering beta), a higher latent dimension would result in better overall reconstruction. This is true, but doing so would have negative consequences. While we would perhaps get the UMAPs to show the full data distribution, the UMAPs are not our focus; predicting polypharmacology through LSA is. We found that when we have a higher focus on the reconstruction term, we have more feature entanglement, as indicated by lower performance when simulating data and overlapping feature contribution per latent feature. The fact that simulating data would logically require less disentanglement than performing LSA shows that we require higher regularization (and hence lower focus on reconstruction) than the one we got from simulating data.

      Essentially, while the reviewer's comments would improve reconstruction and allow us to improve the UMAPs, doing so would likely worsen LSA performance, which is the main focus of the project. Also, increasing the latent dimension without changing beta would likely have caused little to no change because since beta is encouraging disentanglement, it would cause the newly added dimension to have little variation and encode little new information that wasn’t already encoded before.

      We have also previously explored the concept of toggling the latent dimensions in a separate project (Way et al, 2020). We are very interested in this area of research in general, and any additional analyses (beyond hyperparameter optimization) deserves a much deeper dive than what we can provide in this paper.

      Lastly, we intend to include a deeper description and analysis of reconstruction loss across models, datasets, and MOAs as was suggested by a previous reviewer comment (see section 2.1 above)

      4.2. We will not review Gaussian distribution assumptions of the VAE as we feel it is not informative

      Reviewer 1: By looking at SFigure 6, I am wondering whether latent distribution actually met gaussian distribution (assumption of VAE). It may show skew distribution as some of latent features shows low contribution.

      This reviewer’s comment is interesting, but we do not believe it would change the findings of our study. Suppose we find that the latent dimensions aren’t normally distributed. This wouldn’t change much; a gaussian distribution isn’t the most critical to perform LSA. We need the latent code to be disentangled, but having normally distributed latent features doesn't necessarily mean that we have good disentanglement (see https://towardsdatascience.com/what-a-disentangled-net-we-weave-representation-learning-in-vaes-pt-1-9e5dbc205bd1)

      4.3. In this paper, we will not train or compare conditional VAEs nor cycle GANs

      Reviewer 2: While authors provided a comparison between vanilla VAE and MMD-VAE, B-VEA, there are other methods capable of doing similar tasks (data simulation, counterfactual predictions ), I would like to see a comparison with those methods such as conditional VAE( https://papers.nips.cc/paper/2015/hash/8d55a249e6baa5c06772297520da2051-Abstract.html, CVAE + MMD : https://academic.oup.com/bioinformatics/article/36/Supplement_2/i610/6055927?login=true) or cycle GANs(https://arxiv.org/abs/1703.10593 ).

      While such comparisons would be interesting, they are not the main focus of the manuscript, which is to benchmark the use of VAEs in cell morphology readouts and to predict polypharmacology.

      We think that CVAE would not be appropriate for our study. In a CVAE, the encoder and decoder are both conditioned to some variable. In our situation where we are predicting the cell states of different MOAs, it would make most sense to condition on the MOA. However, because we’re using the MOA labels in our LSA experiment, conditioning on them is likely to bias our results and not be effective for MOAs outside the conditioning.

      For cycle GANs, we have found that training using these data, in a separate study in our lab, is extremely difficult. Our lab has not published this yet, but once we are able to better understand cycleGAN behavior in these data, it will require a separate paper in which we compare performance and dissect model properties in much greater detail.

      Nevertheless, we have added citations to multi-modal approaches like cycle GANs (see section 4.4) as they will point a reader to useful resources for future directions.

      4.4. We will not be comparing with multi-modal integration, but we clarified our focus on Cell Painting VAE novelty and added multi-modal citations

      Reviewer 1: Researchers found that the optimal VAE architectures were very different between morphology and gene expression, suggesting that the lessons learned training gene expression VAEs might not necessarily translate to morphology. It would be interesting to compare the result with multimodal integration as baseline (i.e., Seurat).

      Our focus in this paper was to train and benchmark different variational autoencoder (VAE) architectures using Cell Painting data and to demonstrate an important, unsolved application in predicting polypharmacology that we show is now possible for a subset of compounds. It was a natural and useful extension to compare Cell Painting VAE performance with L1000 VAE performance especially since our data set contained equivalent drug perturbations. We feel that any extension including multi-modal data integration will distract focus away from the Cell Painting VAE novelty, and requires a much deeper dive beyond scope of our current manuscript.

      Additionally, there have been other, more in-depth and very recent multi-modal data integration efforts using the same or similar datasets (Caicedo et al, 2021; Haghighi et al, 2021). In a separate paper that we just recently submitted, we also dive much deeper to answer the question of how the two modalities complement one another in various ways and for various tasks (Way et al, 2021b). These two papers already provide a deeper and more informative exploration of Cell Painting and L1000 data integration.

      Therefore, because multi-modal data integration, while certainly interesting, will distract from the Cell Painting VAE novelty and is redundant with other recent publications, we feel it is beyond scope of this current paper.

      Nevertheless, multi-modal data integration is important to mention, so we add it to the discussion. Specifically, we discuss how multi-modal data integration might help with predicting polypharmacology in the future and include pertinent citations so that we, or another reader, might be able to follow-up in the future. The new section reads:

      “Because we had access to the same perturbations with L1000 readouts, we were able to compare cell morphology and gene expression results. We found that both models capture complementary information when predicting polypharmacology, which is a similar observation to recent work comparing the different technologies’ information content (Way et al, 2021). We did not explore multi-modal data integration in this project; this has been explored in more detail in other recent publications (Caicedo et al, 2021; Haghighi et al, 2021). However, using multi-modal data integration with models like CycleGAN or other style transfer algorithms might provide more confidence in our ability to predict polypharmacology in the future (Zhu et al, 2017).”

      1. References

      Caicedo JC, Cooper S, Heigwer F, Warchal S, Qiu P, Molnar C, Vasilevich AS, Barry JD, Bansal HS, Kraus O, et al (2017) Data-analysis strategies for image-based cell profiling. Nat Methods 14: 849–863

      Caicedo JC, Moshkov N, Becker T, Yang K, Horvath P, Dancik V, Wagner BK, Clemons PA, Singh S & Carpenter AE (2021) Predicting compound activity from phenotypic profiles and chemical structures. bioRxiv: 2020.12.15.422887

      Corsello SM, Bittker JA, Liu Z, Gould J, McCarren P, Hirschman JE, Johnston SE, Vrcic A, Wong B, Khan M, et al (2017) The Drug Repurposing Hub: a next-generation drug library and information resource. Nat Med 23: 405–408

      Haghighi M, Singh S, Caicedo J & Carpenter A (2021) High-Dimensional Gene Expression and Morphology Profiles of Cells across 28,000 Genetic and Chemical Perturbations. bioRxiv: 2021.09.08.459417

      McQuin C, Goodman A, Chernyshev V, Kamentsky L, Cimini BA, Karhohs KW, Doan M, Ding L, Rafelski SM, Thirstrup D, et al (2018) CellProfiler 3.0: Next-generation image processing for biology. PLoS Biol 16: e2005970

      Wang Y, Huang H, Rudin C & Shaposhnik Y (2021) Understanding how dimension reduction tools work: an empirical approach to deciphering t-SNE, UMAP, TriMAP, and PaCMAP for data visualization. J Mach Learn Res 22: 1–73

      Way GP, Kost-Alimova M, Shibue T, Harrington WF, Gill S, Piccioni F, Becker T, Shafqat-Abbasi H, Hahn WC, Carpenter AE, et al (2021a) Predicting cell health phenotypes using image-based morphology profiling. Mol Biol Cell 32: 995–1005

      Way GP, Natoli T, Adeboye A, Litichevskiy L, Yang A, Lu X, Caicedo JC, Cimini BA, Karhohs K, Logan DJ, et al (2021b) Morphology and gene expression profiling provide complementary information for mapping cell state. bioRxiv: 2021.10.21.465335

      Way GP, Zietz M, Rubinetti V, Himmelstein DS & Greene CS (2020) Compressing gene expression data using multiple latent space dimensionalities learns complementary biological representations. Genome Biol 21: 109

      Zhu J-Y, Park T, Isola P & Efros AA (2017) Unpaired Image-to-Image Translation using Cycle-Consistent Adversarial Networks. arXiv [csCV]

    1. s e t o t h e W e s t , w a s m a d e b e t t e r , a n d I w a s o u t f i t t e d i n t u r t l e n e c k s , s a i l o r s h i r t s , j e a n s , o v e r a l l s , s k i hats, l e a t h e r j a c k e t s , a n d t a i l o r e d s c h o o l u n i f o r m s t h a t a c t u a l l y h e l d t o g e t h e r . I t w a s a l l n e w , a n d i t c h e d m e h o r r i b l y ; l i k e m y f a t h e r , I h a t e d h a v i n g on m o r e t h a n I n e e d e d . W h e n m y m o t h e r ? s b e s t f r i e n d c a m e o v e r w i t h h e r d a u g h t e r , t h e g i r l cast l o n g i n g l o o k s a t m y c l o t h e s , a n d I at a l l t h e f o o d s h e l e f t o n h e r p l a t e .

      Clothing used to construct memories

  4. Oct 2021
    1. Singanayagam, A., Hakki, S., Dunning, J., Madon, K. J., Crone, M. A., Koycheva, A., Derqui-Fernandez, N., Barnett, J. L., Whitfield, M. G., Varro, R., Charlett, A., Kundu, R., Fenn, J., Cutajar, J., Quinn, V., Conibear, E., Barclay, W., Freemont, P. S., Taylor, G. P., … Lackenby, A. (2021). Community transmission and viral load kinetics of the SARS-CoV-2 delta (B.1.617.2) variant in vaccinated and unvaccinated individuals in the UK: A prospective, longitudinal, cohort study. The Lancet Infectious Diseases, 0(0). https://doi.org/10.1016/S1473-3099(21)00648-4

    1. Sun, W., Liu, Y., Amanat, F., González-Domínguez, I., McCroskery, S., Slamanig, S., Coughlan, L., Rosado, V., Lemus, N., Jangra, S., Rathnasinghe, R., Schotsaert, M., Martinez, J. L., Sano, K., Mena, I., Innis, B. L., Wirachwong, P., Thai, D. H., Oliveira, R. D. N., … Palese, P. (2021). A Newcastle disease virus expressing a stabilized spike protein of SARS-CoV-2 induces protective immune responses. Nature Communications, 12(1), 6197. https://doi.org/10.1038/s41467-021-26499-y

    1. Jeong, M., Ocwieja, K. E., Han, D., Wackym, P. A., Zhang, Y., Brown, A., Moncada, C., Vambutas, A., Kanne, T., Crain, R., Siegel, N., Leger, V., Santos, F., Welling, D. B., Gehrke, L., & Stankovic, K. M. (2021). Direct SARS-CoV-2 infection of the human inner ear may underlie COVID-19-associated audiovestibular dysfunction. Communications Medicine, 1(1), 1–14. https://doi.org/10.1038/s43856-021-00044-w

    1. SciScore for 10.1101/2021.10.25.21265476: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Participant recruitment and study approval – Toronto cohorts: Negative control serum samples were from patients enrolled in cancer studies pre-COVID-19 (prior to November 2019; Mount Sinai Hospital (MSH) Research Ethics Board (REB) studies #01-0138-U and #01-0347-U), which were archived and frozen in the Lunenfeld-Tanenbaum Research Institute (LTRI</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Recombinant antibody production: The llama single domain antibody (VHH) VHH72-hFc1X7 (VHH72-Fc) was described previously (PDB entry 6WAQ_1) (17); additional VHHs (NRCoV2-04 and NRCoV2-20) were isolated in-house from llamas immunized with recombinant SARS-CoV-2 trimeric spike ectodomain SmT1 (Supplementary Figure 2).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NRCoV2-20</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">VHH sequences were fused to an antibody-dependent cell-mediated cytotoxicity (ADCC)-attenuated human IgG1 Fc domain (hFc1X7, from patent US 2019 352 383A1).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>human IgG1 Fc domain ( hFc1X7</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The anti-human-IgG monoclonal antibodies (mAbs) IgG#5 and IgG#6 were derived from mice immunized with human IgG; heavy chain (HC) and light chain (LC) variable domain sequences (VH and VL) were fused to mouse IgG2a and mouse kappa LC constant sequences, respectively, to express full-length mAbs.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human-IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>mouse IgG2a</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 antibody-negative blood was spotted directly from EDTA Vacutainer tubes onto DBS cards.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All matched plasma and contrived DBS samples were tested using the anti-SARS-CoV-2 ELISA IgG kit (EUROIMMUN, Lübeck, Germany), according to the manufacturer’s instructions, to verify that donors were either positive or negative for SARS-CoV-2 antibodies prior to shipping to Toronto and Ottawa.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 ELISA IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For spike and its RBD, the recombinant antibodies used were VHH72-Fc IgG (NRC; see above), human anti-spike S1 IgG (clone HC2001, GenScript, #A02038), human anti-Spike S1 IgM (clone hIgM2001, GenScript, #A02046), and human anti-spike IgA (clone CR3022, Absolute Antibody, Oxford, United Kingdom, #Ab01680-16.0).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-spike S1 IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-Spike S1 IgM</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-spike IgA</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For N, the antibodies used were human anti-nucleocapsid IgG (clone HC2003, GenScript, #A02039)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-nucleocapsid IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">anti-nucleoprotein IgM (CR3018 (03-018), Absolute Antibody, #Ab01690 -15.0), and anti-nucleoprotein IgA (CR3018 (03-018), Absolute Antibody, #Ab01690 -16.0).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-nucleoprotein IgM</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-nucleoprotein IgA</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CR3018</div><div>suggested: (Imported from the IEDB Cat# CR3018, RRID:AB_2833185)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Negative control antibodies purified from human serum (final 1 µg/mL; human IgG, Sigma-Aldrich, Oakville, ON, Canada,</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>human IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Anti-human secondary antibodies (recombinant anti-human IgG#5-HRP, goat anti-human IgG Fcy-HRP (Jackson ImmunoResearch Labs, West Grove, PA, USA, #109-035-098)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Anti-human secondary</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human IgG#5-HRP</div><div>suggested: (Jackson ImmunoResearch Labs Cat# 109-035-098, RRID:AB_2337586)</div></div><div style="margin-bottom:8px"><div>anti-human IgG Fcy-HRP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, 100 μL samples of titrations of anti-SARS-CoV-2 S CR3022 Human IgG1 (Absolute Antibody, Ab01680-10.0), anti-SARS-CoV-2 S CR3022 Human IgA (Absolute Antibody, Ab01680-16.0), or anti-SARS-CoV-2 S CR3022 Human IgM (Absolute Antibody, Ab01680-15.0) were diluted in 1% w/v skim milk in PBST.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 S CR3022 Human IgG1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Human</div><div>suggested: (Imported from the IEDB Cat# CR3022, RRID:AB_2848080)</div></div><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 S CR3022 Human IgA</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 S CR3022 Human IgM</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The final isotype-specific secondary antibodies used were anti-human IgG#5-HRP (Supplementary Figure 3), anti-human IgA-HRP (Jackson ImmunoResearch Labs, 109-035-011), and anti-human IgM-HRP (Jackson ImmunoResearch Labs, 109-035-129).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgA-HRP</div><div>suggested: (SouthernBiotech Cat# 2050-05, RRID:AB_2687526)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Two concentrations of secondary antibody IgG#5-HRP (0.09 and 0.18 μg/mL) were assessed using dilution curves of the VHH72-Fc antibody (to detect spike and its RBD) or an anti-N antibody (to detect N; Supplementary Figure 7), and the best concentration (0.18 μg/mL) was further tested on a dilution series of 32 serum samples provided by CBS (Supplemental Figure 8).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>VHH72-Fc</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-N</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">We also tested anti-RBD NRCoV2-04 and NRCoV2-20 recombinant calibration antibodies, which were comparable to VHH72-Fc in reference curves (Supplementary Figure 7).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-RBD</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>NRCoV2-04</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For chemiluminescent assays, 10 µL of goat anti-human IgM-HRP (1:10,000; 0.80 ng/well) or goat anti-human IgA-HRP (1:12,000, 0.66 ng/well) were used as secondary antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgM-HRP</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Protein production: Spike trimer: The SARS-CoV-2 spike ectodomain construct (SmT1) with S1/S2 furin site mutations, K986P/V987P prefusion-stabilizing mutations, and human resistin as a trimerization partner (15) was produced using stably transfected Chinese Hamster Ovary (CHO) pools (CHOBRI/2353™ cells) and purified as described (8).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHOBRI/2353™</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The construct was expressed by transient gene expression in CHOBRI/55E1™ cells as described above (15).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHOBRI/55E1™</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">VHH and mAb sequences were synthesized by GenScript using C. griseus codon bias for expression in CHO cells and cloned into the pTT5™ plasmid.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHO</div><div>suggested: CLS Cat# 603479/p746_CHO, RRID:CVCL_0213)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The ACE2-BAP cDNA was expressed by transient gene expression in CHOBRI/55E1 cells as described (15) with the addition of 5% (w/w) pTT5™-BirA (an Escherichia coli biotin ligase) expression plasmid as described previously (18).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHOBRI/55E1</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Nucleocapsid: N cDNA (corresponding to amino acids 1–419 of YP_009724397) was synthesized by GenScript (Piscataway, NJ, USA; using Cricetulus griseus codon bias) with a C-terminal FLAG-Twin-Strep-tag-(His)6 tag and cloned into the pTT5 expression plasmid (NRC) to create NCAP (16).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pTT5</div><div>suggested: RRID:Addgene_52326)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Amino acids 331–521 of the SARS-CoV-2 spike protein (YP_009724390.1) corresponding to the RBD were cloned into the pTT5™ vector using EcoRI and BamHI.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pTT5™</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The ACE2-BAP cDNA was expressed by transient gene expression in CHOBRI/55E1 cells as described (15) with the addition of 5% (w/w) pTT5™-BirA (an Escherichia coli biotin ligase) expression plasmid as described previously (18).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pTT5™-BirA</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Ottawa: Samples from DBS cards were punched manually or in a semi-automated manner using a PerkinElmer DBS puncher (PerkinElmer, Woodbridge, ON, Canada; 3.2 mm discs) or a BSD600 Ascent puncher (BSD Robotics; 3 mm discs) and eluted in 100 μL/disc PBS + 1% Triton X-100 for up to 16 h (minimum 4 h) in 96-well U-bottom plates on a shaker at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Canada</div><div>suggested: (Brain Canada, RRID:SCR_005053)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Other data analyses: Plots were generated in R using the ggplot2, lattice, latticeExtra, grid, and gridExtra packages.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ggplot2</div><div>suggested: (ggplot2, RRID:SCR_014601)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.22.21265255: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Clinical specimens: Use of deidentified remnant clinical specimens from University of Washington Virology Laboratory (UWVL) for SARS-CoV-2 testing was approved by the University of Washington Institutional Review Board.<br>Field Sample Permit: Laboratory-confirmed specimens used in this study came from nasal or nasopharyngeal swabs collected in either PBS or viral transport media that had >500 μL volume remaining.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero E6-TMPRSS2 cells (obtained from the JCRB Cell Bank, JCRB No. JCRB1819) were inoculated with 100 μL of clinical sample, inoculated for 1 hour at 37ºC with rocking, washed with PBS, and overlaid with 1 ml standard Vero media containing 2% FBS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6-TMPRSS2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">LDA), Abbott m2000 (Abbott Laboratories, Chicago, IL, USA)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Abbott Laboratories</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Swift SNAP library preparation and quality control: Using SuperScript™ IV First-Strand Synthesis System (ThermoFisher, Waltham, MA, USA), 11 μL of extracted RNA was subjected to single-strand complementary DNA (sscDNA) synthesis, and 10 μL of the resulting sscDNA was used for library preparation using the Swift SARS-CoV-2 SNAP Version 2.0 kit (Swift Biosciences™, Ann Arbor, MI, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SNAP</div><div>suggested: (SNAP, RRID:SCR_007936)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Positive and negative controls were included on each run, and only sequencing runs with > 50% reads passing filter (PF) and > 60% of bases exceeding Phred quality scores of 30 (Q30) were accepted.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Phred</div><div>suggested: (Phred, RRID:SCR_001017)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For Sanger sequencing, reads were imported into Geneious (v9.1.8, Biomatters, Auckland, New Zealand), trimmed with an error probability limit of 0.005, mapped to the reference Spike sequence (NC_045512.2: 21563-25384), and manually trimmed to the start and stop codons for Spike.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Geneious</div><div>suggested: (Geneious, RRID:SCR_010519)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Probit analysis to determine limit of detection calculations was performed in SPSS (v26, IBM, Armonk, NY).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SPSS</div><div>suggested: (SPSS, RRID:SCR_002865)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For SAREPI orders (requested for outbreak/cluster investigations), consensus sequences passing QC criteria are aligned using MAFFT v7.45 and the total number of pairwise nucleotide differences between sequences is reported as a table along with SARSEQ results.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MAFFT</div><div>suggested: (MAFFT, RRID:SCR_011811)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Bioinformatic pipeline validation: To assess the performance of our bioinformatic pipeline and data processing steps, we used a set of benchmark datasets from the CDC (https://github.com/CDCgov/datasets-sars-cov-2).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Bioinformatic</div><div>suggested: (QFAB Bioinformatics, RRID:SCR_012513)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      One of the limitations of short-read sequencing using reference-based approaches is the reduced ability to identify large structural variants, long indels, and tandem duplicates. Long deletions often manifest as low coverage regions masked with ambiguous bases (Ns) and require manual review to confirm that they are deletions vs. amplicon dropouts. In the current study, we saw one example of this, and we have previously identified similar deletions in ORFs 7a, 7b, and 8 using Swift55. Taken together, our results demonstrate the high sensitivity, specificity, and reproducibility of the Swift SNAP amplicon panel for SARS-CoV-2, which make it ideal for clinical applications. Our protocol is available at https://www.protocols.io/view/uw-virology-swift-snapv2-protocol-byw4pxgw with options for automation via robotic liquid handling systems. In addition, our study provides a framework for validating amplicon sequencing methods which have proved to be an important tool in our fight against COVID-19 and will be for other emerging pathogens.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Reviewer #1 (Public Review): 

      The manuscript by Ahmad et al. reports on the high-resolution crystal structures of sugar and a β-lactam molecule binding to an allosteric site of Mycobacterium tuberculosis L,D-transpeptidase (LdtMt2). The structural changes upon dual ligand binding highlight the structural alterations that span across the allosteric pocket and the catalytic site. The authors systematically mutate residues in both, the allosteric site and the catalytic site and use biochemical assays to show how they are linked. 

      Strengths: <br> Structural, biochemical and Mutagenesis experiments <br> (a) High-resolution crystal structures of LdtMt2 with ligands in both allosteric site and orthosteric site. <br> (b) The study unequivocally demonstrates that residue S351 forms a part of the catalytic triad and not S337, as previously reported in the literature. <br> (c) Residue R209 in the allosteric pocket is directly linked to the catalytic activity. 

      Weakness: <br> Computational studies <br> (a) How exactly are the two sites structurally linked across a distance of >20Å is not explained.

    1. M. Czerwinski, A. Natarajan, L. Barske, L. L. Looger, B. Capel, Dev. Biol. 420, 166–177 (2016).

      Czerwinski et al. completed sequencing for the total RNA in T.scripta embryos at MPT and FPT before gonad development and during gonad development. This allowed authors to classify male- and female-specific gene expression during sex development.

    1. Author Response:

      Reviewer #1:

      The manuscript entitled, "Early evolution of beetles regulated by the end-Permian deforestation" by Zhao et al. is a strong, interesting, and well-written study worthy of publication after revision.

      The authors met their goal of documenting and analyzing the diversity of Paleozoic beetle taxonomy, morphological disparity, ecosystem roles, and phylogeny. This, in my opinion, is the strongest portion of the paper as it brings several lines of evidence to show the high diversity of xylophagous beetles, up until the EPME, followed by a distinct extinction of xylophagous beetles and the expansion of ecological roles into a more modern component of beetles.

      A distinct weakness of the paper is the reliance of correlation between biochemical cycling and the evolution of beetles. To address this, we would ideally see isotopic data associated with these statements. My overall suggestion is to make clear that this is speculative and bring other hypotheses to the table, and hopefully rule them out. It isn't very helpful to say something like xylophagous beetles were the main source of nutrient cycling in the Permian without discussing fungus at greater length. Or similarly, implying a drop in O2 was caused by beetles, without describing any of the other biotic/abiotic things going on at that time.

      We really appreciate those insightful comments, and completely agreed that the correlation between carbon cycling and Permian beetles is speculative. We followed the reviewer’s suggestion and toned down the discussion about this correlation. The role of ancient insects in deep-time forest carbon cycle is unclear, partly because the contribution of extant insects to the decomposition of deadwood is poorly understood. Fortunately, a paper published last month reveals the functional importance of insects in the decomposition of deadwood and the forest carbon cycle (Seibold et al., 2021), and thus provide a further support for our conclusion. We added this reference to our paper. Moreover, regarding the Permian biochemical cycling change, we also have added an introduction about other two hypotheses (reduction in the extent of coal swamps and the evolution of lignin-consuming fungi) and ruled them out in the Discussion.

      Please see lines 237–249:

      “The oxygen concentration of the atmosphere began to rise in the early Palaeozoic, probably with a peak in the Carboniferous and large decline from the beginning of the Permian (Dahl et al., 2010; Berner, 2009; Krause et al, 2018). The reason for this plunge was attributed to a tectonic- or climate-driven reduction in the extent of coal swamps (Berner and Canfield, 1989) or to the evolution of lignin-consuming fungi (Floudas et al., 2012). However, global recoverable coal is only equivalent to a few percent of the oxygen budget in the atmosphere, and thus cannot account for the large drop of atmospheric oxygen (Nelsen et al., 2016). Furthermore, lignin-consuming fungi may have been present before the Carboniferous (Nelsen et al., 2016). Recently, a new geochemical model proposed that the development of Permian terrestrial herbivores may have limited transport and long-term burial of terrestrial organic compounds in marine sediments, resulting in less organic carbon burial and attendant declines in atmospheric oxygen (Laakso et al., 2020).”

      Please see lines 261–264:

      “In extant forest ecosystems, insects may account for 29 percent of the total carbon flux from deadwood and thus they have a functional importance in the decomposition of deadwood and the carbon cycle (Seibold et al., 2021).”

      Please see lines 266–269:

      “Permian beetles had probably evolved close interactions with various microorganisms especially lignin-consuming fungi (Nelsen et al., 2016), which also accelerated the decomposition of deadwood.”

      We have added 7 references.

      Berner RA. 2009. Phanerozoic atmospheric oxygen: new results using the GEOCARBSULF model. American Journal of Science 309: 603–606.

      Dahl TW, Hammarlund EU, Anbar AD, Bond DPG, Gill BC, Gordon GW, Knoll AH, Nielsen AT, Schovsbo NH, and Canfield DE. 2010. Devonian rise in atmospheric oxygen correlated to the radiations of terrestrial plants and large predatory fish. PNAS 107: 17911–17915.

      Krause AJ, Mills BJW, Zhang S, Planavsky NJ, Lenton TM, Poulton SW. 2018. Stepwise oxygenation of the Paleozoic atmosphere. Nature Communications 9: 4081.

      Berner RA, Canfield DE. 1989. A new model for atmospheric oxygen over Phanerozoic time. American Journal of Science 289: 333–361.

      Nelsen MP, DiMichele WA, Peters SE, Boyce CK. 2016. Delayed fungal evolution did not cause the Paleozoic peak in coal production. PNAS 113: 2442–2447.

      Floudas TD, Binder M, Riley R, Barry K, Blanchette RA, Henrissat B, Martínez AT, Otillar R, Spatafora JW, Yadav JS, Aerts A, Benoit I, Boyd A, Carlson A, Copeland A, Coutinho PM, Vries RPD, Ferreira P, Findley K, Foster B, Gaskell J, Glotzer D, Górecki P, Heitman J, Hesse C, Hori C, Igarashi K, Jurgens JA, Kallen N, Kersten P, Kohler A, Kües U, Kumar TKA, Kuo A, Labutti K, Larrondo LF, Lindquist E, Ling A, Lombard V, Lucas S, Lundell T, Martin R, Mclaughlin DJ, Morgenstern I, Morin E, Murat C, Nagy LG, Nolan M, Ohm RA, Patyshakuliyeva A, Rokas A, Ruiz-Dueñas FJ, Sabat G, Salamov A, Samejima M, Schmutz J, Slot JC, John FSt, Stenlid J, Sun H, Sun S, Syed K, Tsang A, Wiebenga A, Young D, Pisabarro A, Eastwood DC, Martin F, Cullen D, Grigoriev IV, Hibbett DS. 2012. The Paleozoic origin of enzymatic lignin decomposition reconstructed from 31 fungal genomes. Science 336: 1715–1719.

      Seibold S, Rammer W, Hothorn T, Seidl R, Ulyshen MD, Lorz J, Cadotte MW, Lindenmayer DB, Adhikari YP, Aragón R, Bae S, Baldrian P, Varandi HB, Barlow J, Bässler C, Beauchêne J, Berenguer E, Bergamin RS, Birkemoe T, Boros G, Brandl R, Brustel H, Burton PJ, Cakpo-Tossou YT, Castro J, Cateau E, Cobb TP, Farwig N, Fernández RD, Firn J, Gan KS, González G, Gossner MM, Habel JC, Hébert C, Heibl C, Heikkala O, Hemp A, Hemp C, Hjältén J, Hotes S, Kouki J, Lachat T, Liu J, Liu Y, Luo YH, Macandog DM, Martina PE, Mukul SA, Nachin B, Nisbet K, O’Halloran J, Oxbrough A, Pandey JN, Pavlíček T, Pawson SM, Rakotondranary JS, Ramanamanjato JB, Rossi L, Schmidl J, Schulze M, Seaton S, Stone MJ, Stork NE, Suran B, Thygeson AS, Thorn S, Thyagarajan G, Wardlaw TJ, Weisser WW, Yoon S, Zhang NL, Müller J. 2021. The contribution of insects to global forest deadwood decomposition. Nature 597: 77–81.

      Below are some more detailed suggestions:

      -It would be helpful to address the evolution of lignin-consuming fungi. Whether or not you can tie fungal symbiosis into the evolution of these beetles, fungal decomposition may (or may not) have accelerated in the Early Permian due to the timeline of particular clades of fungi. Worth a quick sentence or two. See relevant references below.

      Nelsen, M.P., DiMichele, W.A., Peters, S.E. and Boyce, C.K., 2016. Delayed fungal evolution did not cause the Paleozoic peak in coal production. Proceedings of the National Academy of Sciences, 113(9), pp.2442-2447.

      Floudas D, et al. (2012) The Paleozoic origin of enzymatic lignin decomposition reconstructed from 31 fungal genomes. Science 336(6089):1715-1719.Abstract/FREE Full TextGoogle Scholar

      Kohler A, et al., Mycorrhizal Genomics Initiative Consortium (2015) Convergent losses of decay mechanisms and rapid turnover of symbiosis genes in mycorrhizal mutualists. Nat Genet 47(4):410-415.CrossRefPubMedGoogle Scholar

      Thank you very much for pointing out this issue. We complete agreed with the reviewer that Permian beetles had probably evolved close interactions with fungi, which also accelerated the decomposition of deadwood. We have revised the text and added the references based on the reviewer’s comments and suggestions. Please see comment 1.

      For the concluding paragraph in the Discussion, there is no acknowledgment to modern studies of xylophagous beetles in relation to climate change. There are many studies of the effects on climate change and xylophagous beetles, ex the North American pine bark beetles. Might be worth saying that the diversity and abundance of xylophagous beetles are extremely sensitive to climate change and can cause forest collapse too.

      Thank you. We have added a sentence and two new references about extant xylophagous beetles and climate change in the concluding paragraph. Please see lines 328–330:

      “In particular, the diversity and abundance of xylophagous beetles are extremely sensitive to climate change and can also cause forest collapse and carbon cycle disturbance (Kurz et al., 2008; Fei et al., 2019; Šamonil et al., 2020).”

      Kurz WA, Dymond CC, Stinson G, Rampley GJ, Neilson ET, Carroll AL, Ebata T, Safranyik L. 2008. Mountain pine beetle and forest carbon feedback to climate change. Nature 452: 987–990.

      Šamonil P, Phillips JD, Pawlik Ł. 2020. Indirect biogeomorphic and soil evolutionary effects of spruce bark beetle. Global and Planetary Change 195: 103317.

    1. This review reflects comments and contributions by Sónia Gomes Pereira, Julia Grzymkowski and Wasim Sayyad.

      The authors reported an improved method called nano-PrOteomics sample Preparation (nPOP) to quantify single-cell proteomics and its use in cell cycle analysis. The high throughput sample preparation method uses CellenOne cell sorting and liquid handling system which overcome the limitations of their previously proposed method Minimal ProteOmics sample Preparation (mPOP method) by reducing the sample volume 100-fold to a few nanoliters. The nPOP Workflow is explained very clearly. The Cell Cycle Analysis data presented in Figure 4 is an interesting validation of the technique, which seems really useful for single cell-omics studies.

      The text in the paper could be tidied up slightly, especially surrounding Figure 1. Some minor issues which can be easily addressed:

      • Please provide the full forms of some of the abbreviations used (e.g. SILAC, SP3, iST, RI, or TMT).
      • There are some missing labels of subpanels in the Figures or the text. E.g.

      a) Subpanel Fig. 1c and 1d mentioned in the text are missing in Fig. 1 as well as in the legend.

      b) On page 5 and line 7 (PDF file), Fig. 2b should be mentioned at the end of the sentence “After 20 minutes of cell lysis, …”.

      c) On page 7 (PDF file), ‘The relatively low CV values indicate that protein quantification derived from different peptides is internally consistent, Fig. 3c.’ - Fig. 3c should read Fig. 3b.

      The samples were then diluted and combined for digestion. These results suggest that DMSO allows for efficient cell lysis without detectable biases against proteins originating from different cell compartments, Fig. 1a’ - There may be a sentence missing here to explain the graph in Fig. 1a. The first sentence describes the last part of the method and the next sentence starts with "These results suggest…", though no results were discussed. Perhaps the reference to Fig. 1a should be updated to refer to other figure panels.

      We lysed U-937 monocytes and Jurkat T-cells with both DMSO and urea and compared the protein ratios estimated from the cells lysed with DMSO and with urea, Fig. 1c. U-937 monocytes cultured in heavy SILAC media and Jurkat T-Cells cultured in standard media were combined in equal amounts and lysed with either 90 % DMSO or 6M urea as shown in Fig. 1c.’ - Consider condensing this fragment into a single sentence.

      This gave us further confidence that DMSO lysis is well suited for miniaturizing sample preparation on an open surface without using MS-incompatible chemicals’ - The confidence in using DMSO for lysis and therefore avoiding the use of "MS-incompatible chemicals" is supported. However, based solely on the information given in the paragraph and in Figure 1a, it is unclear how conclusions can be made about "miniaturizing sample preparation on an open surface," because it looks like the method was done in centrifuge tubes. Can more detail be provided about steps taken to establish whether DMSO lysis is suited for this miniaturization?

      The addition brings the total volume to 13.5 nl, Fig. 2a. Samples are digested by 75 ng/μl trypsin for 5 hours’ - In the Methods it is stated that the volume is 14 nl and the trypsin concentration is 100 ng/ul. Suggest checking these details for consistency and accuracy. As in Fig. 1a the trypsin is given in nl (10nl), maybe both values should be in the text (e.g. 10nl of 75 ng/ul).

      room temperature’ - Room temperature can mean different values in different countries. Could the authors clarify or provide a range of temperatures? This might be particularly important when taking into consideration the drying of samples with such reduced volumes.

      Figure 2

      • a) A schematic of the nPOP sample preparation method illustrates the steps of cell lysis, protein digestion, peptide labeling with TMT, and quenching with two additions of hydroxylamine’ - The drying of the droplets appears to be done without the use of the nozzle. If this is correct, suggest removing it from this particular stage on the scheme. Also, please note that each incubation with hydroxylamine was indicated as lasting 20min (so a total of 40min), but the scheme indicates 1h.
      • A suggestion for the visualization of Figure 2a is to divide the sections using vertical dashed lines into the following sections: Cell isolation - Lysis – Digestion - Labeling – Quenching - Pooling
      • ‘(c) Total ion current chromatograms from three runs demonstrate low contaminants and consistent chromatography’ - This could be discussed in the text.

      To improve the recovery of labeled peptides, the footprint of each array is washed by 4 μl of acetonitrile, which is collected and added to the corresponding combined set. This wash is option and used to maximize the recovery of labeled peptides from the slide.’ - Suggest rephrasing this fragment to "To improve the recovery of labeled peptides, an optional step of washing the footprint of each array…"

      Figure 3 ‘The consistency of protein quantification is estimated as the coefficient of variation (CV) of the relative levels of peptides originating from the same protein. The median CVs per cells are tightly distributed, suggesting high consistency of sample preparation’ - It is not immediately clear what the pink and black numbers of cells represent; this could be clarified in the legend or in the text.

      Similar to previous analysis the protein ratios in bulk samples agreed well with ratios in the single cells single cells’ - ‘single cells’ is duplicated.

      A Pearson correlation of 0.8 indicates that the single-cell protein quantification is consistent with the proteomic measurements of established bulk method’ - Fig. 3d should be mentioned at the end of this sentence.

      Figure 4

      • Figure 4b, 'The boxplots display distributions for correlations between the phase markers and proteins from the large ribosomal subunit assembly GO term'- In the image itself it's written "Microtubule-based process," so please clarify what is shown on the boxplots.
      • Figure 4c - as in b, please clarify in the legend what the boxplots represent.
      • Methods ‘for a final concentration of 100 ng/μl of trypsin’ - as mentioned above, in the main text the value indicated for trypsin concentration is 75ng/ul, can this be clarified?
    1. Abstract

      This paper has been reviewed by GigaByte Journal and all peer reviews are shared CC-BY 4.0.

      Reviewer 1. Claudius F Kratochwil. Is the language of sufficient quality?<br> No. The text is understandable, but has many grammatical errors. The manuscript would greatly improve through language editing.

      Are all data available and do they match the descriptions in the paper?<br> Yes. I did not check every single file, but all data I looked for I found to be publicly available. It would help if the "Availability of supporting data and materials" statement would be a bit more comprehensive. Data A is deposited under X, Data B is deposited under Y-Z instead of just providing the project ID.

      Are the data and metadata consistent with relevant minimum information or reporting standards? Yes. To the best of my knowledge. Not my area of expertise.

      Is the data acquisition clear, complete and methodologically sound?<br> No. I was lacking information about the transcriptomic data (it says in line 44 that RNA was extracted) that was used for the annotation? Was RNA only extracted from the muscle? Maybe the caveats that go along with that should be discussed. How was the data processed? How many reads etc. I think the manuscript lacks information about this unless I misunderstood where the data for the "transcript-based prediction" came from. Then this should be indicated more clearly.

      Is there sufficient detail in the methods and data-processing steps to allow reproduction?<br> Yes. To the best of my knowledge. I am not an expert on this. Minor comments: l 46: Which protocol?

      Is there sufficient data validation and statistical analyses of data quality?<br> Not my area of expertise. One thing that could be probably additionally done is to provide dot plots with the 1-2 more closely related species with chromosome level assemblies (probably Tilapia or Medaka).

      Is the validation suitable for this type of data?<br> Yes. As far as I can judge the analysis is fine.

      Is there sufficient information for others to reuse this dataset or integrate it with other data?<br> Yes. Genome and annotation are available, which is the most important for reuse and integration with other data sets. So as far as I can judge there is sufficient information for others.

      Any Additional Overall Comments to the Author:<br> From my viewpoint, this is a useful chromosome-level genome, so I support its publication. Beyond being a useful resource, I was however a bit disappointed by the 'scientific part' regarding the bi-color body formation. While the pigmentation of the bicolor angelfish is certainly a very exciting phenotype, the analysis performed is far too superficial to give any solid insights into the phenotype. I would suggest the authors toning this down in title, abstract and main text. It is fine to mention this as a future research direction and to state that the performed initial analysis (fig. 6 and 7) might aid these investigations, but the data does not permit further conclusions. Especially as GigaByte does not focus on analyses for biological findings, this should be completely sufficient.

      Recommendation: Major Revision

      Re-Review: I am happy with the changes made and thank the authors for addressing them. The manuscript is in my opinion acceptable for publication. Congratulations to the authors for providing a reference genome for this exciting fish species to the community.

    1. SciScore for 10.1101/2021.10.21.465254: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Later the cells were incubated with the secondary anti-Rabbit IgG antibody conjugated with Alexa Fluor 488 (Life Technologies, Cat. no.: A11008; Lot no.: 1735088) at the dilution of 1:200 in 1% BSA made in PBS. Rhodamine Phalloidin (Life Technologies, Cat. no.: R415; Lot no.: 1738179) was used to label F-actin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Rabbit IgG</div><div>suggested: (Thermo Fisher Scientific Cat# A-11008, RRID:AB_143165)</div></div><div style="margin-bottom:8px"><div>F-actin</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After the incubation, virus inoculum containing melittin & gramicidin S was added to the Vero cells in duplicates (50μl /well).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: CLS Cat# 605372/p622_VERO, RRID:CVCL_0059)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Network and pathway analysis of the associated proteins were performed using STRING v11.5</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>STRING</div><div>suggested: (STRING, RRID:SCR_005223)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The data analysis and graphs were generated using GraphPad Prism (Ver 8.4.2).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on pages 25 and 23. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.21.465252: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">2.1 Mice: Male and female BALB/c and K18-hACE2 mice (aged 6–10 weeks) were obtained from the HKU Laboratory Animal Unit</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2.8 Surface and intracellular cytokine staining (ICS): The lung cells of mice were washed one time with staining buffer (PBS contained 2% FBS) followed by staining with anti-mouse antibodies for 30 min at 4 □, including dead cell dye (Zombie Aqua, Biolegend Cat# 423102), CD19-FITC (Biolegend Cat# 152404, RRID: AB_2629813), CD11b-PerCP/Cy5.5 (Biolegend Cat# 101228, RRID: AB_893232), CD11c-PE-Cy7 (Biolegend Cat# 117318, RRID: AB_493568), Ly6c-APC-Fire750 (BioLegend Cat# 128046, RRID: AB_2616731), F4/80-BV421 (Biolegend Cat# 123137, RRID: AB_2563102), Ly6G-PE (BioLegend Cat# 127608, RRID: AB_1186099), CD103-BV785 (Biolegend Cat# 121439, RRID: AB_2800588) and I-A/I-E-BV605 (Biolegend Cat# 107639, RRID: AB_2565894).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse</div><div>detected: (BioLegend Cat# 127608, RRID:AB_1186099)</div></div><div style="margin-bottom:8px"><div>CD19-FITC</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-mouse antibodies</div><div>detected: (BioLegend Cat# 152404, RRID:AB_2629813)</div></div><div style="margin-bottom:8px"><div>CD11b-PerCP/Cy5.5</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div></div><div>detected: (BioLegend Cat# 101228, RRID:AB_893232)</div></div><div style="margin-bottom:8px"><div>CD11c-PE-Cy7</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div></div><div>detected: (BioLegend Cat# 117318, RRID:AB_493568)</div></div><div style="margin-bottom:8px"><div>Ly6c-APC-Fire750</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div></div><div>detected: (BioLegend Cat# 128046, RRID:AB_2616731)</div></div><div style="margin-bottom:8px"><div>F4/80-BV421</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div></div><div>detected: (BioLegend Cat# 123137, RRID:AB_2563102)</div></div><div style="margin-bottom:8px"><div>Ly6G-PE</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>CD103-BV785</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div></div><div>detected: (BioLegend Cat# 121439, RRID:AB_2800588)</div></div><div style="margin-bottom:8px"><div>I-A/I-E-BV605</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>I-A/I-E-BV605</div><div>detected: (BioLegend Cat# 107639, RRID:AB_2565894)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After overnight incubation, cells were washed with staining buffer (PBS containing 2% FBS) and surface stained with anti-mouse-CD4-PerCP/Cy5.5 (Biolegend Cat# 116012, RRID: AB_2563023), anti-mouse-CD8-BV785 (Biolegend Cat# 100750, RRID: AB_2562610)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>with anti-mouse-CD4-PerCP/Cy5.5</div><div>detected: (BioLegend Cat# 116012, RRID:AB_2563023)</div></div><div style="margin-bottom:8px"><div>anti-mouse-CD8-BV785</div><div>detected: (BioLegend Cat# 100750, RRID:AB_2562610)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, anti-mouse CD69-BV711 (Biolegend Cat# 104537, RRID: AB_2566120) and anti-mouse CD103-BV421 (Biolegend Cat# 121422, RRID: AB_2562901)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-mouse CD69-BV711</div><div>detected: (BioLegend Cat# 104537, RRID:AB_2566120)</div></div><div style="margin-bottom:8px"><div>anti-mouse</div><div>detected: (BioLegend Cat# 121422, RRID:AB_2562901)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For intracellular staining, cells were fixed and permeabilized with BD Cytofix/Cytoperm (BD Biosciences) prior to staining with anti-mouse-IFN-γ-APC (Biolegend Cat# 505810, RRID: AB_315404), anti-mouse-TNF-α-PE (Biolegend Cat# 506306, RRID: AB_315427) and anti-mouse-IL-2-PE-Cy7 (Biolegend Cat# 503832, RRID: AB_2561750)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>with anti-mouse-IFN-γ-APC</div><div>detected: (BioLegend Cat# 505810, RRID:AB_315404)</div></div><div style="margin-bottom:8px"><div>anti-mouse-TNF-α-PE</div><div>detected: (BioLegend Cat# 506306, RRID:AB_315427)</div></div><div style="margin-bottom:8px"><div>anti-mouse-IL-2-PE-Cy7</div><div>detected: (BioLegend Cat# 503832, RRID:AB_2561750)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For identification and localization of SARS-CoV-2 nucleocapsid protein (NP) in organ tissues, IF staining was performed on deparaffinized and rehydrated tissue sections using rabbit anti-SARS-CoV-2-N protein antibody together with AF568-conjugated goat anti-rabbit IgG (Invitrogen).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2 nucleocapsid protein (NP</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-SARS-CoV-2-N protein</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-rabbit IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After blocking with 0.1% Sudan black B for 15 min and 1% bovine serum albumin (BSA)/PBS at RT for 30 min, the primary antibody rabbit anti-SARS-CoV-2-N antibody (1:4000 dilution with 1% BSA/PBS) was incubated at 4°C overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2-N</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2.2 Cell lines: HEK 293T-hACE2 and Vero E6 cells (RRID:CVCL_0574) were maintained in Dulbecco’s Modified Eagle Medium (DMEM) (Thermo Fisher Scientific) containing 10% fetal bovine serum, 2 mM L-glutamine and 100 U/mL penicillin and were incubated at 37□ in 5% CO2 setting (22). 2.3</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293T-hACE2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Vero E6</div><div>detected: (IZSLER Cat# BS CL 87, RRID:CVCL_0574)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viruses: Confluent Vero-E6 cells were infected at 0.01 MOI with live SARS-CoV-2 HKU-13 strain (GenBank accession number MT835140).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plasmid DNA transfection into HEK 293T cells was performed using polyethylenimine (PEI), and protein expression was detected by Western blot.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293T</div><div>suggested: CCLV Cat# CCLV-RIE 1018, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To rescue the virus, eight pHW2000 plasmids containing the DelNS1-RBD and the other 7 influenza virus genomic segments, together with an NS1 expression plasmid, were transfected into 293T cells using Transit-LT1 (Mirus) according to the manufacturer protocol.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: CCLV Cat# CCLV-RIE 1018, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viruses were aliquoted and titrated by plaque assay using MDCK cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MDCK</div><div>suggested: CLS Cat# 602280/p823_MDCK_(NBL-2, RRID:CVCL_0422)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2.1 Mice: Male and female BALB/c and K18-hACE2 mice (aged 6–10 weeks) were obtained from the HKU Laboratory Animal Unit</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>K18-hACE2</div><div>suggested: RRID:IMSR_GPT:T037657)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The transduced BALB/c mice or K18-ACE2 transgenic mice were intranasally infected with live wild type SARS-CoV-2 (HKU clone 13) at a dose of 1×104 PFU.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BALB/c</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">vaccine: Codon-optimized SARS-CoV-2 RBD gene was in fusion to a human soluble PD1 domain (PD1-RBD) using the pVAX plasmid as the backbone.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pVAX</div><div>suggested: RRID:Addgene_141350)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The pHW2000-DelNS1-RBD plasmid was constructed by inserting the tPA-linked RBD between the noncoding region (NCR) and autoproteolytic cleavage site (2A) in the pHW2000-DelNS1 plasmid.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHW2000-DelNS1-RBD</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pHW2000-DelNS1</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To rescue the virus, eight pHW2000 plasmids containing the DelNS1-RBD and the other 7 influenza virus genomic segments, together with an NS1 expression plasmid, were transfected into 293T cells using Transit-LT1 (Mirus) according to the manufacturer protocol.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHW2000</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In brief, different SARS-CoV-2 pseudotype viruses were generated through co-transfection of 293T cells with 2 plasmids, pSARS-CoV-2 S and pNL4-3Luc_Env_Vpr, carrying the optimized SARS-CoV-2 S gene and a human immunodeficiency virus type 1 backbone, respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pNL4-3Luc_Env_Vpr</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Area under the curve (AUC) was measured using GraphPad Prism v8, setting the baseline with the defined endpoint (average of negative control wells + 10 standard deviation) and taking the total peak area as previous described (27).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For intracellular staining, cells were fixed and permeabilized with BD Cytofix/Cytoperm (BD Biosciences) prior to staining with anti-mouse-IFN-γ-APC (Biolegend Cat# 505810, RRID: AB_315404), anti-mouse-TNF-α-PE (Biolegend Cat# 506306, RRID: AB_315427) and anti-mouse-IL-2-PE-Cy7 (Biolegend Cat# 503832, RRID: AB_2561750)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BD Cytofix/Cytoperm</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Stained cells were acquired by FACSAriaIII Flow Cytometer (BD Biosciences) and analyzed with FlowJo software (v10.6) (BD Bioscience).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All tissue sections were examined, the images were captured with a Carl Zeiss LSM780 confocal microscope, and the mean fluorescence intensity (MFI) was further measured by ImageJ v1.53c.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2.12 Statistical analysis: Statistical analysis was performed with the GraphPad Prism 8 Software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Although intramuscular electroporation delivery has potential limitation for DNA vaccination in large populations, this approach has demonstrated the safety, tolerability and immunogenicity profile for SARS-CoV-2 DNA vaccines in clinical trials (61). Future study, however, is needed to develop non-invasive delivery techniques for DNA vaccination in humans. In addition, simultaneous or sequential co-infection by SARS-CoV-2 and A(H1N1)pdm09 caused more severe disease than infection by either virus (62), our LAIV platform may offer an opportunity of generating a human vaccine to fight both COVID-19 and influenza.

      Results from TrialIdentifier: We found the following clinical trial numbers in your paper:<br><table><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Identifier</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Status</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Title</td></tr><tr><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">NCT04809389</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Active, not recruiting</td><td style="min-width:95px; border-right:1px solid lightgray; border-bottom:1px solid lightgray">A Study to Evaluate Safety and Immunogenicity of DelNS1-nCoV…</td></tr></table>


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on page 30. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Andreano, E., Paciello, I., Piccini, G., Manganaro, N., Pileri, P., Hyseni, I., Leonardi, M., Pantano, E., Abbiento, V., Benincasa, L., Giglioli, G., De Santi, C., Fabbiani, M., Rancan, I., Tumbarello, M., Montagnani, F., Sala, C., Montomoli, E., & Rappuoli, R. (2021). Hybrid immunity improves B cells and antibodies against SARS-CoV-2 variants. Nature, 1–7. https://doi.org/10.1038/s41586-021-04117-7

    1. Tartof, S. Y., Slezak, J. M., Fischer, H., Hong, V., Ackerson, B. K., Ranasinghe, O. N., Frankland, T. B., Ogun, O. A., Zamparo, J. M., Gray, S., Valluri, S. R., Pan, K., Angulo, F. J., Jodar, L., & McLaughlin, J. M. (2021). Effectiveness of mRNA BNT162b2 COVID-19 vaccine up to 6 months in a large integrated health system in the USA: A retrospective cohort study. The Lancet, 398(10309), 1407–1416. https://doi.org/10.1016/S0140-6736(21)02183-8

    1. Meuris, C., Kremer, C., Geerinck, A., Locquet, M., Bruyère, O., Defêche, J., Meex, C., Hayette, M.-P., Duchene, L., Dellot, P., Azarzar, S., Maréchal, N., Sauvage, A.-S., Frippiat, F., Giot, J.-B., Léonard, P., Fombellida, K., Moutschen, M., Durkin, K., … Darcis, G. (2021). Transmission of SARS-CoV-2 After COVID-19 Screening and Mitigation Measures for Primary School Children Attending School in Liège, Belgium. JAMA Network Open, 4(10), e2128757. https://doi.org/10.1001/jamanetworkopen.2021.28757

    1. Hulme, W. J., Williamson, E. J., Green, A., Bhaskaran, K., McDonald, H. I., Rentsch, C. T., Schultze, A., Tazare, J., Curtis, H. J., Walker, A. J., Tomlinson, L., Palmer, T., Horne, E., MacKenna, B., Morton, C. E., Mehrkar, A., Fisher, L., Bacon, S., Evans, D., … Goldacre, B. (2021). Comparative effectiveness of ChAdOx1 versus BNT162b2 COVID-19 vaccines in Health and Social Care workers in England: A cohort study using OpenSAFELY [Preprint]. Epidemiology. https://doi.org/10.1101/2021.10.13.21264937

    1. SciScore for 10.1101/2021.10.18.21265113: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: Participants were provided contact information for the Beth Israel Deaconess Medical Center (BIDMC) study team for recruitment and informed consent.<br>IRB: The BIDMC Institutional Review Board approved this study (#2021P000344) as part of a parent biorepository study (#2020P000361).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plates were again washed 3 times and 50 μL of SULFO-Tagged anti-Human IgG detection antibody diluted to 1x in Diluent 100 was added to each well and incubated shaking at 700 rpm at room temperature for at least 1 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Human IgG</div><div>suggested: (RevMAb Biosciences Cat# 31-1019-MK, RRID:AB_2783627)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Intracellular cytokine staining (ICS) assay: 106 peripheral blood mononuclear cells well were re-suspended in 100 µL of R10 media supplemented with CD49d monoclonal antibody (1 µg/mL) and CD28 monoclonal antibody (1 µg/mL) as described previously.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD49d</div><div>suggested: (BD Biosciences Cat# 347690, RRID:AB_647457)</div></div><div style="margin-bottom:8px"><div>CD28</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The next day, the cells were washed twice with DPBS, stained with aqua live/dead dye for 10 mins and then stained with predetermined titers of monoclonal antibodies against CD279 (clone EH12.1, BB700), CD4 (clone L200, BV711),</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CD279</div><div>suggested: (BD Biosciences Cat# 746185, RRID:AB_2743534)</div></div><div style="margin-bottom:8px"><div>CD4</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>BV711</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were washed twice with 1X Perm Wash buffer (BD Perm/WashTM Buffer 10X in the CytoFix/CytoPerm Fixation/ Permeabilization kit diluted with MilliQ water and passed through 0.22µm filter) and stained with intracellularly with monoclonal antibodies against IFN-γ (clone B27; BUV395), and CD3 (clone SP34.2, Alexa 700), for 30 min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IFN-γ</div><div>suggested: (BD Biosciences Cat# 563563, RRID:AB_2738277)</div></div><div style="margin-bottom:8px"><div>CD3</div><div>suggested: (BD Biosciences Cat# 556610, RRID:AB_396483)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Enzyme-linked immunospot (ELISPOT) assay: ELISPOT plates were coated with mouse anti-human IFN-γ monoclonal antibody from MabTech at 1 µg/well and incubated overnight at 4°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IFN-γ</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">luciferase reporter plasmid pLenti-CMV Puro-Luc (Addgene) and spike protein expressing pcDNA3.1-SARS-CoV-2 SΔCT were co-transfected into HEK293T cells (ATCC CRL_3216) with lipofectamine 2000 (ThermoFisher Scientific).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: ATCC Cat# CRL-3216, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The mixture was incubated at 37 °C for 1 h before adding to HEK293T-hACE2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T-hACE2</div><div>suggested: RRID:CVCL_A7UK)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudovirus neutralizing antibody assay: The SARS-CoV-2 pseudoviruses expressing a luciferase reporter gene were used to measure pseudovirus neutralizing antibodies as described previously.5,6 In brief, the packaging construct psPAX2 (AIDS Resource and Reagent Program)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>psPAX2</div><div>suggested: RRID:Addgene_12260)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">luciferase reporter plasmid pLenti-CMV Puro-Luc (Addgene) and spike protein expressing pcDNA3.1-SARS-CoV-2 SΔCT were co-transfected into HEK293T cells (ATCC CRL_3216) with lipofectamine 2000 (ThermoFisher Scientific).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLenti-CMV Puro-Luc</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pcDNA3.1-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudovirus neutralizing antibody assay: The SARS-CoV-2 pseudoviruses expressing a luciferase reporter gene were used to measure pseudovirus neutralizing antibodies as described previously.5,6 In brief, the packaging construct psPAX2 (AIDS Resource and Reagent Program)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>AIDS Resource and Reagent Program</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Fixed cells were transferred to 96-well round bottom plate and analyzed by BD FACSymphony™ system.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BD FACSymphony™</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were analyzed using FlowJo v9.9</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analysis: Descriptive statistics were calculated using GraphPad Prism 8.4.3, (</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">(GraphPad Software, San Diego, California).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      One limitation of this study is the relatively small number of individuals in this immunologic analysis compared with the large total number of individuals in this outbreak. Nevertheless, the magnitude and consistency of the immunologic differences observed between vaccinated infected and vaccinated uninfected individuals suggest the generalizability of the conclusions. Another limitation is the fact that the vaccinated infected group was generally younger than the vaccinated uninfected group, which may reflect different risk behaviors or exposures based on age. However, age did not appear to correlate with the magnitude of binding or neutralizing antibody titers in this cohort (Fig. S2). In conclusion, we describe humoral and cellular immune responses in the first large, well described cluster of breakthrough infections with the SARS-CoV-2 delta variant in fully vaccinated individuals in the United States. Breakthrough infection led to a large increase in antibody and T cell responses in vaccinated individuals, suggesting important immunologic benefits of vaccination even when infection was not prevented. Moreover, anamnestic antibody responses in breakthrough infections were similar in magnitude regardless of the length of time from vaccination (Fig. S3), suggesting the possibility of protection against severe disease for a prolonged period of time even after serum antibody titers decline. These data provide unique insights into the immunology of breakthrough infections wit...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.13.21264957: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">We modelled the time dependence of eight state variables: lipid nanoparticles (L), vaccinated cells (V), CD4+ T cells (T), plasma B cells (B), antibody (A), CD8+ T cells (C), and the cytokines interferon (F) and interleukin (I).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>B</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">If unavailable directly from the published source, we digitized the data directly using the software WebPlotDigitizer (version 4.5) [25]. 2.2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>WebPlotDigitizer</div><div>suggested: (WebPlotDigitizer, RRID:SCR_013996)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.12.21264890: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: A total of 30 women were enrolled in the study and provided consent under UMass Amherst IRB-approved protocol #2534.<br>Field Sample Permit: Pre-pandemic milk, maternal DBS, and infant stool samples were collected using the same methods as samples in the vaccine cohort (see Sample collection).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">A total of 30 women were enrolled in the study and provided consent under UMass Amherst IRB-approved protocol #2534.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For detection of total immunoglobulins, 96-well plates were coated with anti-IgA (α-chain specific) or anti-IgG (H+L specific) capture antibodies at 1 μg/mL (Jackson ImmunoResearch Laboratories, Inc.).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-IgA</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>α-chain</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The assay quantitatively measures antibodies in the sample that can inhibit the interaction of spike and its variants with ACE2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Independent t-tests were used to analyze differences in infant stool anti-RBD antibodies, stratified by the presence of maternal side effects to immunization.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-RBD</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Information was logged via Research Electronic Data Capture (REDCap).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>REDCap</div><div>suggested: (REDCap, RRID:SCR_003445)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Infant stool samples were collected in stool collection tubes (Fisher Sci., Cat No. NC0705093)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Fisher Sci.</div><div>suggested: (One Mind Biospecimen Bank Listing, RRID:SCR_004193)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analyses were performed using GraphPad Prism 9.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.14.464416: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The protein identities of the purified HCV nsp5b RdRp and NiV RdRp P/L complex were confirmed by mass spectrometry (MS) analysis (Alberta Proteomics and Mass Spectrometry, Edmonton, AB, Canada).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>AB</div><div>suggested: RRID:BDSC_203)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The pFastBac-1 (Invitrogen, Burlington, ON, Canada) plasmid with the codon-optimized synthetic DNA sequences (GenScript, Piscataway, NJ, USA) coding for HCV nsp5b RdRp (CAB46677.1 polyprotein, residues 2420 to 3010) minus the 21 C-terminus residues was used as a starting material for protein expression in insect cells (Sf9, Invitrogen, Burlington, ON, Canada).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pFastBac-1</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were analyzed using GraphPad Prism 7.0 (GraphPad Software, Inc</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Structures of EBOV, NiV, CCHFV RdRp enzymes are not available, and structure of RSV and LASV RdRp lack the RNA substrate, which is a limitation of our modeling approach. Clear evidence for delayed chain-termination following a single incorporation of RDV-TP has so far only been demonstrated for SARS-CoV, MERS-CoV, and SARS-CoV-2 RdRp complexes. In these cases, a conserved serine clashes with the 1’-cyano group of the incorporated RDV-MP at position “i+3”(26,27,29,31,32). However, NTP concentrations > 10 μM are often sufficient to overcome the inhibition(26,27,29,31). The clash between the 1’-cyano group of RDV-MP and S861 in SARS-CoV-2 occurs in a region of the RdRp away from the active site. Indeed, tested polymerases of other viruses did not show any significant inhibition in primer extension reactions, although previous studies have shown that multiple consecutive incorporations of the inhibitor can also lead to delayed chain-termination at positions “i+3” and “i+5” with EBOV, RSV, and NiV RdRp complexes(11,16). In this work, we have also shown a subtle inhibitory effect at position “i” with HCV RdRp. Overall, this analysis suggests that the inhibitory effect in primer extension reactions is heterogeneous and generally weak. In contrast, the template-dependent inhibition of RNA synthesis seems to provide a unifying mechanism that shows strong inhibition of UTP incorporation opposite RDV-MP. The template nucleotide that base-pairs with the incoming nucleotide substrate is p...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.13.464254: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">In brief, female Syrian hamsters (Mesocricetus auratus) of 6-8 weeks old were anesthetized with ketamine/xylazine/atropine and inoculated intranasally with 50 μL containing 1×104 TCID50 Beta B.1.351 (derived from hCoV-19/Belgium/rega-1920/2021; EPI_ISL_896474, 2021-01-11).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody isolation and recombinant production: Antigen specific IgG+ memory B cells were isolated and cloned from PBMC of SARS-CoV-2 convalescent individuals.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Antigen specific IgG+</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">goat anti-human IgG secondary antibody (Southern Biotech, 2040-04) was added and incubated for 45 min at room temperature.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>goat anti-human IgG secondary antibody</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human IgG</div><div>suggested: (SouthernBiotech Cat# 2040-04, RRID:AB_2795643)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 2 h, infected cells were washed an additional five times with DMEM prior to adding media supplemented with anti-VSV-G antibody (I1-mouse hybridoma supernatant diluted 1:25, from CRL-2700, ATCC) to reduce parental background.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-VSV-G</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were fixed with 4% PFA (Electron Microscopy Sciences, #15714S), permeabilized with Triton X-100 (SIGMA, #X100-500ML) and stained with an antibody against the viral nucleocapsid protein (Sino Biologicals, #40143-R001) followed by a staining with the nuclear dye Hoechst 33342 (Fisher Scientific, # H1399) and a goat anti-rabbit Alexa Fluor 647 antibody (Invitrogen, #A-21245).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>#X100-500ML</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: (Molecular Probes Cat# A-21245, RRID:AB_141775)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HEK293T-ACE2, Vero-TMPRSS2) (32)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T-ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudotyped viruses were prepared using Lenti-X 293 cells seeded in 15-cm dishes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For neutralization experiments, HEK-293T cells expressing hACE2 (Crawford et al. 2020) in DMEM supplemented with 10% FBS and 1% PenStrep were seeded at 20,000 cells per well into clear bottom, white manually poly-D-lysine coated 96 well plates and incubated at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Neutralization of authentic SARS-CoV-2 viruses: Vero-TMPRSS2 cells were seeded into black-walled, clear-bottom 96-well plates at 2 × 104 cells/well and cultured overnight at 37°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-TMPRSS2</div><div>suggested: JCRB Cat# JCRB1818, RRID:CVCL_YQ48)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell-surface mAb-mediated S1 shedding: CHO cells stably expressing the prototypic SARS-CoV-2 Spike protein were harvested, washed in wash buffer (PBS 1% BSA 2 mM EDTA) and resuspended in PBS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CHO</div><div>suggested: CLS Cat# 603479/p746_CHO, RRID:CVCL_0213)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viral replication fitness assays: Vero E6 cells (ATCC, CRL-1586) were seeded at 1×106 cells per well in 6-well plates.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After a 15-minute incubation, Jurkat cells stably expressing FcγRIIIa receptor (V158 variant) or FcγRIIa receptor (H131 variant) and NFAT-driven luciferase gene (effector cells) were added at an effector to target ratio of 6:1 for FcγRIIIa and 5:1 for FcγRIIa.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Jurkat</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">fold-on trimerization motif, and an 8× His tag in the pCMV vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV</div><div>suggested: RRID:Addgene_20783)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Using the Database IMGT (http://www.imgt.org), the VH and VL gene family and the number of somatic mutations were determined by analyzing the homology of the VH and VL sequences to known human V, D and J genes.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>http://www.imgt.org</div><div>suggested: (IMGT - the international ImMunoGeneTics information system, RRID:SCR_012780)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">UCA sequences of heavy and light variable regions were constructed using IMGT/V-QUEST.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IMGT/V-QUEST</div><div>suggested: (IMGT/V-QUEST, RRID:SCR_010749)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After 45 min incubation, absorbance at 405 nm was measured by a plate reader (Biotek) and data plotted using Prism GraphPad.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After a 30 sec stabilization step in KB, biosensors were moved in SARS-CoV or SARS-CoV-2 :2 dilution series (starting concentration: 18.5 nM) for the 600 sec association step, and then moved back in KB to record dissociation signals for 540 sec.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2</div><div>suggested: (BioLegend Cat# 946101, RRID:AB_2892515)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The data were baseline subtracted, results fitted using the Pall FortéBio/Sartorius analysis software (version 12.0) and plotted using GraphPad Prism (version 9.1.1</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data were analyzed and visualized with Prism (Version 9.1.1).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Prism</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Micrographs were recorded using the Leginon software on a 120 kV FEI Tecnai G2 Spirit with a Gatan Ultrascan 4000 4k</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Leginon</div><div>suggested: (Leginon, RRID:SCR_016731)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">3D refinements were carried out using non-uniform refinement along with per-particle defocus refinement in CryoSPARC (57).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CryoSPARC</div><div>suggested: (cryoSPARC, RRID:SCR_016501)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Model building and refinement: UCSF Chimera (61) and Coot (62) were used to fit atomic models into the cryoEM maps.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Coot</div><div>suggested: (Coot, RRID:SCR_014222)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">This variant was originally isolated in house from nasopharyngeal swabs taken from travelers returning to Belgium (baseline surveillance) and were subjected to sequencing on a MinION platform (Oxford Nanopore) directly from the nasopharyngeal swabs (65).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MinION</div><div>suggested: (MinION, RRID:SCR_017985)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code and data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on page 24. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.18.464900: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Field Sample Permit: Animal studies: All animal studies described in the manuscript were carried out under Institutional Animal Care and Use Committee (IACUC)-approved protocols at the respective institutions (BU and MRIGlobal) and where appropriate were reviewed and approved by Animal Care and Use Review Office of USAMRDC (ACURO).<br>IACUC: Animal studies: All animal studies described in the manuscript were carried out under Institutional Animal Care and Use Committee (IACUC)-approved protocols at the respective institutions (BU and MRIGlobal) and where appropriate were reviewed and approved by Animal Care and Use Review Office of USAMRDC (ACURO).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The antibody/RVP mixture was pre-incubated for 1 hour in a 37□C incubator containing 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antibody/RVP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were blocked with endotoxin-free 2% gelatin solution (Sigma) and incubated with anti-Spike antibodies of interest for 1 hour at +4°C.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Spike</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells with deposited complement components were stained with anti-C4 antisera (Complement Technology) and a secondary anti-goat-HRP antibody (SouthernBiotech).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-C4 antisera (Complement Technology)</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-goat-HRP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plates were washed (3x) and subsequently probed for ACE2 binding with anti-ACE2 antibody.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells: Reporter virus particles (RVP’s) were purchased from Integral Molecular, ACE2-293T cells (Integral Molecular; Cat #C-HA102) were cultured in DMEM containing 10% FBS, 10mM HEPES, and 0.5 g/mL Puromycin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2-293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero E6 cells (BEI resources, NIAID, NIH: VERO C1008 (E6), African green monkey kidney, Working Cell Bank NR-596) were maintained in humidified incubators at 37°C and 5% CO2 in DMEM high glucose with GlutaMAX and sodium pyruvate (Gibco™, cat #10569) and 10% certified US-origin heat-inactivated fetal bovine serum (Gibco™, cat #10082).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The mutant library was arrayed in 384-well microplates and transiently transfected into HEK293T cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: CCLV Cat# CCLV-RIE 1018, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">100 μL of THP-1 cells at 2.5e5 cells per mL are then added to wells containing bead-antigen-antibody mixture.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>THP-1</div><div>suggested: CLS Cat# 300356/p804_THP-1, RRID:CVCL_0006)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">CHO-S1 target cells (Promega Cat #CS3195A06) and Jurkat NFAT-Luc effector cells were mixed at 2:1 (E:T) ratio.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Jurkat</div><div>suggested: TKG Cat# TKG 0209, RRID:CVCL_0065)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Plate is then run on Attune NXT for acquisition and FCS Files are analyzed using FlowJo Software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>FlowJo</div><div>suggested: (FlowJo, RRID:SCR_008520)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The half maximal inhibitory concentrations (IC50) were calculated using GraphPad Prism 8.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.15.464595: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: All live virus infections were performed in a biosafety level 3 (BSL3) laboratory as approved by the Institutional Biosafety Committee (IBC).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The viral spike protein was stained with an in-house developed rabbit anti-spike antibody and goat anti-rabbit IgG (H+L) highly cross-adsorbed antibody with Alexa Fluor 488 (Invitrogen).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-spike</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-rabbit IgG</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Effect cells were HEK293T cells stably expressing ACE2-GFP, as described previously 21, or as a control, HEK293T cells transfected with pEGFP.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: CCLV Cat# CCLV-RIE 1018, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 infection on cells: 7×104 Vero E6 cells (ATCC #CRL-1586) were seeded into an Millicell EZ SLIDES chamber slides (Millipore) 24 hours before infection.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">pcDNA3.1-SARS-CoV-2-Spike plasmid was obtained from BEI resource 7. pLV-Mcherry was obtained from Addgene (Catalog number:</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1-SARS-CoV-2-Spike</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pLV-Mcherry</div><div>suggested: RRID:Addgene_36084)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Effect cells were HEK293T cells stably expressing ACE2-GFP, as described previously 21, or as a control, HEK293T cells transfected with pEGFP.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pEGFP</div><div>suggested: RRID:Addgene_165830)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The identified networks were exported into Cytoscape for graph-making.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Cytoscape</div><div>suggested: (Cytoscape, RRID:SCR_003032)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To determine how Mitoxantrone interacts with DNA and topoisomerase, we used LigPlot to analyze the molecular interactions present in the published structure (PDB: 4g0v) 27.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>LigPlot</div><div>suggested: (LigPlot+, RRID:SCR_018249)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Image processing and statistical analyses: Confocal images were processed using the Zeiss Zen software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Zeiss Zen</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To measure fluorescence intensity, we used the open-source Fiji software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Fiji</div><div>suggested: (Fiji, RRID:SCR_002285)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analyses were performed using either Excel or GraphPad Prism 9.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Excel</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Data are presented as means□±□SEM, which was calculated by GraphPad Prism 9.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Images were prepared with Adobe Photoshop and assembled in Adobe Illustrator.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Adobe Photoshop</div><div>suggested: (Adobe Photoshop, RRID:SCR_014199)</div></div><div style="margin-bottom:8px"><div>Adobe Illustrator</div><div>suggested: (Adobe Illustrator, RRID:SCR_010279)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on pages 19 and 22. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.17.464700: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Patient Samples and Collection: Use of human samples for this study was approved by the University of Ottawa Ethics Review Board: Certificates H-04-20-5727, H-04-21-6643 and H-07-20-6009.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In initial experiments, aliquots of each fraction were visualized via immunoblotting (anti-His antibody; Cat: SAB2702218</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-His</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">In conjunction, titration curves of conformation-dependent monoclonal IgM (Absolute Antibody, Ab01680-15.0), IgA (Absolute Antibody, Ab01680-16.0), and IgG (Absolute Antibody, Ab01680-10.0) CR3022 antibodies were used as reference material to assess protein folding.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>titration curves of conformation-dependent monoclonal IgM ( Absolute Antibody , Ab01680-15.0) , IgA ( Absolute Antibody , Ab01680-16.0)</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgG ( Absolute Antibody , Ab01680-10.0 ) CR3022 antibodies</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After blocking, plates were washed thrice with PBS-T, and followed by addition of 100 μL of the respective diluted serum samples and CR3022 antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>CR3022</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The plates were incubated for two hours on a shaker at room temperature, washed thrice with PBS-T followed by the addition of 50 μL of the respective secondary-HRP antibody at specified dilutions (1:4000 secondary anti-human IgG-HRP (NRC anti-hIgG#5-HRP</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG-HRP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Surrogate Neutralization ELISA (snELISA) assay for evaluation of neutralization in serum samples: The described methodology was adapted from the surrogate neutralization ELISA assay as shown in Abe et al. 2020, for the evaluation of the relative inhibition of neutralizing antibodies to RBD protein from binding to soluble ACE2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">RBD Production in mammalian cells: For comparison, a mammalian RBD was produced in HEK 293F cells and purified.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293F</div><div>suggested: RRID:CVCL_6642)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">(Mount Sinai, NYC) encoding the Whuhan-Hu-1 RBD (MN908947) sequence coding for the amino acid 319-541 and fused with the N-terminal SARS-CoV-2 spike secretory signal and a C-terminal hexa-histidine tag was transfected into 293F cells cultivated in Freestyle 293 expression media (Thermo Fisher, #12338018) at 37°C, 7% CO2, while shaking (125rpm).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Whuhan-Hu-1 RBD</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The construct was codon-optimized for N. benthamiana expression and was synthesized by GenScript into the pHREAC vector (Peyret et al., 2019) via BsaI sites</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHREAC</div><div>suggested: RRID:Addgene_134908)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Lectin-binding human chaperone calreticulin (NP_004334.1) was codon-optimized for N. benthamiana and synthesized in the pHRE vector (Peyret et al., 2019).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHRE</div><div>suggested: RRID:Addgene_134909)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Transient expression in Nicotiana benthamiana: Prior to infiltration, pHREAC-RBD and pHRE-calreticulin were freshly transformed into Agrobacterium tumefaciens strains AGL1 and Gv2260, respectively, via electroporation.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pHREAC-RBD</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pHRE-calreticulin</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Dissociation constant (KD) was determined using 4-parameter curve fitting with GraphPad Prism 9.1.2 software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Siddle, K. J., Krasilnikova, L. A., Moreno, G. K., Schaffner, S. F., Vostok, J., Fitzgerald, N. A., Lemieux, J. E., Barkas, N., Loreth, C., Specht, I., Tomkins-Tinch, C. H., Silbert, J., Schaeffer, B., Taylor, B. P., Loftness, B., Johnson, H., Schubert, P. L., Shephard, H. M., Doucette, M., … Sabeti, P. C. (2021). Evidence of transmission from fully vaccinated individuals in a large outbreak of the SARS-CoV-2 Delta variant in Provincetown, Massachusetts (p. 2021.10.20.21265137). https://doi.org/10.1101/2021.10.20.21265137

    1. Imagine a place in which personal privacy is a right, including owning one's personal data, one's own deep encryption, and one's complete personal digital autonomy. In this place, the online world is uncluttered, free from advertising, ..
      • for : personal digital autonomy

  5. int850.pressbooks.com int850.pressbooks.com
    1. Kimberly Clarke October 11, 2021 INT 850 Dr. Stuke Literature Review

      Anil K. Gupta, Vijay Govindarajan, & Peter Roche. (2001). Converting Global Presence into Global Competitive Advantage [and Executive Commentary]. The Academy of Management Executive (1993-2005), 15(2), 45–58.

      This article says to achieve global competitive advantage a brand needs optimal architecture, world class competencies, frictionless coordination between similar activities. It questions if a company can produce in a low-cost country and achieve world class quality levels. It also argues that optimizing location for every step of production can reduce cost and risk and enhance performance.

      Chiang, J., & Chathoth, P. (2013). International Expansion Strategy of Foodservice Firms: An Exploratory Study. Journal of Hospitality Marketing & Management, 22(2), 204–228. https://doi-org.ezproxy.snhu.edu/10.1080/19368623.2013.737744

      This article focuses on firms in the food service industry. It states that the distance between two countries consist of cultural, administrative, geographic and economic. It talks about a multi domestic strategy as incorporating global strategy levers and find a balance between over globalizing and under globalizing.

      Farinha, L., Nunes, S., Ferreira, J. J., & Fernandes, A. (2018). Understanding the foundations of global competitive advantage of nations. Competitiveness Review, 28(5), 503–517. https://doi-org.ezproxy.snhu.edu/10.1108/CR-10-2016-0063

      Hongsik John Cheon, Chang-Hoan Cho, & Sutherland, J. (2007). A Meta-Analysis of Studies on the Determinants of Standardization and Localization of International Marketing and Advertising Strategies. Journal of International Consumer Marketing, 19(4), 109–147. https://doi-org.ezproxy.snhu.edu/10.1300/J046v19n04_06

      This article talks about the 4 Ps of marketing, target market, market positioning, environmental factors and organizational factors. It looks at if product strategy is easier to market internationally. Innes, B. G., Kerr, W. A., & Hobbs, J. E. (2010). A private-public strategy for International Marketing Through Collective Brands: Canada brand foods. Journal of International Food & Agribusiness Marketing, 23(1), 72–87. https://doi.org/10.1080/08974438.2011.534042 This article talks about brand image and country image through a public private partnership. Public private partnerships are usually helpful because they allow funding and access the best of both sides. It says in order for a brand to market internationally they must have robust and unique characteristics.<br> Kedia, B. L., Nordtvedt, R., & Perez, L. M. (2002). International business strategies, decision-making theories, and leadership styles: An integrated framework.Competitiveness Review, 12(1), 38-52. doi:http://dx.doi.org/10.1108/eb046433

      This article looks at mode of entry, international collaboration, and global integration vs. local responsiveness. It also examines decision-making with regards to bounded rationality and speed. It compares management scientists has been that of leadership and its influence on organizational performance.

      Milanesi, M., Gigliotti, M., & Runfola, A. (2020). The international marketing strategy of Luxury Food Smes: The case of truffle. Journal of Food Products Marketing, 26(9), 600–618. https://doi.org/10.1080/10454446.2020.1854916 This article looks at entry modes and international marketing mix in foreign markets and market selection. It comes up with a five-pillar approach of strategy for luxury food SMEs. These are events, market selection, exercising control over distribution channels, creating product awareness and the global image of the product based on making it globally exclusive. Phan, Q. P. T., Pham, N. T., & Nguyen, L. H. L. (2020). How to Drive Brand Engagement and Ewom Intention in Social Commerce: A Competitive Strategy for the Emerging Market. Journal of Competitiveness, 3, 136–155. https://doi-org.ezproxy.snhu.edu/10.7441/joc.2020.03.08 This article discusses how companies engage with their brand and customers as a competitive advantage. This leads to trust and the role of communication with the brand. It focuses on generation Y and the importance of trust with them.

      Ramarapu, N. K., & Lado, A. A. (1995). Linking information technology to global business strategy to gain competitive advantage: an integrative model. Journal of Information Technology (Routledge, Ltd.), 10(2), 115. https://doi-org.ezproxy.snhu.edu/10.1057/jit.1995.13 This article talks about the benefits of IT and competitive advantage. We are seeing more and more how technology plays a role in reaching customers and improving efficiency. The article talks about the industry and resource based views to support this. Singireddy, M. (2020). Mcdonald’s: Global Marketing. International Journal of Health & Economic Development, 6(2), 16–27.

      This article talks about McDonalds focusing on localization as well as standardization and regional sensitivity. It talks about human resources and the importance of the right people to represent the brand. The article explains the product testing McDonalds does in different countries to cater the menu and how that works. I did not know how to post a new chapter

    1. SciScore for 10.1101/2021.10.12.21264881: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Neutralizing antibodies are considered to block the binding between RBD and ACE2, hence increasing the amount of free RBD that can bind to the plate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Next, the plate was washed 4x with the supplied wash buffer and 100 μL of Spike-RBD antibodies conjugated to HRP were added per well.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Spike-RBD</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Binding antibody ELISA tests: The Euroimmun SARS-CoV-2 IgG antibody ELISA (“S1 IgG”), Euroimmun SARS-CoV-2-NCP IgG ELISA (“NCP IgG”, both Euroimmun AG, Lübeck, Germany) and the Wantai SARS-CoV-2 Ab ELISA (Beijing Wantai Biological Pharmacy Enterprise; Beijing, China) were carried out according to the manufacturer’s instructions, with the exception that 50 μl of serum were used in the Wantai Ab ELISA.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>The Euroimmun SARS-CoV-2 IgG antibody ELISA</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>SARS-CoV-2 IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>“S1 IgG”</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Next, 100 μL of diluted serum–virus mix were added to wells containing 2 × 104 Vero E6 cells per well (#85020206, European Collection of Authenticated Cell Cultures (ECACC), Porton Down, UK) in a 96-well plate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      There are some technical limitations concerning the use of the GenScript sVNT for high-throughput sample analysis. We have identified pipetting speed as one of the main factors involved in the generation of false positive results, as the strength of the signal is strongly correlated with incubation time. If pipetting occurs slowly (e.g. when using a single-channel pipette), HRP-coupled RBD will have more time to bind to the coated ACE receptor, and will thus create a stronger OD signal, in negative samples at the beginning of the plate compared to negative samples at the end of the plate. In our laboratory, where the GenScript sVNT is performed manually, we were able to address this “OD drift” over the plate by using a multichannel pipette and by processing only half plates at a time. However, for full automation this time-dependent drift can be problematic as many pipetting robots use a single-tip dispenser and, hence, robots often cannot adhere to the 2-min pipetting time per plate as recommended by the manufacturer. Nonetheless, the throughput achievable by using the GenScript sVNT remains much higher than that of a cell-culture-based PRNT, even if only half plates are processed. However, it impairs the large-scale testing of vaccinated individuals on a routine basis. Another parameter that remains to be evaluated when using the GenScript sVNT is the influence of emerging variants with mutations in the RBD, e.g. B1.1.7, B.1.351 and P1. A possible solution would be the deve...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.12.464114: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: Description of cohort and ethics statement: Samples were collected from participants enrolled in a prospective cohort study approved by the Biomedical Research Ethics Committee (BREC) at the University of KwaZulu–Natal (reference BREC/00001275/2020).<br>Consent: Written informed consent was obtained from each participant.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Four were males and 5 were females.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For RBD expression experiments, 45 OD units of yeast were labeled in 1:100 diluted chicken-anti-Myc-FITC antibody (Immunology Consultants CMYC45F) to detect the RBD’s C-terminal Myc tag.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Myc tag .</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After the plasma incubations, the libraries were secondarily labeled for 1 hour with 1:100 fluorescein isothiocyanate-conjugated anti-MYC antibody (Immunology Consultants Lab, CYMC-45F) to label for RBD expression and 1:200 Alexa Fluor-647-conjugated goat anti-human-IgA+IgG+IgM (Jackson ImmunoResearch 109-605-064) to label for bound plasma antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-MYC</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human-IgA+IgG+IgM</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">, version 0.8.10) to process Illumina sequences into counts of each barcoded RBD variant in each pre-selection and antibody-escape population.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>antibody-escape population .</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Magnetic Separation Rack, Thermo Fisher Scientific, CS15000) was used to separate antibodies that bind RBD from the supernatant, and the supernatant (the post-RBD antibody depletion sample) was removed.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>post-RBD</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Note that these assays were performed in 293T cells over-expressing human ACE2, which may underestimate contributions of non-RBD-binding antibodies to viral neutralization (7, 35, 60).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Dilution series of the synthetic sera comprised of the anti-RBD antibody REGN10987 (72), which binds to both Wuhan-1-like RBD and B.1.351 RBD, and pooled pre-pandemic human serum from 2017-2018 (Gemini Biosciences; nos. 100–110, lot H86W03J; pooled from 75 donors) were performed such that the anti-spike antibody was present at a highest concentration of 0.25 µg/mL.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-spike</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pre-pandemic serum alone, without anti-RBD antibody depletion, was used as a negative control, averaged over 2 replicates</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-RBD</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody binding was detected with TMB/E HRP substrate (Millipore Sigma, ES001) and 1 N HCl was used to stop the reaction.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ES001</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Generation of pseudotyped lentiviral particles: HEK-293T (American Type Culture Collection, CRL-3216) cells were used to generate SARS-CoV-2 spike-pseudotyped lentiviral particles and 293T-ACE2 cells (Biodefense and Emerging Infectious Research Resources Repository (BEI Resources), NR-52511) were used to titer the SARS-CoV-2 spike-pseudotyped lentiviral particles and to perform neutralization assays (see below).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T-ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">To generate spike-pseudotyped lentiviral particles (70), 6e105 HEK-293T (ATCC CRL-3216) cells per well were seeded in 6-well plates in 2 mL D10 growth media (Dulbecco’s Modified Eagle Medium with 10% heat-inactivated fetal bovine serum, 2 mM l-glutamine, 100 U/mL penicillin, and 100 µg/mL streptomycin).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK-293T</div><div>suggested: ATCC Cat# CRL-3216, RRID:CVCL_0063)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Note that these assays were performed in 293T cells over-expressing human ACE2, which may underestimate contributions of non-RBD-binding antibodies to viral neutralization (7, 35, 60).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: CCLV Cat# CCLV-RIE 1018, RRID:CVCL_0063)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For experiments involving D614G spike, we used spike-pseudotyped lentiviral particles that were generated essentially as described in (70), using a codon-optimized SARS-CoV-2 spike from Wuhan-Hu-1 strain that contains a 21-amino-acid deletion at the end of the cytoplasmic tail (27) and the D614G mutation that is now predominant in human SARS-CoV-2 (30).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Wuhan-Hu-1</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">AWY101 yeast containing a negative control (containing an empty vector pETcon plasmid) were grown overnight at 30°C in galactose-containing media.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pETcon</div><div>suggested: RRID:Addgene_41522)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The resulting CCSs are available on the NCBI Sequence Read Archive, BioProject PRJNA770094,</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NCBI Sequence Read Archive</div><div>suggested: (NCBI Sequence Read Archive (SRA, RRID:SCR_004891)</div></div><div style="margin-bottom:8px"><div>BioProject</div><div>suggested: (NCBI BioProject, RRID:SCR_004801)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical Analysis: The percent of neutralizing activity of early-2020 and B.1.351-convalescent plasmas due to RBD-binding antibodies is plotted with the plotnine python package, version 0.8.0 (https://plotnine.readthedocs.io/en/stable/index.html), shown as a Tukey boxplot (middle line indicating median, box limits indicating interquartile range) with individual measurements overlaid as points.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All raw sequencing data are available on the NCBI Short Read Archive at BioProject PRJNA770094, BioSample SAMN22208699, SAMN22208700.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NCBI Short Read Archive</div><div>suggested: None</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code and data.


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      Our study has several limitations. The cohorts of individuals infected with early 2020 and B.1.351 viruses are small, and are geographically and temporally distinct. Nevertheless, the two cohorts are relatively well-matched with respect to age, sex, and days-post symptom onset of sample collection (Table 1) and assays were performed under comparable conditions. Our deep mutational scanning measured binding to yeast-displayed RBD, which may not capture all relevant features of full-length spike in the context of virus. Finally, our neutralization assays used pseudotyped lentiviral particles and ACE2-overexpressing cells, and some recent works suggest that the relative importance of different spike epitopes for neutralization can depend on the viral system and target cell line used (7, 35, 36, 60). Although the B.1.351 variant has now been displaced by the Delta variant, our results illustrate the need to understand immunity elicited by different SARS-CoV-2 variants. As population immunity due to infection or vaccination increases, preexisting immunity is becoming an increasingly important driver of SARS-CoV-2 evolution (61), as has shown to be the case for seasonal coronaviruses (62, 63). Moreover, as individuals begin to accumulate more complex SARS-CoV-2 immune histories due to multiple infections and/or vaccinations, the effects of immune imprinting or original antigenic sin (64, 65) may start to interact with the variant-specific immunodominance hierarchies we have describ...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.11.463936: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The infectivity of the virus stock was further verified by immunohistochemistry (IHC) using a primary rabbit monoclonal antibody against the SARS-CoV-2 (2019-nCoV) nucleocapsid protein (SinoBiological, 40143-R019) and commercial staining reagents (Agilent Technologies, K346430-2, K406189-2) following the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>2019-nCoV ) nucleocapsid protein ( SinoBiological , 40143-R019 )</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell culture: HeLa (DSMZ, Cat. No. ACC 57) and NIH-3T3 cells (DSMZ, Cat. No. ACC59) were cultured in DMEM supplemented with 10 % FCS, 1 % penicillin-streptomycin (P/S, 10,000 U/mL), 200 mM L-Glutamine and 1 % MEM Non-Essential Amino Acids Solution (100X, all media and components from Gibco, ThermoFisher Scientific).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NIH-3T3</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Human lung adenocarcinoma cell line Calu3 and human colon adenocarcinoma cell line Caco2 were maintained in MEM with 10 % FCS, 1 % P/S and 200 mM L-Glutamine.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu3</div><div>suggested: RRID:CVCL_EQ19)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For MC, probe sets for 19 human genes were hybridized to fixed HeLa cells and transcripts were detected using the standard MC protocol.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HeLa</div><div>suggested: CLS Cat# 300194/p772_HeLa, RRID:CVCL_0030)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 infection for MC: For SARS-CoV-2 infection experiments, 7.000 Huh7 cells, 15.000 PLC5 cells, 15.000 Caco2 cells and 20.000 Calu3 cells were seeded into 8x glass bottom slides (Ibidi) at a confluence of 30-50 % and infected with SARS-CoV-2 at an MOI of 0.4 (if applied to VeroE6 cells, titer maintained for comparison across cell lines) for 60 min at 37 °C at 5 % CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Huh7</div><div>suggested: RRID:CVCL_YU20)</div></div><div style="margin-bottom:8px"><div>Caco2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>VeroE6</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, the probe-design was performed at the gene-level using all full-length protein-coding transcript sequences from the ENSEMBL database tagged as ‘basic’52,53.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ENSEMBL</div><div>suggested: (Ensembl, RRID:SCR_002344)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The fully automated imaging process (including water immersion generation and precise relocation of regions to image in all three dimensions) was realized by a custom Python script using the scripting API of the Zeiss ZEN software (open application development).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div><div style="margin-bottom:8px"><div>Zeiss ZEN</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Hierarchical clustering and covariation analysis: Expression data was normalized to the total counts per cell (with exception of SARS-CoV-2 Np transcripts to avoid skewing of data) or ROI (Fig. 4) and scaled using Excel (Microsoft)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Excel</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Final figures were prepared using GraphPad Prism.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on pages 16 and 20. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • No funding statement was detected.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.11.463956: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">The experiments were not randomized and investigators were not blinded to allocation during experiments and outcome assessment.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">The experiments were not randomized and investigators were not blinded to allocation during experiments and outcome assessment.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">No statistical methods were used to predetermine sample size.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell Lines: 293T (or HEK293T) cells, 293T-ACE2, and Expi293F cells were cultured in DMEM media, supplemented with 10% FBS, 100 U/ml penicillin/ streptomycin, 2 mM L-glutamine, and in the presence of 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Expi293F</div><div>suggested: RRID:CVCL_D615)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">293T-ACE2 cells, derived from 293T, stably express human ACE2 71.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T-ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Expi293F cells, derived from the 293 cells, were purchased from ThermoFisher Scientific (cat # A14528; RRID: CVCL_D615).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Expi293F</div><div>detected: ( RRID:CVCL_D615)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viral infectivity measurements: The infectivity of lentivirus particles carrying S proteins (including variants) on the surface was evaluated using a vector containing an HIV-1 long terminal repeat (LTR) that expresses a Gaussia luciferase reporter (HIV-1-inGluc) 72,73. 293T cells were transfected at 60–80 % confluency with the plasmid encoding indicated full-length SARS-CoV-2 S glycoproteins, the plasmid encoding an intron-regulated Gluc (HIV-1-inGluc), and a plasmid pCMV delta R8.2 encoding HIV-1 GagPol (Addgene, plasmid # 12263) using FuGENE 6 (Promega, # E2311).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Untagged and double-tagged SARS-CoV-2 spike variants were generated based on a template full-length pCMV3-SARS-CoV-2 Spike (codon-optimized, Sino Biological, cat # VG40589-UT) plasmid that has translated amino acid sequence identical to QHD43416.1 (GenBank).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV3-SARS-CoV-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">D614G point mutation was introduced into both untagged full-length pCMV3 SD614 and double-tagged SD614 Q3/A4 constructs to generate both untagged and tagged SG614 variants.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV3</div><div>suggested: RRID:Addgene_161029)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">E484K point mutation was introduced into both untagged and tagged pcDNA3.1 SAlpha by site-specific mutagenesis.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1</div><div>suggested: RRID:Addgene_79663)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Viral infectivity measurements: The infectivity of lentivirus particles carrying S proteins (including variants) on the surface was evaluated using a vector containing an HIV-1 long terminal repeat (LTR) that expresses a Gaussia luciferase reporter (HIV-1-inGluc) 72,73. 293T cells were transfected at 60–80 % confluency with the plasmid encoding indicated full-length SARS-CoV-2 S glycoproteins, the plasmid encoding an intron-regulated Gluc (HIV-1-inGluc), and a plasmid pCMV delta R8.2 encoding HIV-1 GagPol (Addgene, plasmid # 12263) using FuGENE 6 (Promega, # E2311).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pCMV</div><div>suggested: RRID:Addgene_20783)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, DNA sequence encoding monomeric hACE2 followed by an HRV3C cleavage site, monomeric Fc tag, and 8xHisTag at the 3’-end were synthesized and cloned into the pVRC8400 vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pVRC8400</div><div>suggested: RRID:Addgene_63164)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Where indicated, the conformational effects of hACE2 on S proteins were conducted by pre-incubating fluorescently labeled viruses with 200 μg/ml hACE2 for 90 mins at room temperature before imaging and smFRET imaging data were taken in the continued presence of 200 μg/ml hACE2. smFRET quantification and statistical analysis: The analysis of smFRET data was performed using a MATLAB-based customized SPARTAN software package 78.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SPARTAN</div><div>suggested: (SPARTAN, RRID:SCR_014901)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Based on visual inspection of fluorescence and FRET traces that revealed direct observations of state-to-state (conformation-to-conformation) transitions, FRET histograms were fitted into the sum of four Gaussian distributions using the least-squares fitting algorithm in MATLAB.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MATLAB</div><div>suggested: (MATLAB, RRID:SCR_001622)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on pages 20 and 22. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Note: This rebuttal was posted by the corresponding author to Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Reply to the reviewers

      1. General Statements [optional]

      We thank the reviewers for their critical comments and suggestions. We are glad that the reviewers appreciated the quality of the data and the novel findings connecting the secretory trafficking machinery with extracellular matrix-related signaling.

      2. Description of the planned revisions

      Reviewer #1 (Evidence, reproducibility and clarity (Required)):

      The manuscript by Jung et al reports on an interesting finding that focal adhesion signaling regulates the expression of Sec23A and thereby regulates COPII-dependent trafficking. The data presented a mostly solid and the finding itself is highly novel, as it tackles an area of secretory trafficking that remains poorly understood, namely the connection between the ECM and secretion.

      I will list below all comments that I have mixing both technical and conceptual topics:

      \*Technical issues:***

      1-The authors should provide a better description of how the designed this siRNA library. What were the inclusion criteria for these 378 genes? I might have missed it, but I could not find this information easily.

      Reply: The library has been designed in-house based on gene annotations and literature to include cytoskeleton structural proteins, motor proteins, and other associated and regulatory proteins. We will add this information in the Materials and Methods section.

      2-Figure 2: I know this is challenging for EM images, but is there a way the authors could quantify these data? How many images were looked at? What was the average width of ER cisterne?

      Reply: We will provide image quantifications and statistics

      3-Figure 4: I think that the characterization of the FA phenotype is a bit underdeveloped. There is no quantification of these data. Is the size of FA changing? Is the number of FA per cell changing? Is the length of FAs changing? I think that more work is needed to increase the confidence in these data.

      I could also not easily see what type of cells these are. A better description of this experiment is also required. Also, how many cells were analyzed. I think it is important that this experiment is done with a sufficient number of cells to increase the confidence in the data.

      Reply: We agree with the reviewer that our observations regarding the focal adhesion (FA) phenotype will benefit from image quantification and we intend to include this in the revised manuscript. All FA experiments were performed on HeLa cells. We will update the materials and methods sections to better describe this experiment.

      \*Conceptual issues:***

      1-The finding that focal adhesion signaling negatively affects ER-export is surprising, because cancer cells that grow on stiff substrates have more focal adhesions and are more invasive and migratory. Both migration and invasion are expected to depend on ER-export. Although the authors did not formally test Sec23A expression under different stiffnesses, I would expect that stiff substrates would lower Sec23A expression and thereby negatively affect ER-export. It would certainly increase the breadth of this work to include data like this and to also discuss this highly surprising finding. However, it is of course the decision of the authors and the editors to decide whether such an experiment would benefit the entire story.

      Reply: In this work, we have shown that cells plated on ECM or matrigel have decreased SEC23A expression compared to control cells. We have also shown that inhibition of FA kinase leads to an increase in SEC23A expression (Figure 5). Whether this translates into a change in ER transport, is a fair point that we will address in the revision. Regarding stiffness, we have done a preliminary experiment that shows that cells plated on a soft synthetic substrate have less SEC23A than cells plated on plastic.This goes in line with our ECM experiments because Matrigel and fibroblast-derived ECM are softer than plastic.

      2-The authors postulate that this novel mechanism could be part of a feedback loop. If this were the case one would expect the acute effect of FA to increase ER-export (or secretion) and the negative feedback will then reduce secretion. However, the acute effect of FA is not addressed in this manuscript. In order to postulate a feedback loop, the authors would need to test the individual nodes of this loop.

      Reply: The question appears to be whether an acute effect on FA would affect the expression of SEC23A and therefore ER transport. If by the acute effect the reviewer means a pharmacological manipulation, we have shown that upon treatment with the FAK inhibitor the expression of SEC23A increases (Fig 5A). Whether this increase in SEC23A expression translates into a corresponding increase in ER transport remains to be seen. This will be tested in our revised manuscript as mentioned above in reply to point # 1.

      Our data encouraged us to propose a hypothetical feedback loop that would connect the deposition of ECM through the expression of SEC23A. We will have more data to support (or reject) this idea once we do the transport experiments as mentioned above. However, we think that a full characterization of this hypothetical loop by testing individual nodes is beyond the scope of this manuscript

      Reviewer #1 (Significance (Required)):

      I think that the basic finding of this manuscript is highly novel, by showing the impact of the ECM and focal adhesions on COPII-dependent trafficking. I think that this will not only appeal to people from the trafficking community, but also to people working on cell migration and on mechanobiology. The work in its current form does not require much extra efforts (max. 3 month). However, if the authors would decide to increase the breadth of data, they would require 3-6 months.

      Reply: We thank reviewer #1 for the comments. We also believe that this story will appeal to a broader audience and would help to bridge the gap between membrane trafficking and mechanobiology communities.

      \*Referees cross-commenting***

      I went through the comments of the two other reviewers and agree with their verdict. Some extra work on the characterization of the early secretory pathway would be good. Both reviewers provided a nice catalogue of possible experiments to choose from.

      Reply: We have characterized the early secretory pathway in terms of ER exit sites, Beta-COP, and Golgi morphology (FIG. 2B-H and S1A-B). Together, these data strongly characterize the nature of ER-block. Moreover, the finding that our interactors affect the expression of SEC23A allows us to explain mechanistically why an ER transport block occurs. This is further strengthened by the rescue experiments (FIG. 3F). We believe that further characterization of the secretory pathway will not contribute substantially to the main message of this manuscript.

      Reviewer #2 (Evidence, reproducibility and clarity (Required)):

      The manuscript by Jung et al which based on a targeted siRNA screen, demonstrates regulation of SEC23A (component of the SEC23 complex of the COP coat) levels at transcriptional level downstream of focal adhesion signaling. By regulating siRNA mediated downregulation, the authors were able to identify proteins which either increased or decreased traffic of VSVG through the secretory pathway when combined with downregulation in the levels of with either SEC23A or SEC23B. Authors have focused on a group of SEC23B functional interactors, downregulation of which shows them increased size of focal adhesions which also downregulate SEC23A levels, thus providing an explanation for reduced secretory traffic. Authors further show that plating cells on fibronectin or Matrigel, which activate Focal adhesion kinase signaling also results in downregulation of SEC23A transcript levels. The screen is conducted in a well-controlled manner for most parts with a clear explanation of the analysis routines and the data presentation if of very good quality. Most important results have been validated by more than one experimental strategy which lends substantial confidence to the findings. The results also open further avenues for understanding the transcriptional regulation in different physiological and disease contexts.

      There are certain issues, which the authors should address with regards to controls and some conflicting observations with published results with respect the phenotypes associated with downregulating proteins on focal adhesions size. Additionally, authors don't tie the ends by monitoring secretory traffic in cells grown on different matrices but include it in the model. Addressing/explaining these issues could improve this manuscript and the model may have to be tweaked a bit.

      \*Major comments:***

      1)I wonder why the authors only used siRNA control in their screen when the effects are scored in context of double knockdown fashion in combination with mild knockdown of SEC23A and SEC23B to get functional interactors. Control siRNA in combination with SEC23A and SEC23B should have been two ideal negative controls in the screen. Nevertheless, in data presented Figure 1E and whole of Figure 2, using control siRNA in combination with SEC23B siRNA would have been ideal control to show that the combination does not induce any trafficking defects which could impact the findings of the study. Hence, a few of the data presented from some of these figures should have sicontrol+SEC23B siRNA combination as a control.

      Reply: There seems to be a misunderstanding. In the screen, the negative controls are only used as a reference as the scoring is based on a 5X5 matrix centered on the siRNA of interest. This is done to overcome possible plate effects and to normalize data across different biological replicas. As seen in figure 1B, the negative controls (Control siRNA or Control siRNA + SEC23A siRNA or Control siRNA + SEC23B siRNA are very close to 0 (but not exactly 0) as they were not used in the normalization process. It is important to mention that all single knockdowns also contain our control siRNA to keep the same final siRNA concentration in single and double knockdowns. In Fig 1E we will include the images from Control + SEC23A siRNAs and Control + SEC23B siRNA as a reference. For Figure 2 all except 2A and 2H have the single knockdowns as controls.

      2)What is the identity of post-ER structures which authors refer to in Figure 2A? Could the images represent VSVG concentrated at ER exit sites? Authors should stain with markers for ERES to see if the VSVG puncta colocalize with it.

      Reply: We have done the experiment, and indeed these structures colocalize with an ER exit site marker (SEC31A). We intend to include this data into the revised manuscript. Our observations are in agreement with what is known in the literature about VSVG transport.

      3)Based on RNA sequencing results, authors chose to follow up on SEC23A levels in background of siRNA knockdown of components (like MACF1, ROCK1, FERMT2 etc.) which regulate Focal adhesions in cells and show that there is a reduction in both transcript and protein levels of SEC23A. In images shown in Figure 2B and Figure 2C, levels or SEC31A and β-Cop1 are reduced. Authors should test using qPCR and western blots whether there is a downregulation SEC31A, β-Cop1 and SEC23B in siRNA knockdowns of MACF1, ROCK1, FERMT2 etc. It would provide new insights if there were a co-regulation of secretory machinery to modulate the secretory traffic in response to Focal Adhesion based signaling.

      Reply: Our transcriptomics data (FIG 3C and Table 5) shows that SEC31A and COPB1 mRNAs are not altered upon any of the knockdowns. For SEC23B, we observed only a slight decrease in ROCK1 knockdown. This data suggests that a co-regulation of the secretory machinery might not be present. Instead, the curation of secretory pathway genes in our transcriptome data shows that SEC23A is the only commonly differentially expressed gene.

      4)Most major concern in this manuscript surrounds around results presented in Figure 4C. Authors show that in response to all the knockdowns, they see more focal adhesions as monitored by Vinculin staining and this along with the experiments with cells plated on Matrigel and Fibronectin arrive at the conclusion that increased Focal adhesion signaling downregulates SEC23A levels which presumably modulates secretory traffic. I am not an expert on Focal adhesions but based on my understanding of the literature on that topic, downregulation of ROCK1, FEMRT2 disrupts focal adhesions. (See: Theodosiou et. al., Elife, 2016 or Lock et. al., Plos One, 2012 for example). How do authors explain their results in siRNA knockdown of ROCK1 and FEMRT2 which leads to an increased size of focal adhesions which seems contradictory to the published results? To clarify these results authors should test phosphorylation of FAK in their siRNA backgrounds which is another read out of focal adhesion signaling.

      The experiments from cells grown on Fibronectin and Matrigel favor the argument which authors put forth, but authors may have to tweak the model a bit based on FAK phosphorylation and FAK signaling in context of above-mentioned knockdowns.

      Reply: Based on the images for vinculin staining, in our current manuscript we propose that changes in FAs occur upon knocking down our interactors. In our revised manuscript we will provide a more robust quantitative assessment of those changes (change in number, size, or intensity) as mentioned in our reply to Reviewer #1.

      As for the discrepancies in the relation of FA phenotype upon depletion of ROCK1 and FERMT2, we want to point out that this effect depends on the cell type used. For instance, the papers listed by the reviewer here use fibroblasts and keratinocytes respectively while we have used Hela Kyoto cells which are epithelial in nature. Another example is that while in fibroblasts depletion of FERMT2 leads to a rounded morphology and almost an absence of FAs (Theodosiou et. al., Elife, 2016), in podocytes (Qu et al JCS, 2011), it leads to fewer FAs but an increase in their size. Nonetheless, this is a very keen observation from the reviewer and we will address this point in our revised manuscript discussion.

      5)What happens to VSVG traffic or RUSH-Cadherin traffic when cells are plated on Matrigel and Fibronectin? Reduction in secretory traffic of these is an important experiment which is missing to close the loop and validate the model presented. Authors must test these experiments either with cells grown on matrix alone or in combination with siRNA to SEC23B. Authors should also monitor ERES and transport carriers in this background.

      Reply: We agree with the reviewer and intend to perform these experiments.

      6)This is not such a major issue, but it would be good to see a comparison in SEC23A levels in siRNA knockdown condition in comparison to those when cells are grown on different substrates and in ROCK1, FEMRT2 knockdowns (blots of which authors already have in this manuscript).

      Reply: We will assess the level of SEC23A at the protein level for cells plated on matrigel or Fibroblast-derived ECM.

      \*Minor comments:***

      1)Scale bars are missing in EM images in Figure 2H.

      Reply: We will add the scales in our EM images

      2)Show molecular weight markers in Western blots in main figure 3E and supplementary figure S1E.

      Reply: We will add molecular weight markers in our Western-Blots

      Reviewer #2 (Significance (Required)):

      I have looked at the manuscript from through the lens of a cell biologist as that is predominantly my area of expertise. In that respect I find the screen conducted by authors particularly interesting as they aim to connect how extracellular cues regulate the secretory pathway. A screen seems justified as there is no comprehensive understanding linking the two above-mentioned processes. Authors have done a functional interaction screen and analyzed a lot of images to identify candidates which either increase or decrease secretory traffic in combination with SEC23A and SEC23B. Such a functional screen has helped authors identify candidates which were otherwise missed in single siRNA knockdowns in their previous work from 2012. This definitely opens up interesting avenues to test the candidates identified in the screen in different physiological contexts and in disease as also the transcriptional program connecting Focal adhesion signaling with the regulation of components governing secretion. Such functional interaction screens could also be employed to identify crosstalk of different cellular processes with the regulation secretory pathway at ER as well as at the Golgi apparatus.

      Reply: We thank reviewer #2 for the comments. As we mentioned in our reply to reviewer #1, we strongly believe that these results will encourage further research at the crossroads of membrane trafficking and mechanobiology.

      \*Referees cross-commenting***

      I agree with the comments from both the referees that the manuscript is very interesting, most experiments are well controlled, but the quantification of focal adhesion phenotype in knockdowns need to be done in an extensive manner and secretion phenotypes need to measured upon plating cells on different matrix to validate the model presented.

      Reply: These two experiments will be included in our revision

      Reviewer #3 (Evidence, reproducibility and clarity (Required)):

      \*Summary***

      The authors use a synchronized cargo release assay following codepletion of either Sec23 paralog with cytoskeletal and associated proteins to identify potential functional interactions between COPII trafficking and the cytoskeleton. This screen yields a number of Sec23b functionally interacting molecules that stall cargo trafficking to various degrees within the secretory pathway upon codepletion, and in the case of MACF1 reduce ERES number despite not physically interacting. Depletion of the majority of the identified Sec23b functional interactors alone surprisingly caused the downregulation of Sec23a at the mRNA and protein levels, and cargo trafficking could be partially or fully rescued by Sec23a overexpression depending on the codepleted cytoskeletal factor. RNA-seq enrichment analysis and imaging of a focal adhesion marker suggest that genes involved in cell adhesion were differentially regulated following depletion of the cytoskeletal functional interactors. Finally, the authors show that Sec23a expression levels are reduced when cells are cultured on dishes with high amounts of ECM to induce focal adhesions, and that inhibition of focal adhesion kinase can rescue Sec23a expression levels.

      \*Major comments***

      #1 The authors successfully implicate a group of cytoskeletal proteins and their actions at focal adhesions in negatively regulating Sec23a expression levels and COPII trafficking. This description of a shared, novel mode of COPII transcriptional regulation by cytoskeletal factors is convincingly shown to be at least a contributor to the delayed trafficking in the presence of focal adhesions. In general, the data are reproducible and use appropriate statistical analysis. However, a more robust description of the architecture of early secretory pathway would be beneficial, especially in the case of MACF1 codepletion which cannot be fully rescued by Sec23a-YFP overexpression. In contrast, trafficking during codepletion of FERMT2 is fully rescued by Sec23a-YFP despite both MACF1 and FERMT2 showing similar loss of Sec23a mRNA levels upon codepletion. This data suggests that while the trafficking delay in FERMT2 codepletion might be exclusively due to reduced Sec23a expression levels, there are likely additional causes for the trafficking delay observed in MACF1 codepletion.

      Reply: We thank the reviewer for the appreciation of our results and the importance they might bear for the field. The reviewer has very neatly highlighted that each of our interactor hits might have roles in the secretory pathway beyond the ER or independent of the expression levels of SEC23A. This phenomenon could also explain the differential rescue of the arrival of VSVG at the plasma membrane upon SEC23A overexpression in FERMT2 and MACF1 knockdowns (FIG 3F). For instance, MACF1 has been involved in Golgi to Plasma Membrane transport as well (Kakinuma et al. Exp. Cell Res. 2004, Burgo et al. Dev. Cell 2012). So a possibility is that SEC23A overexpression rescues only ER to Golgi transport but the lack of rescue in the compartment between Golgi and plasma membrane independent of SEC23A expression levels would result in reduced rescue In the case of MACF1 compared to FERMT2. To support this, in our revised manuscript, we will provide example images from the experiment.

      Nonetheless, we agree that these are very important observations from Reviewer #3 and warrant a detailed discussion in the light of other interactors as well, which we intend to highlight in our revised manuscript.

      #2 While there is indeed a reduction in the number of ERESs following MACF1 codepletion, the authors report an even more dramatic reduction in 'transport intermediates / cell' as marked by COPI. However, as recent cyro-EM analysis of ERESs has definitively show, COPI exists stably at ERGIC membranes (1). Thus, an alternative possibility for the more dramatic reduction of COPI sites compared to Sec31a sites in Figures 2B-E is that ERGIC membranes are destabilized following MACF1 codepletion in a manner independent of Sec23a expression, and this destabilization compounds with reduced ERES number to ultimately delay trafficking. To more directly determine whether ERGIC membranes stability is regulated by MACF1, the authors should compare COPI and ERGIC-53 staining among MACF1 codepleted and FERMT2 codepleted cells with and without Sec23a-YFP overexpressed to levels that rescue cargo trafficking. If Sec23a-YFP restores the number of ERGIC puntae marked by these stains in FERMT2 but not MACF1 codepleted cells, it would suggest a role for MACF1 in forming or stabilizing ERGIC membranes which are known to associate with microtubules and WHAMM, an actin nucleator. Additionally, it would be useful to costain COPII with COPI or ERGIC-53 in control, MACF1 depleted, MACF1 codepleted, and MACF1 codepleted and Sec23a-YFP rescued cells to determine their colocalization. COPII and ERGIC membranes should be almost entirely coupled and juxtaposed in control cells and may be decoupled upon loss of MACF if plays a role in ERGIC membrane localization and stability. These proposed experiments are relevant because ERGIC membranes are sites of COPII cargo delivery and changes in ERGIC stability or localization would suggest an additional mechanism for cytoskeletal regulation of COPII trafficking. These immunofluorescence studies should be straightforward and completed in a few weeks.

      Reply: Although a possible additional role of MACF1 in the organisation of early secretory pathway, stability of ERES, etc., independent of the expression of SEC23A is interesting on its own, we believe that an extensive characterization of these possible roles/ pathways as proposed by the reviewer is beyond the scope this manuscript.

      #3 The choice to use VSVG and E-Cadherin for the synchronized release assays unfortunately convolutes interpreting the 'transport ratios' used by the authors to compare the effects of the various codepletions. Each protein progresses beyond the Golgi during secretion, and the authors choose to calculate the ratio of cargo intensity at the plasma membrane normalized to the total cellular cargo. This means that the synchronized release assays and calculated 'transport ratios' assay not only ER to Golgi trafficking, but also trafficking from the Golgi to the plasma membrane. In instances where Sec23a-YFP overexpression does not fully rescue the codepletion, it is possible that additional trafficking delays occur during Golgi to plasma membrane trafficking that cause the 'transport score' to decrease. Thus, the 'transport score' as the authors calculate it is needlessly nonspecific to COPII trafficking and should not be used to compare the codepletions for COPII functional interactors.

      Reply: We agree that the “transport score” used here and in our previous genome-wide screen (Simpson et. al Nat. Cell Biol. 2012) does not allow us to distinguish between the individual transport substeps in the transport of VSVG from the ER to the plasma membrane. However, as we see in Fig 1E, the proteins that we have decided to follow in more detail in this study do have a clear ER transport block phenotype (except for CRKL). So for 6 out of 7 of these proteins, the images clearly show that the decrease in the “transport score” is due to a decreased ER to Golgi transport.

      #4 To mitigate unwanted contributions of post-COPII trafficking events from altering 'transport scores,' the authors should use a cargo for synchronized release assays that does not progress past the Golgi such as α-Mannosidase II and quantify a ratio of the perinuclear cargo signal to whole cell signal. Ideally, the screen would be repeated with a more appropriate cargo generating new 'transport scores' for the full list of cytoskeletal proteins. However, this may not be feasible, and as such 'transport scores' based on a Golgi resident protein should at least be produced for the 7 Sec23b functional interactors featured in this manuscript. These Golgi 'transport scores' would add much needed quantification of ER to Golgi transport delays that currently can only be inferred from the representative images in Figure 1E, which unfortunately show significant heterogeneity among cells from the same image. The authors should also explicitly state that any 'transport score' from a synchronous release assay using a cargo destined for the plasma membrane will take into account trafficking rate changes due not only to COPII, but also COPI from the ERGIC to the Golgi, and transport carriers departing from the TGN. These synchronized release assays would likely take between a few weeks to a few months depending on their ability to automate image analysis.

      Reply: We consider that having a “Golgi transport score” won't add any new information as the proteins that we have chosen to follow are the ones that show a strong ER-block phenotype. However, we agree that such a “Golgi score” would indeed be useful if one would like to study other interactors, for instance, the ones that induce transport acceleration.

      Also, we don't expect all cells to behave similarly as the level of knockdown might be slightly different or because of the cell to cell variability. Even in control conditions (no knockdown), this heterogeneity is evident. As suggested by the reviewer, in our revised manuscript we will explicitly state that a change in the transport scores could mean a change in any sub-step of the transport from the ER to the PM in our assay.

      \*Minor comments***

      It would be useful for the authors to quantify the number of focal adhesions present from Vinculin stains from Figure 4C and 5C instead of just showing representative images. It would be interesting to determine if there is a meaningful relationship between focal adhesion number induced by the codepletions or tissue culture coating and Sec23a expression levels like in Figure 3D. Generally, the figures, text, and references were appropriate.

      Reply: As also pointed out by the other reviewers we will quantify the FA changes

      Reviewer #3 (Significance (Required)):

      In recent years, significant effort has been devoted to elucidating mechanisms by which COPII trafficking is modulated in response to cellular cues. These studies have revealed that changes in nutrient availability, growth factors, ER stress, autophagy, and T-cell activation all cause changes in COPII trafficking via unique gene expression, splicing, or post-translational control (2-7). This work elucidates a novel mechanism of transcriptional control driven by focal adhesions. Additionally, it provides a number of potentially useful Sec23a and Sec23b functional interactors among cytoskeletal factors for further study. These unexplored factors may have unique mechanism of COPII regulation that could contribute to our understanding ER export modulation. Altogether, this and similar works are building an increasingly complex set of regulatory pathways that when integrated ultimately dictate COPII trafficking kinetics.

      The reported findings are not only relevant to those who study COPII trafficking, but also other fields where secretion is studied in the context of the ECM. This work would suggest that secretion of factors involved in crosstalk between cells, including in tumors, is likely to be controlled by the interactions of cells with ECM.

      Reply: We thank reviewer #3 for the comments and insightful discussion about the limitations of our assay that we will highlight in the revised manuscript and in general for the insight into the early secretory pathway regulation. Furthermore their explicit summary of how our study could bridge COPII trafficking, ECM signaling and the relevance to various pathophysiologies is highly appreciated.

      Expertise keywords: cell biology, light microscopy, membrane trafficking

      References

      1.Weigel A V., Chang CL, Shtengel G, Xu CS, Hoffman DP, Freeman M, et al. ER-to-Golgi protein delivery through an interwoven, tubular network extending from ER. Cell. 2021 Apr;184(9):2412-2429.e16.

      2.Farhan, H., Wendeler, M. W., Mitrovic, S., Fava, E., Silberberg, Y., Sharan, R., Zerial, M., & Hauri, H. P. (2010). **MAPK signaling to the early secretory pathway revealed by kinase/phosphatase functional screening. Journal of Cell Biology, 189(6), 997-1011.

      3.Zacharogianni, M., Kondylis, V., Tang, Y., Farhan, H., Xanthakis, D., Fuchs, F., Boutros, M., & Rabouille, C. (2011). ERK7 is a negative regulator of protein secretion in response to amino-acid starvation by modulating Sec16 membrane association. **EMBO Journal, 30(18), 3684-3700.

      4.Lillmann, K.D., V. Reiterer, F. Baschieri, J. Hoffmann, V. Millarte, M.A. Hauser, A. Mazza, N. Atias, D.F. Legler, R. Sharan, et al 2015. **Regulation of Sec16 levels and dynamics links proliferation and secretion. J. Cell Sci. 128:670-682.

      5.Liu, L., Cai, J., Wang, H., Liang, X., Zhou, Q., Ding, C., Zhu, Y., Fu, T., Guo, Q., Xu, Z., Xiao, L., Liu, J., Yin, Y., Fang, L., Xue, B., Wang, Y., Meng, Z. X., He, A., Li, J. L., ... Gan, Z. (2019). Coupling of COPII vesicle trafficking to nutrient availability by the IRE1α-XBP1s axis. Proceedings of the National Academy of Sciences of the United States of America, 116(24), 11776-11785.

      6.Jeong, Y.-T., Simoneschi, D., Keegan, S., Melville, D., Adler, N. S., Saraf, A., Florens, L., Washburn, M. P., Cavasotto, C. N., Fenyö, D., Cuervo, A. M., Rossi, M., & Pagano, M. (2018). The ULK1-FBXW5-SEC23B nexus controls autophagy. ELife, 1-25.

      7.Wilhelmi, I., Kanski, R., Neumann, A., Herdt, O., Hoff, F., Jacob, R., Preußner, M., & Heyd, F. (2016). Sec16 alternative splicing dynamically controls COPII transport efficiency. Nature Communications, 7, 12347. https://doi.org/10.1038/ncomms12347

      3. Description of the revisions that have already been incorporated in the transferred manuscript

      4. Description of analyses that authors prefer not to carry out

      Reviewer #3 suggested to robustly characterise the early secretory pathway, in response to the depletion of our interactors, for instance, the role of MACF1 in the organization and the stability of ERES. This view is also supported by reviewer #1. However, in our revised manuscript we would like to focus more on the novel aspect of our study (as highlighted by all the reviewers), namely how ECM signaling and changes in FAs affect SEC23A and possibly ER transport. For this, we would like to present a more quantitative outlook of the FA phenotype and concentrate on the transport experiments. The reason for not dwelling into a more extensive characterization of the early secretory pathway is that these experiments are very interesting on their own, and merit a separate study that would deconvolve in detail the individual trafficking steps, and their relation to SEC23A expression, ERES stability, and ECM signaling.

      Reviewer #2 suggested that to better characterize the FA phenotype and solve the apparent discrepancies between our data and the literature, we could test FAK phosphorylation. As we mentioned in our reply to this point, we think that most of the discrepancies arise from the different cell types used. Nevertheless, we agree that a quantitative approach is needed for a better characterisation of FA phenotype, therefore we intend to perform quantification of the vinculin stainings.

    2. Note: This preprint has been reviewed by subject experts for Review Commons. Content has not been altered except for formatting.

      Learn more at Review Commons


      Referee #3

      Evidence, reproducibility and clarity

      Summary

      The authors use a synchronized cargo release assay following codepletion of either Sec23 paralog with cytoskeletal and associated proteins to identify potential functional interactions between COPII trafficking and the cytoskeleton. This screen yields a number of Sec23b functionally interacting molecules that stall cargo trafficking to various degrees within the secretory pathway upon codepletion, and in the case of MACF1 reduce ERES number despite not physically interacting. Depletion of the majority of the identified Sec23b functional interactors alone surprisingly caused the downregulation of Sec23a at the mRNA and protein levels, and cargo trafficking could be partially or fully rescued by Sec23a overexpression depending on the codepleted cytoskeletal factor. RNA-seq enrichment analysis and imaging of a focal adhesion marker suggest that genes involved in cell adhesion were differentially regulated following depletion of the cytoskeletal functional interactors. Finally, the authors show that Sec23a expression levels are reduced when cells are cultured on dishes with high amounts of ECM to induce focal adhesions, and that inhibition of focal adhesion kinase can rescue Sec23a expression levels.

      Major comments

      The authors successfully implicate a group of cytoskeletal proteins and their actions at focal adhesions in negatively regulating Sec23a expression levels and COPII trafficking. This description of a shared, novel mode of COPII transcriptional regulation by cytoskeletal factors is convincingly shown to be at least a contributor to the delayed trafficking in the presence of focal adhesions. In general, the data are reproducible and use appropriate statistical analysis. However, a more robust description of the architecture of early secretory pathway would be beneficial, especially in the case of MACF1 codepletion which cannot be fully rescued by Sec23a-YFP overexpression. In contrast, trafficking during codepletion of FERMT2 is fully rescued by Sec23a-YFP despite both MACF1 and FERMT2 showing similar loss of Sec23a mRNA levels upon codepletion. This data suggests that while the trafficking delay in FERMT2 codepletion might be exclusively due to reduced Sec23a expression levels, there are likely additional causes for the trafficking delay observed in MACF1 codepletion.

      While there is indeed a reduction in the number of ERESs following MACF1 codepletion, the authors report an even more dramatic reduction in 'transport intermediates / cell' as marked by COPI. However, as recent cyro-EM analysis of ERESs has definitively show, COPI exists stably at ERGIC membranes (1). Thus, an alternative possibility for the more dramatic reduction of COPI sites compared to Sec31a sites in Figures 2B-E is that ERGIC membranes are destabilized following MACF1 codepletion in a manner independent of Sec23a expression, and this destabilization compounds with reduced ERES number to ultimately delay trafficking. To more directly determine whether ERGIC membranes stability is regulated by MACF1, the authors should compare COPI and ERGIC-53 staining among MACF1 codepleted and FERMT2 codepleted cells with and without Sec23a-YFP overexpressed to levels that rescue cargo trafficking. If Sec23a-YFP restores the number of ERGIC puntae marked by these stains in FERMT2 but not MACF1 codepleted cells, it would suggest a role for MACF1 in forming or stabilizing ERGIC membranes which are known to associate with microtubules and WHAMM, an actin nucleator. Additionally, it would be useful to costain COPII with COPI or ERGIC-53 in control, MACF1 depleted, MACF1 codepleted, and MACF1 codepleted and Sec23a-YFP rescued cells to determine their colocalization. COPII and ERGIC membranes should be almost entirely coupled and juxtaposed in control cells and may be decoupled upon loss of MACF if plays a role in ERGIC membrane localization and stability. These proposed experiments are relevant because ERGIC membranes are sites of COPII cargo delivery and changes in ERGIC stability or localization would suggest an additional mechanism for cytoskeletal regulation of COPII trafficking. These immunofluorescence studies should be straightforward and completed in a few weeks.

      The choice to use VSVG and E-Cadherin for the synchronized release assays unfortunately convolutes interpreting the 'transport ratios' used by the authors to compare the effects of the various codepletions. Each protein progresses beyond the Golgi during secretion, and the authors choose to calculate the ratio of cargo intensity at the plasma membrane normalized to the total cellular cargo. This means that the synchronized release assays and calculated 'transport ratios' assay not only ER to Golgi trafficking, but also trafficking from the Golgi to the plasma membrane. In instances where Sec23a-YFP overexpression does not fully rescue the codepletion, it is possible that additional trafficking delays occur during Golgi to plasma membrane trafficking that cause the 'transport score' to decrease. Thus, the 'transport score' as the authors calculate it is needlessly nonspecific to COPII trafficking and should not be used to compare the codepletions for COPII functional interactors.

      To mitigate unwanted contributions of post-COPII trafficking events from altering 'transport scores,' the authors should use a cargo for synchronized release assays that does not progress past the Golgi such as α-Mannosidase II and quantify a ratio of the perinuclear cargo signal to whole cell signal. Ideally, the screen would be repeated with a more appropriate cargo generating new 'transport scores' for the full list of cytoskeletal proteins. However, this may not be feasible, and as such 'transport scores' based on a Golgi resident protein should at least be produced for the 7 Sec23b functional interactors featured in this manuscript. These Golgi 'transport scores' would add much needed quantification of ER to Golgi transport delays that currently can only be inferred from the representative images in Figure 1E, which unfortunately show significant heterogeneity among cells from the same image. The authors should also explicitly state that any 'transport score' from a synchronous release assay using a cargo destined for the plasma membrane will take into account trafficking rate changes due not only to COPII, but also COPI from the ERGIC to the Golgi, and transport carriers departing from the TGN. These synchronized release assays would likely take between a few weeks to a few months depending on their ability to automate image analysis.

      Minor comments

      It would be useful for the authors to quantify the number of focal adhesions present from Vinculin stains from Figure 4C and 5C instead of just showing representative images. It would be interesting to determine if there is a meaningful relationship between focal adhesion number induced by the codepletions or tissue culture coating and Sec23a expression levels like in Figure 3D. Generally, the figures, text, and references were appropriate.

      Significance

      In recent years, significant effort has been devoted to elucidating mechanisms by which COPII trafficking is modulated in response to cellular cues. These studies have revealed that changes in nutrient availability, growth factors, ER stress, autophagy, and T-cell activation all cause changes in COPII trafficking via unique gene expression, splicing, or post-translational control (2-7). This work elucidates a novel mechanism of transcriptional control driven by focal adhesions. Additionally, it provides a number of potentially useful Sec23a and Sec23b functional interactors among cytoskeletal factors for further study. These unexplored factors may have unique mechanism of COPII regulation that could contribute to our understanding ER export modulation. Altogether, this and similar works are building an increasingly complex set of regulatory pathways that when integrated ultimately dictate COPII trafficking kinetics.

      The reported findings are not only relevant to those who study COPII trafficking, but also other fields where secretion is studied in the context of the ECM. This work would suggest that secretion of factors involved in crosstalk between cells, including in tumors, is likely to be controlled by the interactions of cells with ECM.

      Expertise keywords: cell biology, light microscopy, membrane trafficking

      References

      1.Weigel A V., Chang CL, Shtengel G, Xu CS, Hoffman DP, Freeman M, et al. ER-to-Golgi protein delivery through an interwoven, tubular network extending from ER. Cell. 2021 Apr;184(9):2412-2429.e16.

      2.Farhan, H., Wendeler, M. W., Mitrovic, S., Fava, E., Silberberg, Y., Sharan, R., Zerial, M., & Hauri, H. P. (2010). MAPK signaling to the early secretory pathway revealed by kinase/phosphatase functional screening. Journal of Cell Biology, 189(6), 997-1011.

      3.Zacharogianni, M., Kondylis, V., Tang, Y., Farhan, H., Xanthakis, D., Fuchs, F., Boutros, M., & Rabouille, C. (2011). ERK7 is a negative regulator of protein secretion in response to amino-acid starvation by modulating Sec16 membrane association. EMBO Journal, 30(18), 3684-3700.

      4.Lillmann, K.D., V. Reiterer, F. Baschieri, J. Hoffmann, V. Millarte, M.A. Hauser, A. Mazza, N. Atias, D.F. Legler, R. Sharan, et al 2015. Regulation of Sec16 levels and dynamics links proliferation and secretion. J. Cell Sci. 128:670-682.

      5.Liu, L., Cai, J., Wang, H., Liang, X., Zhou, Q., Ding, C., Zhu, Y., Fu, T., Guo, Q., Xu, Z., Xiao, L., Liu, J., Yin, Y., Fang, L., Xue, B., Wang, Y., Meng, Z. X., He, A., Li, J. L., ... Gan, Z. (2019). Coupling of COPII vesicle trafficking to nutrient availability by the IRE1α-XBP1s axis. Proceedings of the National Academy of Sciences of the United States of America, 116(24), 11776-11785.

      6.Jeong, Y.-T., Simoneschi, D., Keegan, S., Melville, D., Adler, N. S., Saraf, A., Florens, L., Washburn, M. P., Cavasotto, C. N., Fenyö, D., Cuervo, A. M., Rossi, M., & Pagano, M. (2018). The ULK1-FBXW5-SEC23B nexus controls autophagy. ELife, 1-25.

      7.Wilhelmi, I., Kanski, R., Neumann, A., Herdt, O., Hoff, F., Jacob, R., Preußner, M., & Heyd, F. (2016). Sec16 alternative splicing dynamically controls COPII transport efficiency. Nature Communications, 7, 12347. https://doi.org/10.1038/ncomms12347

    1. Author Response:

      Reviewer #2 (Public Review):

      1. Presentation, analysis, and discussion of calcium imaging results

      a) As the authors correctly pointed out, having a water control is indeed essential for interpreting calcium imaging results. As such, I would recommend having a water control panel (currently in Figure S3) in the main figure.

      Thank you for this suggestion. We now provide a new figure, which shows the change in fluorescence of lratd2a right dHb neurons first exposed to water (control) and then to cadaverine or alarm substance. (refer to Figure 2A-D).

      b) The current presentation and analysis of calcium imaging data in Figure 2B does not seem appropriate and can be improved - since the dynamics of olfactory responses are likely highly variable across neurons and fish, rather than comparing responses across time, it would be better to compare the summed response over a longer time window (as already done in Figure S2, but also including water flow control data). Do also mention the time window over which the calcium responses were integrated.

      As noted above, we have added a new figure to represent the change in fluorescence of lratd2a right dHb neurons averaged over a 5 min time window. This trace also includes the standard error of the mean (shaded) to represent the variability in responses among all neurons that were imaged (refer to Figure 2A- D).

      c) Discussion Line 393: "From calcium imaging, we validated that the right dHb appears more responsive than the left when larval zebrafish are exposed to aversive odors such as cadaverine or chondroitin sulfate" - this conclusion cannot be drawn from the existing presented data, unless calcium imaging was also performed in the left habenula.

      Thank you for pointing out this error. Indeed, we were unable to monitor calcium signaling in the left dHb owing to barely detectable levels of GCaMP labeling in the lratd2a cells on the left. We have now corrected this and added the following sentence to the Results:

      “We monitored the responses of individual cells in the right dHb, as GCaMP6f labeling was weakly or not detected in neurons on the left (data not shown).”

      d) It would be good to include in the methods section more detail on how the odor was delivered, volume delivered etc, and whether control experiments were done on the same day / clutch of fish etc.

      We added the requested information in the “Calcium imaging in larval zebrafish” section of the Materials and Methods.

      1. Presentation, analysis, and discussion of c-Fos results and comparison with calcium imaging

      a) Figure 2C-D: The difference / overlap between blue and brown are difficult to make out in the images, especially at this resolution and magnification. Is there a way to specifically quantify the % of lratd2a neurons that are activated by c-fos, rather than just neurons in the dorsal habenula as a whole? This would be necessary to support the claim in line 278: "Thus, the lratd2a subpopulation in the right dHb responds to cadaverine in both larvae and adults".

      We have shown magnified images of double-labeling with fos and lratd2a probes in Figure 2E to G’ to help with visualization of the overlap in colorimetric double in situ hybridization. We quantified the % of the lratd2a expression domain where fos is expressed and provided this information in the results (page 7, lines 128-129).

      b) In larvae (using calcium imaging), the effects of cadaverine to chondroitin sulfate were compared, whereas in adults (using c-Fos), the comparison is between cadaverine and alarm substance. Is there a reason why the alarm substance was not used in larvae, or chondroitin on adult fish? Perhaps the authors can elaborate on their rationale.

      We were basing our experimental approach on results that had been published by others. For example, Krishnan et al. (2014) had shown that dHb neurons respond to chondroitin sulfate in 6-9 day old larvae. Previous studies had reported that the earliest responses to alarm substance can be seen around 42 days post fertilization in zebrafish (Waldman, 1982) and 48-57 days post-hatching in fathead minnows (Carreau-Green et al., 2008). Jetti et al. (2014) examined the response to alarm substance at 25 dpf zebrafish.

      1. Presentation, analysis, and discussion of behavioral results a) The presentation of the alarm substance behavior results could be improved. The authors could include the words "alarm substance" somewhere in the panels so it is clear to the readers that they are looking at responses to that rather than to cadaverine which is described in the preceding panels. Similarly, to avoid confusion and to facilitate comparison, the same parameters should be presented for Figures 3-5 (currently distance in top is not shown in Figure 3 or 5, onset of fast swim and interval time not shown in Figures 4-5).

      As suggested, we added the words “Cadaverine” and “Alarm substance” to Figures 3, 4, 5 and Supplementary figure 4. We also now show the same parameters for the response to alarm substance in BoTx-GFP and intersectional BoTx-GFP transgenic lines, and in tcf7l2 and bsx mutants (refer to Figures 3, 4, 5 and Supplementary figure 4).

      b) Does cadaverine induce changes in swim speed and other kinematic parameters? Similarly, does the alarm substance induce avoidance of one side of the tank like cadaverine? It can be difficult for the reader to compare the effects of genetic manipulations on responses to both odorants since different behavioral parameters are being quantified, hence some means of direct comparison could be helpful.

      As we had described in the discussion (page 14, lines 279-280): “Despite both being aversive cues (Hussain et al., 2013; Mathuru et al., 2012), cadaverine and alarm substance elicit different behavioral responses by adult zebrafish.” Alarm substance triggers immediate (within 1 min) erratic behavior such as rapid swimming, darting and prolonged freezing. Thus, it is not feasible to measure the same behavioral responses to the two aversive cues.

      c) The effect of cadaverine on control groups seems to be quite variable. In Figures 3 and 4 the avoidance effect persists the entire duration of the experiment. In Figures 5 and S4 the effect is only significant in 2 time bins. The authors' conclusions are still valid since the correct comparisons are indeed to their respective sibling controls, however it does make it a bit difficult to compare results across genotypes. For example, non-botox-expressing lratd2a:QF2 fish appear to have about the same degree of cadaverine avoidance as lratd2a:QF2, scl5a7a:Cre, QUAS:Botox fish. Similar to point (b), are there other parameters that can be measured that are more consistent in controls across genotypes? Or at the least, some discussion of the behavioral variability in the text.

      As correctly pointed out by the reviewer, different fish with different genetic backgrounds demonstrate different degrees in their response to odorants. However, behavioral measurements were reproducible over 2 to 3 trials testing the same groups of fish on different days. We now show the aversion index for all individuals tested for the response to cadaverine in a new figure (refer to Supplementary figure 7).

      d) tcf7l2 mutants (like bsx mutants) also have a significantly lower swim speed than controls, this is also worth mentioning / discussing in the text.

      We have now mentioned this in the results section of the main text (Page 10, lines 202-203).

      e) The link between habenular LR asymmetry and aversive behavior is indeed interesting - in the discussion, one proposal was that this asymmetry could promote directed turning and escape. From the existing data (particularly for the lratd2a:QF2, scl5a7a:Cre, QUAS:Botox fish), is there any evidence of differences in turning behavior (LR asymmetry, or probability of turns in general)?

      We did not observe any correlation between habenular L-R asymmetry and the direction of turning in response to alarm substance, although this is an interesting point. We added a sentence to the discussion (page 16, lines 323-324) to reference a recent study on the neural basis of this lateralized behavior.

      f) As a related point, it is not clear to me that one would expect an enhancement of cadaverine avoidance in bsx mutants, especially if the argument is that asymmetry is important for aversive behavior. Perhaps the discussion on this point could be framed less as a negative result but as a notable observation.

      We agree with the reviewer’s interpretation and have added the following sentences to the Results (page 11, lines 218-220): “Despite the symmetric activation of dHb neurons, bsx homozygotes and heterozygotes both showed reduced responsiveness to cadaverine,” and to the Discussion (page 15, lines 303-304): “We did not observe enhanced or prolonged aversion to cadaverine in bsxm1376 homozygotes relative to controls.”

      1. Statistical analyses: Unless data is normally-distributed, non-parametric tests should be used to compare on calcium and behavioral imaging data (such as Kruskal-Wallis for time course of the calcium / behavioral data, Wilcoxon Rank-Sum Test for others).

      As correctly pointed out by the reviewer, we have corrected our statistical analyses (refer to Materials and Methods and the Figure legends). We used two-way ANOVA followed by Bonferroni's post hoc test and an unpaired t-test for analyzing calcium imaging data. For analyzing the response to cadaverine within groups, we used the Wilcoxon signed-rank test and cited publications using comparable approaches (Koide et al., 2009; Wakisaka et al., 2017). For analyzing the data between groups, we used two-way ANOVA followed by Bonferroni's post hoc test.

    1. B · D e s d i f f i c u lt é s r é c u r r e n t e s d e s c o l a r i s at i o n : d e s s a i s i n e s d u D é f e n s e u r d e s d r o i t s t r o p p e u n o m b r e u s e s Lors des consultations et des échanges avec les « Gens du voyage » et les associations les représentant, la Défenseure des droits a pu constater les difficultés rencontrées quant à la scolarisation des enfants « du voyage » et à sa continuité. Le Défenseur des droits est parfois saisi de refus d’inscription scolaire, ou d’interruption de scolarisation, par des maires et services de municipalités, d’enfants « du voyage » ou de familles itinérantes installées dans des aires d’accueil ou de grands passages63, ou sur des terrains « occupés illégalement »
    1. SciScore for 10.1101/2021.10.08.21264741: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      NIH rigor criteria are not applicable to paper type.

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">We solve the minimization problem by means of the L-BFGS-B algorithm (Byrd et al., 1995), which combines the gradient projection method and the BFGS algorithm with optimized use of computational memory, implemented in the SciPy library in Python (Virtanen et al., 2020). 2.5.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SciPy</div><div>suggested: (SciPy, RRID:SCR_008058)</div></div><div style="margin-bottom:8px"><div>Python</div><div>suggested: (IPython, RRID:SCR_001658)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code.


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      The correlation between α and β2 represents a limitation in terms of identifiability of the system. In order to achieve a structural identifiability result it is necessary to know the recovered curve (see Appendix B), whereas for the practical identifiability it would be useful to approximate the transmission and mortality functions with a different model.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Author Response:

      Reviewer #1 (Public Review):

      Summary: In " Rapid and Sensitive Detection of SARS-CoV-2 Infection Using Quantitative Peptide Enrichment 1 LC-MS/MS Analysis" Hober, A. et al. describe the addition of peptide immunoprecipitation by means of SISCAPA technology to the Sars-Cov2 mass spectrometry-based diagnostics toolbox. The work shows in a straightforward way that this is a huge improvement and of great importance to the field. It shows beyond any doubt that mass spectrometry can become a clinically applied diagnostic instrument to detect (viral) infection.

      Overall remark: The main concern is the reported number of 83% sensitivity. This is not because the number is too low, but because the number is misleading. In line with "CLSI EP 12-A2 User Protocol for Evaluation of Qualitative Test Performance guidance" a summary of the sample analysis results are shown in a 2x2 contingency table. Unfortunately, I oppose to this representation of the results at this stage for three reasons: (i) reporting a percentage shouldn't be done on less than 100 samples because of the weight of a few misannotated samples on these numbers, be it in the qPCR or the MS results; (ii) because both assays are imperfect, it is impossible to assess the ground truth for calling patients and thus assess sensitivity and specificity; (iii) the authors still only target a single peptide, which is not conventional in MS-based assays that targets proteins.

      We have changed to PPA and NPA in the new version of the manuscript. We have also included 264 RT-PCR negative samples collected in the same study. We agree that protein quantification should not be done using only one single peptide. We have updated the manuscript to clarify that we do not perform protein quantification, but rather peptide quantification.

      Rather than the proposed confusion matrix, which assumes that the ground truth is known to call it e.g. "false negatives", the authors could refer to it as an agreement matrix and not be tempted to calculate threshold values like sensitivity, which have too much of an impact on the clinical readership that is used to seeing this value in a more controlled context. This is in line with the recent Lancet manuscript from Fitzpatrick, M. et al (2021), proposing percent positive agreement (PPA) and percent negative agreement (PNA) instead (Fitzpatrick et al., 2021).

      We have decided to keep the confusion matrix but we are referring to it as PPA and NPA and rephrased sensitivity to “estimated sensitivity” based on PPA.

      More specifically, as we and others have shown, qPCR Ct values rarely agree in two (consecutive) analyses, even within accredited settings (personal communication NHS). Above Ct30, patients regularly turned negative in our hands (https://doi.org/10.1021/jacsau.1c00048), even with an assay that had proven detectability of 1 plasmid at Ct40. Furthermore, we suspect that freeze-thaw cycles further inflate this uncertainty, two of which the current samples were subjected to. Undetected mRNA would then classify these patient samples as "false positives" if they did yield signal in the LCMS results. By chance, this did not happen in this manuscript, yet this could very well be the reason for the highest signal reported in Figure 3 as a green dot at log2 MRM response of -6 (see minor remarks).

      The authors already distinguished the patients in a High Pool of Ct <30, a Low Pool 30{less than or equal to}Ct<33 and the negative samples (Ct>40). It is clear from the gap (no 34<Ct<39) that finding patients between Ct33 and Ct39 is challenging. Indeed, qPCR has its own "diagnostic grey zone" of LOQ negative and LOQ positive that rarely is being referenced. Thus, a "sensitivity" of 95% for patients <Ct30, despite the low number of samples and considering the uncertainties in qPCR (just above or below Ct30) at least limits the comparison to samples that are positive beyond any doubt. But again, we would be thresholding against a trembling metric, in turn making the claim from the authors dangerous that "the estimated LLOQ is 3 amol/μL approximates to Ct {less than or equal to}30". Rather, the Ct30 threshold should be set for a different reason, if one is chosen at all.

      What is needed is good thresholding for clinical diagnostics, as is done in qPCR. In the public hospital in Belgium that provided us with patient samples, the positive threshold is set to Ct33 on the first measurement and practitioners use higher Ct values only in the context of physical symptoms of the disease to come to a final conclusion. For MS, we now need to measure >1000 samples in order to decide what log2 MRM response for a given set of peptides corresponds to an LOQ positive from - say - Ct27 to Ct30 and an LOQ Negative from Ct31 to Ct33. In other words, the linearity of the correlation between qPCR and MS illustrates the intrinsic value of MS; the point up until which we can provide clinically relevant information remains to be determined on large patient cohorts. In turn, these large patient cohorts can allow to sort (clinically) validated patients according to signal intensity and set a log2 threshold at which e.g. 2% or 5% negatives are expected, in line with False Discovery calculations for target decoy strategies. At this stage however, it might be most straightforward to conclude with percent positive agreement (PPA) and percent negative agreement (PNA), as is recommended for laminar flow tests validated on <100 samples.

      Finally, realizing the importance of this pivotal moment in the implementation of MS in the clinic, I find it somewhat tricky to only focus on one peptide. In fact, the authors perform the qPCR on two genes (three genes being even more common) because of the drop-outs that can occur. I feel like the use of peptide IP with MRM for detecting pathogens has not yet matured enough to rely solely on one peptide. Still, I understand that asking for a second peptide would mean repeating all the measurements, so that is most probably not realistic. Yet, I do consider this to be yet another reason not to report % sensitivity and specificity in the current manuscript and the potential to gain robustness with more peptides should clearly be emphasized at every stage of the manuscript.

      We agree that the method would be much improved by adding another peptide to the repertoire. The method was developed using the most sensitive antibody-peptide pair and the most promising pair was used in the downstream process. We have highlighted the limitations of using only one peptide and emphasized that this is a proof-of-principle study.

      In conclusion, because patient batches in the thousands are currently unavailable to MS-oriented diagnostic labs and because of all the reasons mentioned above, we cannot report the numbers of sensitivity and specificity in this manuscript, as they are misleading and do not quantify what they are intended to do.

      Fitzpatrick, M. C. et al. (2021) 'Buyer beware: inflated claims of sensitivity for rapid COVID-19 tests', The Lancet. Lancet Publishing Group, pp. 24-25. doi: 10.1016/S0140-6736(20)32635-0.

      We agree and have changed to PPA and NPA for this reason.

      Major remarks: P3L250: "on-column amount of 60 amol." Because of the enrichment procedure, could the authors specify what initial conditions they spiked into the dilution series prior to enrichment. This would allow recalculation and avoid confusion about the correctness of the 60 amol on column claim (which in our hands is still detectable).

      We made changes to this in the updated version of the manuscript.

      P8L181: "50 μL elution buffer (0.5 % 180 formic acid, 0.03% CHAPS, 1X PBS) and incubated for 5 min at room temperature." This minor sentence is placed under major remarks, because in our understanding the elution buffer needs to be acidic and adding PBS will reduce acidity. If this is a typo, please correct. If this is not, could the authors try and use H2O instead and see if their results improve?

      The access to the raw data was denied.

      The raw data is accessible through the provided Panorama link and can be accessed under the tab “Raw Data”. The entry in ProteomeXchange, however, is only a reserved data set identifier for now, but the data will be made available through this link after the review process.

      Reviewer #2 (Public Review):

      MS-based proteomics is currently discussed as a method for detection of viruses from clinical samples. Several studies have already shown the potential of this method on the example of the detection of SARS-CoV-2 from respiratory specimens. However, one of the major drawbacks still remains the low sensitivity of MS-based virus detection compared to real-time PCR, which is the gold-standard method. In their manuscript Hober and colleagues apply specific antibody-based enrichment of SARS-CoV-2 peptides from upper airway samples to concentrate the analyte prior to analysis by targeted MS (MRM). The authors determined the dynamic range of the method for four different SARS-CoV-2 NCAP peptides using a calibration curve. On the example of the SARS-CoV-2 NCAP peptide AYNVTQAFGR a correlation between the MS result and the cT value is shown. Furthermore, using stable isotope labelled (SIL) peptides as internal reference, a quantitative MS measurement was achieved. The presented approach is able to distinguish real-time PCR SARS-CoV-2 positive samples from negative samples in the used set of 88 samples from asymptomatic patients. Combined with a specificity of 100 % and sensitivities of up to 94.7 % for samples with cT values {less than or equal to} 30 the authors conclude that the method could be an alternative to real-time PCR.

      Strengths of the manuscript:

      I think the applied technique (SISCAPA) is highly interesting in the context of virus proteomics. This is because virus proteins are often underrepresented in relation to the host proteins, especially during early time points of infection, hampering their detection. Recently, the application of SISCAPA for SARS-CoV-2 diagnostics has been suggested in the discussion of a manuscript from Van Puyvelde and colleagues. The manuscript from Hober and colleagues presents the first study demonstrating that this technique can be applied to enrich, detect and quantify SARS-CoV-2 peptides from upper airway samples. The manuscript is clearly arranged, the data is sound and supports the main conclusions.

      Weaknesses of the manuscript:

      I think the manuscript in some points underestimates the PCR and vice versa overemphasizes the proteomics approach. For example, I don't agree that real-time PCR generally suffers from technical problems, degraded probes or non-specific amplification. Vice versa I think the LC-MS/MS approach is not inherently absolute specific and does not outperform PCR in terms of specificity. Further, LC-MS/MS does not eliminate the problem of false positives, which could be introduced during sample preparation or by inter-run contaminations. Although in real-time PCR no internal standards analogous to isotopically labelled peptides are used there are internal controls used to assure the quality of the extraction and the PCR reaction itself. The method presented by Hober and colleagues is clearly beneficial for the field of proteomics-based virus detection, but I suggest a more balanced discussion also including also the potential drawbacks of the method.

      Another point I like to raise is that the authors conclude at the end of the results section that patient samples were collected at an infectious stage.

      We have made changes to the manuscript accordingly and removed the claim that the samples were collected in an infectious stage since this cannot be confirmed. The patients did not show any symptoms when sampled, which has been highlighted in the new version.

      However, an assessment of the infectivity cannot be drawn from the presented data. The analysis of real-time PCR results in the manuscript is based on cT values. But to draw the conclusion, that the analysed samples contained infectious virus particles, the number of viral genome equivalents has to be determined, which in turn can be correlated to infectivity.

      We have removed this section since we cannot make any claim on infectious virus-particles.

      The detection of viral proteins itself does not proof that samples were collected at an infectious stage and there is currently no correlate of the amount of NCAP protein and infectivity. Since viral proteins are likely more stable than viral RNA, they could even be detectable for a more prolonged time in patient samples.

      Reviewer #3 (Public Review):

      Major comments

      P2, l245, Figure 2: It is not completely clear to me what is represented in panels A and B. Is this the pure SIL peptide of the endogenous peptide in a complex matrix? This may make a large difference for the determination of the LLOQ. Panel B shows a calibration curve and as these are curves for which the signal is detected based on known input amounts of sample, I assume that the input is pure SIL peptide here?

      In panel A, what does '3 amol/ul' in the middle chromatogram exactly mean? Is this the endogenous peptide that was calculated to be present at 3 amol/ul based on a known concentration of spiked-in SIL peptide?

      P4, l276: The authors need to explain the details of data imputation. It is unclear which data were imputed and how this was done. In Figure 3 the grey data points represent "not detected" or "inconclusively identified" samples by LC-MS, while some of the data points seem to have a higher 'response' values than others. Please explain.

      In Figure 3, how is 'response' defined? I don't understand the following sentence (p4, l277): "… for the LC-MS results the lowest response divided by three was used, mimicking….". Which variable does the data point size reflect? There seem to be clear differences in ball sizes. Please explain. For clarity, it would be advisable to keep the y-axes for panels A and B identical. Also, how could RT-PCR values be not obtained, apparently leading to missing Ct values (p5, l278)?

      Assuming that all collected samples from individuals in the test group in this study are visualized in Figure 3, the majority was tested positive for SARS-CoV-2. This is very different from the percentages oberserved in regular testing facilities. How was the study group composed? Were these individuals who were already admitted to the hospital?

      We have specified that the sampels were selected based on RT-PCR result and have included more negative samples in the new version of the mansucript. We have also speciied how individuals were enrolled into the study.

      It would be interesting to include more negatively tested individuals to see the distribution of 'MRM response' values in this group, since some of the negatively tested individuals (green data points) show higher than expected MRM response values if no viral protein is present at all. Related to this, I do not understand how a specificity score of 100 % (p5, l292) was obtained while some green data points (negative by RT-PCR) have higher associated MRM response values than some of the blue (positive by RT-PCR) samples. Can the authors explain this?

      The negative samples that show a stronger MRM response do not have the required qualifying ions, thereby failing the QC parameter of the assay. This has been clarified in the new version of the manuscript.

      I find the text from p6, l298 ("However…") onward more suited for the Discussion section, since this is about the interpretation of the results presented here and the use of the described methodology in diagnostics; no results are shown in this part.

    1. Karashchuk, P., Rupp, K. L., Dickinson, E. S., Sanders, E., Azim, E., Brunton, B. W., & Tuthill, J. C. (2020). Anipose: A toolkit for robust markerless 3D pose estimation [Preprint]. Neuroscience. https://doi.org/10.1101/2020.05.26.117325

      Check new publication instead of preprint

    Annotators

    1. SciScore for 10.1101/2021.10.05.463282: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: Written informed consent was obtained from all patients.<br>IRB: This study was approved by the Institutional Review Board of The University of Hong Kong/Hospital Authority Hong Kong West Cluster, the Hong Kong East Cluster Research Ethics Committee, and the Kowloon West Cluster Research Ethics Committee (UW 13-265, HKECREC-2018-068, KW/EX-20-038[144-26]).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">Male and female golden Syrian hamsters (Mesocricetus auratus) (aged 6–10 weeks) were purchased from the Chinese University of Hong Kong Laboratory Animal Service Centre through the HKU Laboratory Animal Unit</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">The hamsters were randomized from different litters into experimental groups.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Serially diluted plasma from healthy individuals or previously published monoclonal antibodies against HIV-1 (VRC01) were used as negative controls.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HIV-1</div><div>suggested: (bNAber Cat# bNAberID_1, RRID:AB_2491019)</div></div><div style="margin-bottom:8px"><div>VRC01</div><div>suggested: (bNAber Cat# bNAberID_1, RRID:AB_2491019)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Two consecutive staining steps were conducted: the first one used an antibody and RBD cocktail incubation of 30 min at 4 °C; the second staining involved staining with anti-His-APC and anti-His-FITC antibodies (Abcam) at 4 °C for 30 min to detect the His tag of the RBD.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-His-APC</div><div>suggested: (Miltenyi Biotec Cat# 130-101-320, RRID:AB_2747411)</div></div><div style="margin-bottom:8px"><div>anti-His-FITC</div><div>suggested: (Miltenyi Biotec Cat# 130-092-675, RRID:AB_1103226)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For dIgA antibody production, plasmids of paired heavy chain (IgA1, IgA2) and kappa light chain together with a J chain were co-transfected into Expi293™ expression system (Thermo Fisher Scientific) at the ratio of 1:1:1 following the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgA1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgA2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibodies produced from cell culture supernatants were purified immediately by affinity chromatography using recombinant Protein G-Agarose (Thermo Fisher Scientific) or CaptureSelect™ IgA Affinity Matrix (Thermo Fisher Scientific) according to the manufacturer’s instructions, to purify IgG and IgA, respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>IgA</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">2 mL-fractions were collected, pooled, concentrated and evaluated by western blot using mouse anti-IGJ monoclonal antibody [KT109] (Abcam) and rabbit anti-human IgA alpha chain antibody (Abcam).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-IGJ</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-human IgA alpha chain antibody ( Abcam) .</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The differences in response units between ACE2 injection alone and prior antibody incubation reflect the antibodies’ competitive ability against ACE2 binding to the spike protein.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For identification and localization of SARS-CoV-2 nucleocapsid protein (NP) in organ tissues, immunofluorescence staining was performed on deparaffinized and rehydrated tissue sections using a rabbit anti-SARS-CoV-2-NP protein antibody together with an AF488-conjugated anti-rabbit IgG (Jackson ImmunoResearch, PA, USA).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>SARS-CoV-2 nucleocapsid protein (NP</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-SARS-CoV-2-NP protein</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-rabbit IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After blocking with 0.1% Sudan black B for 15 min and 1% bovine serum albumin (BSA)/PBS at RT for 30 min, the primary rabbit anti-SARS-CoV-2-NP antibody (1:4000 dilution with 1% BSA/PBS) was incubated at 4°C overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2-NP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For identification of DC-SIGN expression, we stained the NT slices with rabbit anti-DC-SIGN primary antibody (Abcam) and Alexa Fluor 488 goat anti-rabbit IgG (H+L) cross-adsorbed secondary antibody (Life Technologies) according to the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-DC-SIGN</div><div>suggested: (IMGENEX Cat# DDX0208A488, RRID:AB_1929964)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For identification of ACE2 expression, the goat anti-ACE2 primary antibody (R&D) and Alexa Fluor 568 donkey anti-goat IgG (H+L) secondary antibodies (Invitrogen) according to the manufacturer’s instructions.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-goat IgG</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The infectious medium was replaced with fresh medium containing respective concentration of antibody after washing 3 times with PBS. 24 h later, the infected cells were imaged under fluorescence microscope after staining with AF488-conjugated anti-SARS-CoV-2 NP antibody.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2 NP</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were further permeabilized with 0.2% Triton X-100 and incubated with cross-reactive rabbit sera anti-SARS-CoV-2-N for 1 hour at RT before adding Alexa Fluor 488 goat anti-rabbit IgG (H+L) cross-adsorbed secondary antibody (Life Technologies).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-SARS-CoV-2-N</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After treatment with B8 antibodies at the dose of 3000 ng/ml/mL for 1 hour, HEK293T cells transfected with SARS-CoV-2 spike-GFP were added into the treated Vero-E6 TMPRSS2 cells and co-cultured for 48 hours.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>B8</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The viral challenge experiments were then conducted in our Biosafety Level-3 animal facility following SOPs strictly, with strict adherence to SOPs Cell lines: HEK293T cells, HEK293T-hACE2 cells Vero-E6 cells, HK2 cells and Vero-E6-TMPRSS2 cells were maintained in DMEM containing 10% FBS, 2 mM L-glutamine, 100 U/mL/mL penicillin and incubated at 37 □ in a 5% CO2 setting 62</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T-hACE2</div><div>suggested: RRID:CVCL_A7UK)</div></div><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>Vero-E6-TMPRSS2</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, The pseudovirus was generated by co-transfection of 293T cells with pVax-1-S-COVID19 and pNL4-3Luc_Env_Vpr, carrying the optimized spike (S) gene (QHR63250) and a human immunodeficiency virus type 1 backbone, respectively 77</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The antibody-virus mixtures were subsequently added to pre-seeded HEK 293T-ACE2 cells.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK 293T-ACE2</div><div>suggested: RRID:CVCL_A7UK)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Mixtures were then transferred to 96-well plates pre-seeded with 1×104/well Vero E6 cells and incubated at 37°C for 24 hours.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The HEK293T-CD209 cells were pre-treated with 10 ng/ml/mL of B8-dIgA or control dIgA and incubated for 6 h prior SARS-CoV-2 infection (MOI=0.05).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T-CD209</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Effects of B8 antibodies on SARS-CoV-2 mediated cell-cell fusion: Vero-E6 TMPRSS2 cells were seeded into 48-well plates and cultured overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6 TMPRSS2</div><div>suggested: JCRB Cat# JCRB1819, RRID:CVCL_YQ49)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After treatment with B8 antibodies at the dose of 3000 ng/ml/mL for 1 hour, HEK293T cells transfected with SARS-CoV-2 spike-GFP were added into the treated Vero-E6 TMPRSS2 cells and co-cultured for 48 hours.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, The pseudovirus was generated by co-transfection of 293T cells with pVax-1-S-COVID19 and pNL4-3Luc_Env_Vpr, carrying the optimized spike (S) gene (QHR63250) and a human immunodeficiency virus type 1 backbone, respectively 77</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pVax-1-S-COVID19</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pNL4-3Luc_Env_Vpr</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sequences were aligned using Clustal W in the BioEdit sequence analysis package (Version 7.2)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BioEdit</div><div>suggested: (BioEdit, RRID:SCR_007361)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Half-maximal (IC50) or 90% (IC90) inhibitory concentrations of the evaluated antibody were determined by inhibitor vs. normalized response -- 4 Variable slope using GraphPad Prism 6 or later (GraphPad Software Inc.)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div><div style="margin-bottom:8px"><div>GraphPad</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The defocus value of each image, which was set from −1.0 to −2.0 μm during data collection, was determined by Gctf.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gctf</div><div>suggested: (GCTF, RRID:SCR_016500)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Sequential data processing was carried out on RELION 3.0 and RELION 3.1.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RELION</div><div>suggested: (RELION, RRID:SCR_016274)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">RBD-Fab maps were fitted onto the whole structure map using Chimera, then combined using PHENIX combine_focused_maps.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PHENIX</div><div>suggested: (Phenix, RRID:SCR_014224)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Model building and structure refinement: The spike model (PDB code: 6VSB) and the initial model of the B8 Fab generated by SWISS-Model were fitted into the EM density map, and further manually adjusted with Coot.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Coot</div><div>suggested: (Coot, RRID:SCR_014222)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The final structures were validated using Phenix.molprobity</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>molprobity</div><div>suggested: (MolProbity, RRID:SCR_014226)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">. UCSF Chimera, ChimeraX and PyMol were used for map segmentation and figure generation.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PyMol</div><div>suggested: (PyMOL, RRID:SCR_000305)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">NP+ cells per field were quantified based on the mean fluorescence intensity (MFI) using the ZEN BLACK 3.0 and ImageJ (NIH).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The fluorescence density of SARS-CoV-2 infected cells was acquired using a Sapphire Biomolecular Imager (Azure Biosystems) and then the MFI of four randomly selected areas of each sample was quantified using Fiji software (NIH).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Fiji</div><div>suggested: (Fiji, RRID:SCR_002285)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Re-analysis of published nasal brushing single-cell data: The preprocessed scRNA-seq data from nasal brushing samples of 2 healthy controls and 4 COVID-19 patients were downloaded from Gene Expression Omnibus (GEO) database with accession numbers GSE171488 and GSE164547.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gene Expression Omnibus</div><div>suggested: (Gene Expression Omnibus (GEO, RRID:SCR_005012)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Quantification and statistical analysis: Statistical analysis was performed using PRISM 6.0 or later.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>PRISM</div><div>suggested: (PRISM, RRID:SCR_005375)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: We detected the following sentences addressing limitations in the study:
      One limitation is the insufficient amounts of HuNAbs distributed on the nasal mucosal surface for protection 47. Other reasons might include alternative entry pathways engaged by SARS-CoV-2 to evade HuNAbs. To this end, Liu et al. reported recently that antibodies against the spike N-terminal domain (NTD) induced an open conformation of the RBD and thus enhanced the binding capacity of the spike to the ACE2 receptor, leading to increased viral infectivity 66. Yeung et al. demonstrated nicely that SARS-CoV-2 could engage soluble ACE2 (sACE2) and then bind alternate receptors for viral entry, through interaction between a spike/sACE2 complex with the angiotensin II AT1 receptor, or interaction between a spike/sACE2/vasopressin complex with the AVPR1B vasopressin receptor, respectively 49. In this study, we found that, in the presence of potent neutralizing B8-dIgA1 or B8-dIgA2 antibodies, SARS-CoV-2 used the cellular receptor CD209 for capture or infection, which likely expanded the use of CD209+ cells as target cells, leading to enhanced NT infection and trans-infection. Interestingly, a preprint report suggests that cells expressing CD209 can be infected directly by SARS-CoV-2 through an interaction of the spike with the NTD instead of the RBD 67. This mode of action, however, was unlikely to explain our findings, because no enhancement of SARS-CoV-2 nasal infection was found in presence of control dIgA1 and dIgA2. Our results rather suggest that the direct binding of virus-b...

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Forbes, H., Morton, C. E., Bacon, S., McDonald, H. I., Minassian, C., Brown, J. P., Rentsch, C. T., Mathur, R., Schultze, A., DeVito, N. J., MacKenna, B., Hulme, W. J., Croker, R., Walker, A. J., Williamson, E. J., Bates, C., Mehrkar, A., Curtis, H. J., Evans, D., … Tomlinson, L. A. (2020). Association between living with children and outcomes from COVID-19: An OpenSAFELY cohort study of 12 million adults in England (p. 2020.11.01.20222315). https://doi.org/10.1101/2020.11.01.20222315

    1. Risk-enhancing factors include family history of premature ASCVD; persistently elevated LDL-C levels ≥160 mg/dL (≥4.1 mmol/L); metabolic syndrome; chronic kidney disease; history of preeclampsia or premature menopause (age <40 years); chronic inflammatory disorders (e.g., rheumatoid arthritis, psoriasis, or chronic HIV); high-risk ethnic groups (e.g., South Asian); persistent elevations of triglycerides ≥175 mg/dL (≥1.97 mmol/L); and, if measured in selected individuals, apolipoprotein B ≥130 mg/dL, high-sensitivity C-reactive protein ≥2.0 mg/L, ankle-brachial index (ABI) <0.9 and lipoprotein (a) ≥50 mg/dL or 125 nmol/L, especially at higher values of lipoprotein (a). Risk-enhancing factors may favor statin therapy in patients at 10-year risk of 5% to 7.5% (borderline risk).

      To be able to assign a value to the contributions of these disease processes, particularly earlier in life, could be a huge addition to clinical practice

    1. SciScore for 10.1101/2021.10.03.462915: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IACUC: Mouse experiments and authentic SARS-CoV-2 virus infection of mice: Animal studies were approved by the Institutional Animal Care and Use Committee of Duke University.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">C57BL/6 mice (Stock# B6-MPF, 5-8 weeks old, female or male) were purchased from Taconic (Rensselaer, NY).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">The percentage of pulmonary parenchyma affected was assessed on three randomly selected regions of interest from the digitized whole slide images using a grid overlay with Imagescope software.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Antibody against CTSL was purchased from R&D SYSTEMS (#AF1515)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Antibody against CTSL</div><div>suggested: (Abgent Cat# AP6788c, RRID:AB_1967364)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cell culture: HEK293T (ATCC #CRL-11268, RRID: CVCL_1926), Vero-ACE2 (Vero-E6 expressing high endogenous ACE2, BEI, NR-53726) cells were grown in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 1% penicillin/streptomycin and 10% fetal bovine serum (FBS, Thermo).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>detected: (ATCC Cat# CRL-11268, RRID:CVCL_1926)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Caco-2 (ATCC #HTB-37, RRID: CVCL_0025) cells were grown in DMEM supplemented with 1% penicillin/streptomycin and 20% FBS.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco-2</div><div>detected: (RCB Cat# RCB0988, RRID:CVCL_0025)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero-ACE2 cells stably expressing TMPRSS2 were generated by transduction of Vero-ACE2 cells with a lentiviral vector expressing human TMPRSS2, followed by blasticidin S HCl selection (7.5 μg/mL) for 7 days.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-ACE2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Serial dilutions of lung homogenate were incubated with Vero E6 cells in a standard plaque assay.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, HEK293T cells were transfected with HIV-1 NL4.3-inGluc (a gift of Marc Johnson at the University of Missouri, Columbia, Missouri, USA) and pcDNA3.1-SARS-CoV2-S-C9 (obtained from Fang Li at the University of Minnesota, St. Paul, Minnesota, USA) constructs in a 2:1 ratio using polyelthylenimine (PEI).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Pseudotyped virus infection: 3 × 105 of Vero-ACE2, Vero-ACE2-TMPRSS2 or Caco-2 were seeded into 6-well plate and transfected with CasRx mRNA and pre-gControl oligo (CasRx-pre-gControl) or pre-gCtsl oligo (CasRx-pre-gCtsl) by Lipofectamine MessengerMAX (Invitrogen, #LMRNA015).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Caco-2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Authentic SARS-CoV-2 B.1.617.2 Delta variant and cell infection: The variant strain (USA/PHC658/2021) was obtained from BEI Resources NR-55611. 3 × 105 of Vero-ACE2-TMPRSS2 cells were seeded into 6-well plate and transfected with CasRx-pre-gControl or CasRx-pre-gCtsl by Lipofectamine MessengerMAX.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-ACE2-TMPRSS2</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, 4 × 104 Vero-E6 cells were placed in each well of a 96-well tissue culture plate and allowed to adhere overnight.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-E6</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">C57BL/6 mice (Stock# B6-MPF, 5-8 weeks old, female or male) were purchased from Taconic (Rensselaer, NY).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>C57BL/6</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Survival study: K18-hACE2 mice were lightly anesthetized with isoflurane and infected intranasally with 105 PFU of SARS-CoV-2 (USA-WA1/2020 strain) in a total volume of 50 μl DMEM on Day 0.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>K18-hACE2</div><div>suggested: RRID:IMSR_GPT:T037657)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Briefly, HEK293T cells were transfected with HIV-1 NL4.3-inGluc (a gift of Marc Johnson at the University of Missouri, Columbia, Missouri, USA) and pcDNA3.1-SARS-CoV2-S-C9 (obtained from Fang Li at the University of Minnesota, St. Paul, Minnesota, USA) constructs in a 2:1 ratio using polyelthylenimine (PEI).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pcDNA3.1-SARS-CoV2-S-C9</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">A pathology disease index of respiratory disease was created using semi-quantitative scoring on digitized lung sections (Aperio AT2, Leica Biosystems) with Imagescope (Leica Biosystems)</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Imagescope</div><div>suggested: (ImageScope, RRID:SCR_014311)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The protein expression was quantified by densitometry (ImageJ) and normalized to calnexin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>ImageJ</div><div>suggested: (ImageJ, RRID:SCR_003070)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Statistical analyses: All data were analyzed by GraphPad Prism 9.0 software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We found bar graphs of continuous data. We recommend replacing bar graphs with more informative graphics, as many different datasets can lead to the same bar graph. The actual data may suggest different conclusions from the summary statistics. For more information, please see Weissgerber et al (2015).


      Results from JetFighter: Please consider improving the rainbow (“jet”) colormap(s) used on page 28. At least one figure is not accessible to readers with colorblindness and/or is not true to the data, i.e. not perceptually uniform.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.04.21264434: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: As the research laboratory processing needed to begin proximal to sample collection, a portion of the data was generated prior to obtaining informed consent.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">For each RNA-seq sample, we defined expressed sex based on the relative abundance of the sex-specific genes UTY (male) and Xist (female).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">This is often controlled by constructing batches using a randomization procedure that balances key outcome variables (e.g., case/control status) across batches.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Next, a 1:3,000 dilution of goat anti-human IgG/A/M F(ab)– horseradish peroxidase conjugated secondary antibody was prepared in PBS and 100 μl of this secondary antibody was added to each well for 1 hour (SouthernBiotech #2020-04 Lot No. L4206-Q408B, #2050-04 Lot No. C5213-RI66P, #2040-04 Lot No. B3919-NE80C).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG/A/M</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Lastly, we tested for differences in gene expression that are independent of the antibody response to the spike protein by fitting all models a second time with 3 additional coefficients controlling for the log2 titers of anti-spike-protein IgG, IgA, and IgM.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-spike-protein IgG</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>IgM</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">We controlled for multiple testing using Holm’s method for family-wise error rate control39 among all comparisons performed within a given symptom or cell type between DE signatures with at least 100 DEGs either before or after controlling for anti-spike antibody titers.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-spike</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Given the monumental hurdles of consenting sick and infectious patients in isolation rooms, the Human Research Protection Program allowed for sample collection, which occurred at the time of clinical collection and included at most an extra 5-10 cc of blood, prior to obtaining research consent.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Human Research Protection Program</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Blood used for Olink and enzyme-linked immunosorbent assays (ELISA) were collected in SST tubes (Becton Dickinson #367985) and blood used for whole genome sequencing (WGS) in CPT Vacutainer tubes (Becton Dickinson #362761).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>WGS</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">All plates were then put into the KingFisher to start DNA extraction.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>KingFisher</div><div>suggested: (Hamilton NIMBUS Presto and ID NIMBUS Presto Assay Ready Workstation, RRID:SCR_019998)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">This configuration enabled 2×150 bp paired end reads into resulting FASTQ files in 2-5 days per batch that were sent through primary data quality control using MultiQC to assess read depth and quality metrics17.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>MultiQC</div><div>suggested: (MultiQC, RRID:SCR_014982)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Quality-filtered raw data was converted into FASTQ files using bcl2fastq (Illumina).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>bcl2fastq</div><div>suggested: (bcl2fastq , RRID:SCR_015058)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">RNA-seq reads were aligned to the GRCh38 primary assembly18 with Gencode gene annotation v3019 by STAR (v2.7.3a)20 using per-sample 2-pass mapping (--twopassMode Basic) and chimeric alignment options (--chimOutType Junctions SeparateSAMold -chimSegmentMin 15 -chimJunctionOverhangMin 15).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Gencode</div><div>suggested: (GENCODE, RRID:SCR_014966)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">MultiQC17 was used to compile and summarize per-sample statistics from STAR, Picard Tools and featureCounts (i.e. gene-level counts, mtRNA counts, globinRNA counts, etc.) into an interactive HTML report.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>STAR</div><div>suggested: (STAR, RRID:SCR_004463)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">We therefore excluded samples with DV200 below 80% as well as samples with fewer than 10 million mapped reads counted by featureCounts.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>featureCounts</div><div>suggested: (featureCounts, RRID:SCR_012919)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Gene expression was normalized for composition bias using the trimmed mean of M-values method, implemented by calcNormFactors in the edgeR package25,26 and transformed to normalized log2 CPM with observation weights computed by voomWithDreamWeights from the variancePartition package27,28.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>edgeR</div><div>suggested: (edgeR, RRID:SCR_012802)</div></div><div style="margin-bottom:8px"><div>variancePartition</div><div>suggested: (variancePartition, RRID:SCR_019204)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The last 3 fixed effects listed are sequencing quality metrics computed by Picard Tools: PCT_R2_TRANSCRIPT_STRAND_READS is “the fraction of reads that support the model where R2 is on the strand of transcription and R1 is on the opposite strand”; PCT_INTRONIC_BASES is the “fraction of PF_ALIGNED_BASES that correspond to gene introns”; and WIDTH_OF_95_PERCENT is difference between the 2.5 percentile and the 97.5 percentile of the insert size distribution.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Picard</div><div>suggested: (Picard, RRID:SCR_006525)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Gene Ontology term enrichment analyses for DE signatures: For each DE test, the downregulated and upregulated DEGs were separately tested for Gene Ontology (GO) term enrichment for all GO terms annotated to at least 10 expressed genes, using the Bioconductor packages goseq, topGO, and org.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>topGO</div><div>suggested: (topGO, RRID:SCR_014798)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Study data were collected and managed using REDCap electronic data capture tools hosted by Scientific Computing at the Icahn School of Medicine at Mount Sinai48,49.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>REDCap</div><div>suggested: (REDCap, RRID:SCR_003445)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Canonical correlations between all technical, clinical, and demographic variables were calculated using the canCorPairs function and visualized using the plotCorrMatrix function from the Bioconductor package variancePartition29,55.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Bioconductor</div><div>suggested: (Bioconductor, RRID:SCR_006442)</div></div></td></tr></table>

      Results from OddPub: Thank you for sharing your code and data.


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. This review reflects comments and contributions by Ricardo Carvalho, Joachim Goedhart, Sónia Gomes Pereira, Pratima Gurung, Samuel Lord, Claudia Molina, Arthur Molines, Gregory Redpath, Mugdha Sathe, Sagar Varankar. Review synthesized by Ewa Sitarska.

      This preprint introduces a recombinant profilin that has a flexible linker to a genetically encoded fluorescent tag (either mApple or Halo). Fluorescent protein tagging is a popular and accepted method to study the properties of a protein of interest in solution and in cells. A careful analysis of the tagged protein relative to the untagged, native protein is crucial to understand whether the tagged protein faithfully reflects the behavior of the native protein. Therefore, studies like these are very valuable and the current manuscript is a good example of how such a study should be performed. The flexible linker presented here overcomes challenges observed in previous papers that found that linking a fluorescent protein to profilin disrupted some of its actin-related functions in cells and in vitro.

      This study is carefully conducted and nicely describes the properties of a fluorescent protein tagged profilin in a detailed manner. In particular, the authors use various in vitro assays as well as rescue experiments to demonstrate that their tagged version of profilin appears to behave similarly to wildtype profilin. The manuscript is written in a clear manner and was an enjoyable read. The comments below cover a couple of experiments, clarifications and questions for consideration to further add to the work. Regardless, this work is likely to contribute to the field, as anyone studying profilin is likely to try this construct in their future experiments.

      General comments:

      • Why was mApple chosen as a tag (as opposed to the popular and best known fluorescent protein mEGFP)?
      • The mApple is prone to photochromicity/photoswitching (https://doi.org/10.1038/nmeth.1209, https://doi.org/10.1038/nmeth.4074). This should be mentioned to warn future users of this fusion protein.
      • It would be advisable to be consistent with the naming of ‘untagged profilin’ throughout the manuscript. Currently unlabeled, untagged, wild-type or rescue are used interchangeably.
      • In Figures 4B, 5A there appears to be differences between untagged and tagged profilin in the images. Maybe a more representative image would be beneficial, where applicable.
      • Depositing the plasmids from this paper at addgene.org would be beneficial for the public (the plasmids can be deposited under condition that these will be released only after publication of this work in a peer-reviewed journal).

      Title

      ‘Functional fluorescently-tagged human profilin’– suggest clarifying in the title and throughout the text that the fluorescent tags are genetically encoded.

      Abstract

      ‘high cellular concentrations (121 µM)’– This is a very precise number for such a general statement. It seems that the number is derived from a specific cell line, so it would be beneficial to present it as a number from this cell line or change it to an approximation (~100 µM).

      Introduction

      'Some profilin outcompetes actin bound'– suggest some rewording to clarify the fragment, for example, it could be mentioned whether it refers to F-actin or G-actin.

      Results- Design of tagged profilin

      ‘Profilin is considerably smaller than the smallest fluorescent tags’ – clarifying that it is a genetically encoded fluorescent tag would be of advantage. There are no smaller fluorescent proteins (FP) yet, but genetically encoded FP of a similar size exist, for example miRFP670nano is 17kDa. https://doi.org/10.1038/s41467-018-08050-8

      ‘Traditional direct labeling approaches are cytotoxic and disrupt actin-based functions’ – is there data showing the new fluorescent profilin side-by-side with one without a flexible linker (or other version used previously) to show that the latter disrupts profilin's functions? It’s not essential but it would strengthen this point and confirm the improvement over prior work.

      ‘Estimates of cellular profilin concentration are very high depending on the cell type’ – would be nice to provide a rough estimate at this point, similarly to the introduction part.

      ‘with an mApple fluorescent probe or as Halo-tagged single molecules’ - What is the meaning of 'single' here?

      ‘We cloned mApple- or Halo-tags fused to a ten amino acid flexible linker on the N-terminus of human profilin-1.’ – As in the introduction, it is stated that “Positioning a GFP-derived fluorescent tag on the C- or N-terminus disrupts PLP- and PIP-binding interactions, effectively rendering the fluorescent version flawed for critical measurements in cells”, it would be beneficial to state the rationale for tagging profillin at the N-terminus? Also, how was the linker composition and length determined and how is it related to other linkers used in compromised fusions of profilin?

      Figure 1

      • In panel A, it would be helpful to indicate the N-terminus, as this is the side where the fluorescent protein is attached.
      • In the legend, PFN1 is introduced for the first time and thus, it could be replaced with ‘tagged-profilin (PFN1)’.

      Results - mApple-profilin binds phosphoinositide lipids with similar affinity as untagged profilin

      ‘PIP’ - PIP is usually an abbreviation for Phosphatidyl Inositol Phosphate (which is a lipid). Phosphoinositide is the same thing, but is not abbreviated as PIP. Recommend using Phosphatidyl Inositol Phosphate = PIP. These types of lipids can be indicated as PIPs (without the addition of lipids).

      ‘Profilin also binds PI(3,5)P2 which regulates critical signal transduction events through intracellular vesicles to the early endosome’ - The prevailing consensus now is that PI(3,5)P2 is involved in late endosomal trafficking to the lysosome. This could be different for profilin specific purposes, but this statement could be updated with recent references to PI(3,5)P2.

      ‘Thus, mApple-tagged profilin retains functional interactions with two important PIP lipids.’ – Testing other phospholipids, including PIP3 (Lu et al., 1996 showed an interaction with profilin) and some negative controls would be beneficial. Covering most phosphoinositide species by using the phospholipid-binding dot blots would make this figure stronger.

      Figure 2

      • In panel B, it would be easier to compare profilin and mApple-profilin binding affinity to each of the PIP lipids. For that, profilin and mApple-profilin samples could be run side by side in the same blot. The suggestion being that panel B includes profilin and mApple-profilin incubated with PI(3,5)P2, and panel C profilin and mApple-profilin incubated with PI(4,5)P2. For clarity, can it be specified in the figure legend or in the figure that the profilin-1 lane is the negative control pellet lacking the liposomes as well as that S and P stands for supernatant.
      • Also, in panel B, what are the loading controls? The quantification and western-blots are unclear. For example, it is indicated that 1µM PFN1was used in this experiment, but the pellet band for mAp-PFN1 is not comparable to PFN1 pellet band. Despite this, quantification in 2D shows that they are similar. Please clarify and add the corresponding loading controls.
      • Panel D: Please mention what is quantified here (supernatant, pellet or overall level),
      • Panel D and E: the shades to pink may be tricky to distinguish, more contrasting colors and/or shapes might be useful.
      • It is highly appreciated that the antibodies and dilutions are mentioned in the figure legend.

      Results - Direct visualization of fluorescent-profilin with polymerizing actin filaments

      ‘We used fluorescence anisotropy to measure the binding affinity between profilin and Oregon-Green (OG)-labeled monomeric actin (Figure S2).‘ - This appears confusing with the 3D results. If a change in fluorescence anisotropy with OG-actin is not detected, then is it okay to use OG-actin for bulk polymerisation assay. Maybe the OG-tag interferes only during fluorescence anisotropy, but not during fluorescence microscopy.

      ‘Several studies demonstrate that thymosin b4 (Tb4) competes with profilin to bind actin monomers‘ – It is worth mentioning that this refers to untagged/unlabeled actin monomers.

      Figure 3

      • Please consider if it is relevant to compare the competitive and non-competitive data on the same graph.
      • In panel A description, ‘10 nM GFP-thymosin b4 (GFP-Tb4) mixed with increasing concentrations of unlabeled actin.’ – Would ‘10nM unlabelled actin monomers in presence of increasing concentration of Τβ4’ be more appropriate?
      • In panel D, the curves would be better visible when the y-axis runs from 0-30.
      • In panel E, the mApple-Profilin samples show longer filaments, maybe quantification of the filament length could be performed?
      • In panel G, are the errors bars based on the means of the technical replicates or on all aggregated data? The first option is preferred, as this plotting strategy was also used in 3F.
      • In the panel description, ‘Data were quantified from four separate reactions (FOV) each.’ – could clarify whether the data derive from 4 totally independent reactions, or from the analysis of 4 different fields of view (FOV) from the same experimental procedure?
      • In the panel description, ‘ns, not significantly different from 1 µM actin alone control; a, compared with control (p <0.05)‘ – such labeling may be confusing for the reader, it would be beneficial to state that the first ‘ns/a’ are related to the actin alone, and the second ‘ns’ are comparing labelled and unlabeled profilin or omit showing the statistical test in the plot, and show it in a table instead.

      Results - Fluorescent profilin stimulates formin-based actin filament assembly

      General: Based on the competition and interaction experiments it seems important to generate a dose-dependent inducible construct for profilin to govern the stoichiometry of interactions and study their relevance in the cells.

      ‘Similar to experiments in assessing only profilin-actin interactions (Figure 3F), we counted significantly fewer actin filaments in reactions containing actin and either profilin (Figure 4D)’ - In Figure 3F the plot shows around 45 actin filaments per FOV with 1 uM actin (20% oregon green actin). In Figure 4D the plot shows more than 100 actin filaments per FOV with 1 uM actin (10% alexa 647 actin). Surprisingly, the elongation rate are similar in Fig 3F and Fig 4D. Is the Oregon-Green actin known to be less efficient at nucleating filaments while retaining the same polymerization ability? If it is the case, it would be worth making a mention.

      ‘Thus, fluorescent profilin stimulates formin-mediated actin filament nucleation similar to the untagged version.’ - The data seem to suggest that the presence of profilin inhibits actin filament nucleation and polymerization, a clarification would be appreciated.

      ‘The ac-celerated rate of actin filament’ – Please change to ‘accelerated’.

      Results - Profilin directly binds tubulin dimers and enhances the growth rate of microtubules in vitro

      ‘microtubule stability index‘ – The values indicated on the y-axis for the plot in Fig 5E are confusing (0 / 25/ 50 / 75 / 1). Is the index expressed as a percentage and the max value supposed to be 100? Or is the index supposed to be the number of rescues per catastrophe?

      ’This suggests a mechanism where profilin accelerates microtubule polymerization by directly binding to tubulin dimers to promote microtubule assembly and then diffusing along the sides of the microtubule lattice to further stabilize microtubule growth.‘ - Microtubules are more stable the faster they grow (catastrophe frequency scales inversely with polymerization rate). In this condition where profilin increases polymerization rate by around 5x, it is unclear how much of the increased stability is due to the lattice binding. The fragment could be softened regarding the role of the transient lattice binding in microtubule stabilization.

      Figure 5

      • In panel B, intensities are quite different, would it be possible to comment on this?
      • In panels H an I, a black/magenta merge is tricky to see. Although it breaks consistency, a green/magenta or cyan/magenta merge may be more informative visually.

      Results - Profilin regulates the morphology of N2a cells through actin and microtubule crosstalk

      ‘We used quantitative western blots to determine the level of endogenous profilin as well as levels of profilin in CRISPR knockout cells following transfection with plasmids containing untagged profilin, mApple-profilin, or Halo-profilin.’ - The levels of profilin are quantified from a blot, which is a bulk measurement. The transfection of profilin will show substantial cell-to-cell variation (some cells may have much higher or lower levels than the measured average). Mentioning it and discussing its implications would be advisable.

      ‘We chose this parameter because N2a cells have unique actin filament and microtubule cytoskeletal features but do not efficiently perform other classic cell processes that require intact cytoskeletal crosstalk (i.e., migration or division).‘ – While looking at cell shape is one strategy, an additional experiment looking into a migration phenotype may strengthen this point. Another interesting experiment to strengthen this point and providing a direct measure of profilin function could be performing a pulse chase experiment using drugs to depolymerise actin/microtubules. In such an experiment, a distinct change in depolymerisation should be noted between WT, KO, and the profilin rescue cells. This could show that the mApple-profilin can substitute for WT profilin.

      ‘super resolution confocal microscopy to image fixed cells.‘ – how is super-resolution achieved here? Or is ‘super’ unnecessary here?

      ‘the ratio of endogenous cell area to other cell conditions’ - This metric is a ratio of areas and it is only valid as an assessment for shape if the cells from each condition cover similar areas. If it is not the case, then the two parameters (shape and area) are convoluted and the ratio measures both the difference in shape and in area covered. It would be good to provide the average area of the cells in each condition for clarification.

      ‘We also stained these cells for actin filaments (Figures 6H and 6I) and micro-tubules (Figure 6J and 6K) and used a similar morphology parameter to detect broad differences in cytoskeletal architecture.’ – Please clarify the reasons for using the cell area ratio metric for quantification of cell morphology. How is the quantification metric (area) used for sub-cellular network like actin and microtubule? F-actin stained with phalloidin looks different in endogenous PFN1 vs mApple-PFN1, but by using area metric there is no morphological difference. Microtubule, on the other hand, appear similar in all the cells.

      Figure 6

      • In panel A, it does not seem like mApple-PFN1 and Halo-PFN1 reach endogenous levels. Maybe a quantification would be beneficial.
      • In panel B, please report the number of independent replicates. Also, may be worth commenting on why tagged PFN1 rescue cells were not included?
      • For panel E, please provide the error bars and the legend that contains the information from where the data derived or from how many independent experiments.
      • In panel F, it may be advantageous to use red green and blue as colors for the overlay. This will generate unique colors for the different combinations of the three images.
      • For the context of panel F, unprocessed images of the tagged profilin in living cells could be presented somewhere in the main text. They could be larger than the small panels here, and not be segmented into binary images. The point of the fluorescent profilin is that it can be used for live-cell imaging without substantially disrupting the typical profilin interactions. This should be confirmed by presenting live-cell images of the profilin construct. To avoid problems with high cytoplasmic concentrations of profilin drowning out any localization signal, maybe the fluorescent version could be expressed at a very low level or the Halo version could be used with a low concentration of fluorophore.
      • In panel G, it is clear that the dots are from different cover slips, how many cells were analyzed per coverslip? Data could be shown from individual cells (not just their average). Also, please clarify if this quantification was made 24 hours after transfection as well?
      • For panel I, actin morphology was calculated from actin filament signals similar to the cell morphology index. These calculations could be explained further in the methods. Does this mean that the actin morphology index is the ratio of actin area between the two conditions? Is the actin image somehow thresholded before taking the ratio?
      • Panel L, is really appreciated and helpful to understand the "competition" between actin and microtubules for profilin. It would be also nice to represent the plasma membrane and the lipid-binding activity of profilin as well as binding to nucleation promoting factors (the proline-rich motifs of VASP and WASP), as this is mentioned throughout the paper.

      Discussion

      The fact that mApple and HaloTag both are entirely different and non-disturbing gives confidence that profilin can be fused with other tags, without losing functionality. Mentioning this in the discussion could give new insights for the readers.

      ‘Our genetic analyses in mammalian cells indicate that mApple-profilin and Halo-profilin are fully inter-changeable with the endogenous version.‘ - Authors have given the field an excelled tool which will be quite useful to study cellular functions of PFN1, its interaction with its several binding partners. Currently, cell shape is the metric used to determine if the tagged versions are fully inter-changeable with the endogenous version. Whether the tagged PFN1 can replace untagged PFN1 for other cellular functions will require further exploration. Also, high concentration of PFN1 will remain an issue even with the mApple-PFN1 developed here. Do the authors suggest mild over-expression as a strategy to go around the high concentration issue?

      ‘Based on localization experiments using the pan-formin inhibitor, SMIFH2, some interactions between profilin and the sides of micro-tubules are thought to be indirect.’ – suggest clarifying how SMIFH2 treatment leads to conclude that interactions between PFN1 and microtubules is indirect.

      Methods

      Statistical significance tests do not demonstrate that conditions are identical. That is, when two conditions are not statistically different, it is not possible to say that these are equal (https://doi.org/10.1053/j.seminhematol.2008.04.003). Suggest avoiding the use of "n.s." in graphs to indicate that the data are similar. It is clear from the data that (in many cases) the tagged and untagged profilin show similar properties. If equality needs to be demonstrated, recommend carrying out an equivalence test.

      ‘Different shades of data points show technical replicates.’ – Please rephrase to clarify, for example “Different colors represent biological replicates. Similar colored dots reflect technical replicates“. Does "technical replicate," mean repeated measurements within each independent experimental run? Or different experimental runs? If the shading is supposed to denote paired experiments (e.g. darkest shading in different conditions are from the same experimental run), that can be stated in the caption.

    1. SciScore for 10.1101/2021.10.02.462862: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Wild type and the variants stocks of SARS-CoV-2 were expanded from the seed stocks by infecting Calu-3 cells by in EMEM medium containing 2% FBS, L-glutamine and penicillin/streptomycin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: BCRJ Cat# 0264, RRID:CVCL_0609)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Vero-TMPRSS2 cells (175,000 cells per well) were added into 24 well plates in DMEM medium containing 10% FBS, L-glutamine, puromycin (10 μg/ml) and penicillin/streptomycin and the plates were cultured overnight at 37°C in 5% CO2.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero-TMPRSS2</div><div>suggested: JCRB Cat# JCRB1818, RRID:CVCL_YQ48)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The Absolute IC50 values were calculated using GraphPad Prism 9 program choosing nonlinear regression in a Dose-Response curve.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.01.21264349: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">IRB: The current study was conducted after obtaining clearance from Institute Ethics Committee with waiver of individual consent [IECPG 756/23.12.2020; RT-01/2020] Virus microneutralization assay: Vero E6 cells (NCCS, Pune, India) were maintained in DMEM high glucose medium (HiMedia) supplemented with 10% heat-inactivated FBS, 100U of penicillin and 100 µg of streptomycin in 5% CO2 incubator.<br>Consent: The current study was conducted after obtaining clearance from Institute Ethics Committee with waiver of individual consent [IECPG 756/23.12.2020; RT-01/2020] Virus microneutralization assay: Vero E6 cells (NCCS, Pune, India) were maintained in DMEM high glucose medium (HiMedia) supplemented with 10% heat-inactivated FBS, 100U of penicillin and 100 µg of streptomycin in 5% CO2 incubator.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Authentication: The convalescent serum samples from children infected with HCoVs OC43, NL63 and 229E were evaluated for antibodies against respective human coronaviruses by immunofluorescence assay.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Cells were then stained with anti-spike RBD antibody at 1:4000 dilution (Sino Biologicals; 40592-T62) for 1 h, followed by HRP-conjugated anti-rabbit antibody at 1:4000 dilution (Invitrogen; G-21234) for 1 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-spike RBD</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-rabbit</div><div>suggested: (Innovative Research Cat# G-21234, RRID:AB_1500696)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The secondary antibodies used were goat anti-human IgG-Alexa 488 (A11013 - ThermoFisher) for human sera or goat anti-rabbit IgG-Alexa 488 (A21206-ThermoFisher) for nucleocapsid antibodies.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-human IgG-Alexa</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-rabbit IgG-Alexa</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The current study was conducted after obtaining clearance from Institute Ethics Committee with waiver of individual consent [IECPG 756/23.12.2020; RT-01/2020] Virus microneutralization assay: Vero E6 cells (NCCS, Pune, India) were maintained in DMEM high glucose medium (HiMedia) supplemented with 10% heat-inactivated FBS, 100U of penicillin and 100 µg of streptomycin in 5% CO2 incubator.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero E6</div><div>suggested: RRID:CVCL_XD71)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Human hepatoma cells (Huh-7) (Japanese Collection of Research Bioresources Cell Bank) were grown at 37° C in Dulbecco’s minimum essential medium (DMEM) (Lonza 12-707F) containing above additives and non-essential amino acids (Gibco-111400-50).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Huh-7</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Virus propagation: HCoV-OC43 was propagated in BHK-21 and HCoV-NL63 in LLC MK2 cells in MEM supplemented with 2% heat-inactivated FBS, 100 U/mL of penicillin, and 100 µg/L of streptomycin at 34° C under a humidified atmosphere of 5% CO2 for 4 days and 6 days respectively.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>BHK-21</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Virus dilutions of 1:10 for HCoV-NL63 and HCoV-OC43 infection in LLC MK2 and 1:10000 for HCoV-229E infection in Huh-7 cells were determined as optimum for infection without cytopathic effect.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HCoV-NL63</div><div>suggested: RRID:CVCL_RW88)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The microspots were quantified by AID iSPOT reader (ELR08IFL; AID GmbH, Strassberg, Germany) using AID EliSpot 8.0 software. 50% neutralization values were calculated with four-parameter logistic regression using GraphPad Prism 7.0e software.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. SciScore for 10.1101/2021.10.01.462460: (What is this?)

      Please note, not all rigor criteria are appropriate for all manuscripts.

      Table 1: Rigor

      <table><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Ethics</td><td style="min-width:100px;border-bottom:1px solid lightgray">Consent: Isolation of primary neutrophils: Primary human neutrophils were obtained from healthy donors with their written informed consent by The Oxford Radcliffe Biobank with project number ORB 20/A136.<br>IRB: The study is authorized by South Central – Oxford C Research Ethics Committee (Ref# 19/SC/0173).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Sex as a biological variable</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Randomization</td><td style="min-width:100px;border-bottom:1px solid lightgray">For cDNA synthesis, around 1 µg RNA (10 µl) was incubated with 1 µl 10 µM random pentadecamers (IDT 169190224) and 0.5 µl 100µM anchored oligo(dT)20 primer (Sigma, custom synthesized) at 65°C for 5 minutes, before supplemented with 0.5 µl RevertAid reverse transcriptase (Thermo Scientific EP0441) and 0.5 µl RiboLock RNase inhibitor (Thermo Scientific EO0381) in a total volume of 20 µl RevertAid Reverse Transcriptase buffer (Thermo Scientific LT-02241).</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Blinding</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Power Analysis</td><td style="min-width:100px;border-bottom:1px solid lightgray">not detected.</td></tr><tr><td style="min-width:100px;margin-right:1em; border-right:1px solid lightgray; border-bottom:1px solid lightgray">Cell Line Authentication</td><td style="min-width:100px;border-bottom:1px solid lightgray">Contamination: Cells were routinely checked for Mycoplasma Spp.<br>Authentication: Cell lines were not authenticated.</td></tr></table>

      Table 2: Resources

      <table><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Antibodies</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Primary antibodies used for Western blotting in this study include: anti-ZBP1 (Cell Signaling 60968), anti-Actin, clone C4 (Millipore MAB1501), anti-RIPK3 (Cell Signaling 13526), anti- phospho-p65 (Cell Signaling 3033), anti-p65 (Cell Signaling 8242), anti-phospho-p38 (Cell Signaling 4511), anti-p38 (Cell Signaling 9212), anti-phospho-JNK (BD 612540), anti-JNK (Cell Signaling 9258), anti-phospho-RIPK3 (S227) (Abcam ab209384), anti-RIPK1 (Cell Signaling 3493S), anti-Ubiquitin (rabbit, Cell Signaling, 43124), anti-Ubiquitin (mouse, Cell Signaling 3936), anti-GFP (Cell Signaling 2555), anti-CYLD (Cell Signaling 8462), anti- OTULIN (Cell Signaling 14127), anti-HOIP (R&D AF8039), anti-M1-Ub (kindly provided by David Komander and Rune Busk Damgaard), anti-HOIL-1L (Novus NBP1-88301), anti-SHARPIN (Protein tech 14626-1-AP), anti-TAK1 (Cell Signaling 4505), anti-IKK β (Cell Signaling 8943), anti-K63-Ub (Cell signaling 5621), anti-cIAP1 (Enzo ALX-803-335), anti-FLIP (Cell Signaling 3210), anti-Cleaved caspase-8 (Cell Signaling 9496), anti-Caspase-8 (D35G2) (Cell Signaling 4790) and anti-Caspase-8 (C15) (Adipogen, AG-20B-0057).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-ZBP1</div><div>suggested: (Cell Signaling Technology Cat# 60968, RRID:AB_2799599)</div></div><div style="margin-bottom:8px"><div>anti-Actin</div><div>suggested: (Millipore Cat# MAB1501, RRID:AB_2223041)</div></div><div style="margin-bottom:8px"><div>anti-Actin, clone C4 (Millipore MAB1501), anti-RIPK3 (Cell Signaling 13526)</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti- phospho-p65 (Cell Signaling 3033)</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>phospho-p65</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-p65</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-phospho-p38</div><div>suggested: (Cell Signaling Technology Cat# 4511, RRID:AB_2139682)</div></div><div style="margin-bottom:8px"><div>anti-p38</div><div>suggested: (Cell Signaling Technology Cat# 9212, RRID:AB_330713)</div></div><div style="margin-bottom:8px"><div>anti-phospho-JNK</div><div>suggested: (Proteintech Cat# 80024-1-RR, RRID:AB_2882943)</div></div><div style="margin-bottom:8px"><div>anti-JNK</div><div>suggested: (Cell Signaling Technology Cat# 9258, RRID:AB_2141027)</div></div><div style="margin-bottom:8px"><div>anti-phospho-RIPK3</div><div>suggested: (Affinity Biosciences Cat# AF3894, RRID:AB_2847208)</div></div><div style="margin-bottom:8px"><div>S227</div><div>suggested: (Abcam Cat# ab209384, RRID:AB_2714035)</div></div><div style="margin-bottom:8px"><div>anti-RIPK1</div><div>suggested: (Cell Signaling Technology Cat# 3493, RRID:AB_2305314)</div></div><div style="margin-bottom:8px"><div>anti-Ubiquitin (rabbit, Cell Signaling, 43124)</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-Ubiquitin</div><div>suggested: (Cell Signaling Technology Cat# 3936, RRID:AB_331292)</div></div><div style="margin-bottom:8px"><div>anti-GFP</div><div>suggested: (Cell Signaling Technology Cat# 2555, RRID:AB_10692764)</div></div><div style="margin-bottom:8px"><div>anti-CYLD (Cell Signaling 8462),</div><div>suggested: (Cell Signaling Technology Cat# 8462, RRID:AB_10949157)</div></div><div style="margin-bottom:8px"><div>anti-HOIP</div><div>suggested: (Proteintech Cat# 16289-1-AP, RRID:AB_2878239)</div></div><div style="margin-bottom:8px"><div>anti-M1-Ub</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-HOIL-1L</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-SHARPIN</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-TAK1</div><div>suggested: (Cell Signaling Technology Cat# 4505, RRID:AB_490858)</div></div><div style="margin-bottom:8px"><div>anti-IKK</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-K63-Ub</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-cIAP1</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-FLIP</div><div>suggested: (Cell Signaling Technology Cat# 3210, RRID:AB_2080940)</div></div><div style="margin-bottom:8px"><div>anti-Cleaved caspase-8</div><div>suggested: (Cell Signaling Technology Cat# 9496, RRID:AB_561381)</div></div><div style="margin-bottom:8px"><div>anti-Caspase-8</div><div>suggested: (Cell Signaling Technology Cat# 4790, RRID:AB_10545768)</div></div><div style="margin-bottom:8px"><div>D35G2) (Cell Signaling 4790)</div><div>suggested: (Cell Signaling Technology Cat# 4790, RRID:AB_10545768)</div></div><div style="margin-bottom:8px"><div>C15</div><div>suggested: (AdipoGen Cat# AG-20B-0057, RRID:AB_2490271)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Secondary antibodies used for Western blotting in this study include: anti-Mouse IgG-HRP (Dako P0447), anti-Rabbit IgG-HRP (Bio-Rad 1706515), anti-Sheep IgG-HRP (R&D HAF016), anti-human IgG-HRP (Bio-Rad 172-1033) and anti-Rat IgG-HRP (Thermo Fisher 31470).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>anti-Mouse IgG-HRP</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-Rabbit IgG-HRP</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-Sheep IgG-HRP</div><div>suggested: (Santa Cruz Biotechnology Cat# sc-2924, RRID:AB_656969)</div></div><div style="margin-bottom:8px"><div>anti-human IgG-HRP</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>anti-Rat IgG-HRP</div><div>suggested: (Thermo Fisher Scientific Cat# PA1-31470, RRID:AB_1954744)</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Cell Lines</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After selection with 1 µg/ml puromycin (Invitrogen ant-pr) in the presence of 5 µg/ml blasticidin, HCT116 / Tet-On-GFP, HCT116 / Tet-On-GFP-K63-SUB and HCT116 / Tet-On-GFP-M1-SUB cells were transduced with retroviral particles produced from LZRS-zeo-RIPK3-2xFV plasmids and selected with the combination of 5 µg/ml blasticidin, 1 µg/ml puromycin and 250 ng/µl zeocin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HCT116</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Production of lentiviral particles: For the production of lentiviral particles, HEK293FT cells were plated at a density of 3.5x106 cells in 10 cm dishes in 15 ml complete growth media.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293FT</div><div>suggested: RRID:CVCL_6911)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Generation of HT29 cells with Dox-inducible expression of ZBP1: For lentivirus production, HEK293T cells were transfected with C-terminally FLAG-tagged wild-type or Zα1α2-mutant human ZBP1-expressing transducing vectors in the doxycycline- inducible Tet-On pDG2 backbone (De Groote et al, 2016) together with the pCMV delta R8.91 gag-pol–expressing packaging plasmids and pMD2.G VSV-G-expressing envelope plasmid.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HEK293T</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HT29 and HT29 / RIPK1-KO clones were transduced using 100 µl 0.45 µm syringe-filtered lentivirus-containing supernatant in 12-well plate.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HT29</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">For the transduction of lentiviral particles, HCT116 / RIPK3-2xFV cells were seeded in 12-well plates at a density of 0.5-1x105 cells per well and transduced by incubation with 10-20 μl precipitated virus in 1 ml complete growth medium containing 10 μg/ml polybrene for 24 h.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>RIPK3-2xFV</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">SARS-CoV-2 infection of Calu-3 cells: The Wuhan-like early European SARS-CoV-2 B.1, Freiburg isolate (FR4286, kindly provided by Professor Georg Kochs, University of Freiburg) (Hoffmann et al, 2020), was propagated in Vero cells expressing human TMPRSS2 (Olagnier et al, 2020) and virus titer determined by TCID50% as previously described (Fougeroux et al, 2021).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Vero</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Calu-3 cells were seeded in flat-bottom 12-well plates (2x105 cells/well in 1 ml media) or flat-bottom 6-well plates (5x105 cells/well in 2 ml media).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>Calu-3</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Experimental Models: Organisms/Strains</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HCT116/RIPK1-KO clones used in this study were all generated with gRNAc.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>HCT116/RIPK1-KO</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Recombinant DNA</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The next day, transfection was carried out with a mixture of 1.5 ml OptiMEM, 36 μl FuGENE HD (Promega E2311), 1.2 μg pMD.G (VSVG) plasmid and 10.8 µg of the retroviral vector, and media was replaced 24h after transfection.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pMD.G (VSVG)</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Generation of HCT116 cells with inducible GFP-SUB expression: To generate HCT116 / Tet-On-GFP-SUB / RIPK3-2xFV cells, HCT116 cells were first transduced with lentiviral particles generated from pLenti-CMV-Blast plasmids carrying the Tet Repressor gene.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLenti-CMV-Blast</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">HCT116 / Tet-On clone C4 was plated at a density of 5x104 cells per well in 12-well plates, and transduced with 3 µl precipitated lentiviral particles generated with pLVX-tight-puro plasmids encoding GFP, GFP-K63-SUB or GFP-M1-SUB sequences (Hrdinka et al, 2016).</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLVX-tight-puro</div><div>suggested: RRID:Addgene_64844)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After selection with 1 µg/ml puromycin (Invitrogen ant-pr) in the presence of 5 µg/ml blasticidin, HCT116 / Tet-On-GFP, HCT116 / Tet-On-GFP-K63-SUB and HCT116 / Tet-On-GFP-M1-SUB cells were transduced with retroviral particles produced from LZRS-zeo-RIPK3-2xFV plasmids and selected with the combination of 5 µg/ml blasticidin, 1 µg/ml puromycin and 250 ng/µl zeocin.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>LZRS-zeo-RIPK3-2xFV</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The next day, they were transfected with a mixture of 1.5 ml OptiMEM, 36 μl FuGENE HD, 6 μg psPAX2 vector, 1.5 μg pMD.G (VSVG) and 4.5 μg lentiviral vector.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>psPAX2</div><div>suggested: RRID:Addgene_12260)</div></div><div style="margin-bottom:8px"><div>pMD.G</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Generation of HT29 cells with Dox-inducible expression of ZBP1: For lentivirus production, HEK293T cells were transfected with C-terminally FLAG-tagged wild-type or Zα1α2-mutant human ZBP1-expressing transducing vectors in the doxycycline- inducible Tet-On pDG2 backbone (De Groote et al, 2016) together with the pCMV delta R8.91 gag-pol–expressing packaging plasmids and pMD2.G VSV-G-expressing envelope plasmid.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pDG2</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pCMV delta R8.91 gag-pol–expressing</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pMD2.G VSV-G-expressing</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">shRNA plasmids used for this study are pLKO.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pLKO</div><div>suggested: RRID:Addgene_52920)</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">The next day, they were transfected using per well 125 ng pBIIX-Luc (NF-κB reporter plasmid) (Saksela & Baltimore, 1993), 25 ng SV40- Renilla luciferase plasmid, 0.5 ng ZBP1-expressing pLenti6.3 plasmid (with pBabe-puro or pLenti6.3-GFP as control), and, where indicated, 100 ng pBabe-CYLD plasmids (with pBabe- puro as EV control), 100 ng pcDNA3-OTULIN plasmids (with pcDNA3 as EV control), or 10 ng pcDNA3-GFP-SUB plasmids, in a mixture with 20 μl OptiMEM and 1μl FuGENE HD or FuGENE 6 (Promega E2691) per well.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>pBIIX-Luc</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pLenti6.3</div><div>suggested: RRID:Addgene_120848)</div></div><div style="margin-bottom:8px"><div>pBabe-puro</div><div>suggested: RRID:Addgene_1764)</div></div><div style="margin-bottom:8px"><div>pLenti6.3-GFP</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pBabe-CYLD</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pBabe-</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pcDNA3-OTULIN</div><div>suggested: None</div></div><div style="margin-bottom:8px"><div>pcDNA3</div><div>suggested: RRID:Addgene_15475)</div></div><div style="margin-bottom:8px"><div>pcDNA3-GFP-SUB</div><div>suggested: None</div></div></td></tr><tr><th style="min-width:100px;text-align:center; padding-top:4px;" colspan="2">Software and Algorithms</th></tr><tr><td style="min-width:100px;text=align:center">Sentences</td><td style="min-width:100px;text-align:center">Resources</td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">After stimulation, cells were washed twice with PBS and lysed in 500 µl/dish TBSN buffer (50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 0.5% NP-40) supplemented with protease inhibitor cocktail, phosphatase inhibitor cocktail and 50 mM N- Ethylmaleimide (NEM; Sigma Aldrich E1271) by ice incubation for a minimum of 15min.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>NEM; Sigma Aldrich</div><div>suggested: None</div></div></td></tr><tr><td style="min-width:100px;vertical-align:top;border-bottom:1px solid lightgray">Generation of standard curves and interpolation of data were performed in GraphPad Prism.</td><td style="min-width:100px;border-bottom:1px solid lightgray"><div style="margin-bottom:8px"><div>GraphPad Prism</div><div>suggested: (GraphPad Prism, RRID:SCR_002798)</div></div></td></tr></table>

      Results from OddPub: We did not detect open data. We also did not detect open code. Researchers are encouraged to share open data when possible (see Nature blog).


      Results from LimitationRecognizer: An explicit section about the limitations of the techniques employed in this study was not found. We encourage authors to address study limitations.

      Results from TrialIdentifier: No clinical trial numbers were referenced.


      Results from Barzooka: We did not find any issues relating to the usage of bar graphs.


      Results from JetFighter: We did not find any issues relating to colormaps.


      Results from rtransparent:
      • Thank you for including a conflict of interest statement. Authors are encouraged to include this statement when submitting to a journal.
      • Thank you for including a funding statement. Authors are encouraged to include this statement when submitting to a journal.
      • No protocol registration statement was detected.

      Results from scite Reference Check: We found no unreliable references.


      <footer>

      About SciScore

      SciScore is an automated tool that is designed to assist expert reviewers by finding and presenting formulaic information scattered throughout a paper in a standard, easy to digest format. SciScore checks for the presence and correctness of RRIDs (research resource identifiers), and for rigor criteria such as sex and investigator blinding. For details on the theoretical underpinning of rigor criteria and the tools shown here, including references cited, please follow this link.

      </footer>

    1. Author Response:

      Reviewer #1:

      A role for integrins in lowering the threshold for B cell activation was first observed over 15 years ago, but the mechanism has remained elusive. In this paper, Wang et al. investigate the role of LFA-1:ICAM-1 ligation in B cell synapse formation using live-cell super-resolution fluorescence microscopy in both primary B cells and the A20 B cell line. The use of super-resolution imaging is critical to the investigation as it reveals a level of organisation of the actomyosin network that is not visible with conventional microscopy approaches such as TIRF microscopy. They find that LFA-1:ICAM-1 ligation promotes the formation of actomyosin arcs that regulate various activities in the B cell synapse including BCR signalling, BCR:antigen microcluster transport, and the centralisation of antigen. In agreement with earlier studies, they show that LFA-1:ICAM-1 ligation is required for B cells to centralise antigen that is present at very low density. They also demonstrate that myosin IIa contractility is required for the formation of the actomyosin arcs and promotes the exertion of strong traction forces on the antigen- and ICAM-1-presenting substrate. Using a small molecule inhibitor of formin activity in combination with miRNA knockdown of the formin mDia1, the authors show that the actomyosin arcs originate at the outer edge of the synapse and that their generation is formin dependent. These data provide a much-needed advance to our understanding of the role LFA-1 plays in the earliest events in B cell responses to antigen.

      The conclusions of the paper are mostly well supported by the data, but there are a few points that would need to be clarified.

      1) The requirement for LFA-1:ICAM-1 ligation in the formation of the actomyosin arcs is not clear. The authors observe that ~30% of B cells form actomyosin arcs with anti-IgM stimulation only (Figure 1). Does LFA-1:ICAM-1 ligation simply stabilise the arcs and therefore make their appearance more likely, or does it promote the formation of a distinct actomyosin network with unique functions? The images and videos selected to represent cells stimulated with anti-IgM only (Figure 1; Movies 1A and 1B) seem form a highly branched actin network throughout the synapse, but it would be informative to see cells having the actomyosin arcs for comparison. Since B cells stimulated with anti-IgM alone are capable of signalling and centralising antigen, it would be interesting to know whether and how these two populations (with and without arcs) differ.

      We thank the reviewers for their questions regarding this central aspect of our study. In response to the reviewers’ statement “The requirement for LFA-1:ICAM-1 ligation in the formation of the actomyosin arcs is not clear”, our results state that “Consistently, scoring B cells for the presence of a discernable actin arc network showed that the addition of ICAM-1 increases the percentage of such cells from ~30% to ~70% (Fig. 1G).” Importantly, we then state that “dynamic imaging showed that the arcs in cells engaged with anti-IgM alone are typically sparse and transient (Movies 1A and 1B), while those in cells engaged with both anti-IgM and ICAM-1 are dense and persistent (Movies 2A and 2B).” To emphasize this point, which we think is clear when comparing Movies 1A/1B to Movies 2A/2B, we have now added the following two sentences to the text: “In other words, when B cells receiving only anti-IgM stimulation do form discernable arcs (see, for example, those marked by magenta arrows in Fig. 1A and 1B), they are much sparser and less robust than those formed by cells also receiving ICAM-1 stimulation. Moreover, we never saw even one B cell receiving anti-IgM stimulation alone that possessed a robust actin arc network.” Please note that the magenta arrows in Fig. 1A and 1B were added upon revision. In summary, the cell shown in Fig. 1E, which lacks discernable arcs, is representative of ~70% of anti-IgM stimulated cells, while the cell shown in Fig. 1F, which possesses a robust arc network, is representative of ~70% of anti-IgM+ICAM-1 stimulated cells.

      We would also like to address what we think is a misunderstanding regarding our images in Figure 1, as reflected in reviewer 1’s statement: “The images and videos selected to represent cells stimulated with anti-IgM only (Figure 1; Movies 1A and 1B) seem form a highly branched actin network throughout the synapse”. The outer, Arp2/3-generated, branched network comprising the dSMAC/lamellipodium in primary B cells is really quite thin under both stimulation conditions (please see Fig. 1, E1, E2, F1 and F2). In other words, we would not characterize the region between this thin, outer, canonical branched actin network and the central actin hypodense area (i.e. the region corresponding to the pSMAC) in B cells engaged with anti-IgM alone as “a highly branched actin network throughout”. We described it in the text as “a highly disorganized mixture of short actin filaments/fibers and actin foci”. While it likely contains some branched filaments, it is not a canonical branched actin network like the one comprising the dSMAC. Indeed, it is a lot like the mixture of actin asters, actin foci, branched actin and linear filaments described in Hela cells using the same imaging technique ((Fritzsche et al., 2017); we have now cited this paper). Of note, A20 B cells make a much bigger branched actin/dSMAC/lamellipodium than do primary B cells (compare the image of the representative A20 B cell in Fig. 1J to the various images of primary B cells in this figure). Interestingly, this difference between immortalized cells and primary cells is conserved in T cells, as Jurkat T cells make a much bigger branched actin/dSMAC/lamellipodium than do primary T cells (Murugesan et al, JCB 2016).

      Although the reviewers did not specifically comment on why only ~70% of primary B cells engaged with both anti-IgM and ICAM-1 make actomyosin arcs, we note that this is also the case for both Jurkat T cells and primary T cells (Murugesan et al, JCB 2016). We do not know why the number does not go to 100%, but the ~70% limit is the case for both B cells and T cells. Of note, in unpublished work we see that LFA-1 ligation also promotes actomyosin arc formation in T cells.

      With regard to the reviewers’ question “Does LFA-1:ICAM-1 ligation simply stabilize the arcs and therefore make their appearance more likely, or does it promote the formation of a distinct actomyosin network with unique functions?”, we think that ICAM-1 engagement likely leads to the strong activation of RhoA, which then serves to drive both the formation of actin arcs by recruiting, unfolding, and activating mDia at the plasma membrane, and the stabilization and concentric organization of these arcs by activating myosin 2A filament assembly and contractility. In other words, we think ICAM-1 engagement leads simultaneously to the creation and stabilization/organization of the arcs. While it is true that BCR stimulation alone activates RhoA signaling to some extent (see Saci and Carpenter, Mol Cell 2005 and Caloca et al, J Biol Chem 2008), and that this may account for the sparse actin arcs seen in cells stimulated with anti-IgM alone, it is likely that RhoA signaling is more robust with the addition of integrin co-stimulation (Lawson & Burridge, 2014) and that this would promote the creation of the actomyosin arcs seen in these cells. That said, without independent measures of the creation and stabilization/turnover of the arcs, we cannot gauge the relative significance of creation versus stabilization/turnover in determining the steady state amount of arcs. To address this limitation, we have added the following sentence to the section of the Discussion dealing with integrin-dependent signaling pathways leading to actomyosin arc formation: “Finally, future studies should also seek to clarify the extent to which integrin ligation promotes the formation of actomyosin arcs by driving their creation versus stabilizing them once created.

      With regard to the reviewers’ comment that “B cells stimulated with anti-IgM alone are capable of signalling and centralising antigen” we would like to emphasize that our study focuses on B cell immune synapse formation under limiting antigen conditions, where a previous study (Carrasco et al. Immunity 2004) and our data in Fig. S5 show that the impairments in BCR signaling and antigen centralization seen under this condition are rescued by integrin co-stimulation. We expand upon these findings by showing in Figures 5 and 6 that this integrin-dependent rescue of antigen centralization and BCR signaling requires actomyosin. In other words, the actomyosin arc network described here is required for integrin co-stimulation to promote antigen centralization and signaling under limiting antigen conditions. We agree with the reviewer that under non-limiting antigen conditions B cells can signal and centralize antigen in the absence of ICAM-1. That said, these high levels of BCR stimulation are probably not as physiological as limiting BCR stimulation. Finally, our data in Figure S7 shows that antigen centralization in primary B cells receiving non-limiting anti-IgM stimulation alone is also significantly impaired when myosin is inhibited. This suggests that cells receiving high levels of BCR stimulation employ myosin in some fashion to drive antigen centralization. We now close the section describing these results with the following statement: “That said, additional experiments should help define exactly how myosin contributes to antigen centralization in B cells receiving only strong anti-IgM stimulation."

      Finally, and most generally, we avoided the use of the word “requirement” as in the reviewer’s statement “the requirement for LFA-1:ICAM-1 ligation in the formation of the actomyosin arcs is not clear”. Given that some B cells receiving only anti-IgM stimulation create arcs (albeit sparse and transient), we were careful to say throughout the text that ICAM-1 engagement “promotes” actomyosin arc formation. We think our evidence for this is compelling.

      2) The authors propose that the contractile actomyosin network formed in the presence of LFA-1:ICAM-1 interactions promotes B cell activation especially at low antigen concentrations; however, their data focus only on early signalling (pCD79a and pCD19) and it would be helpful to know whether LFA-1:ICAM-1 interactions impact signalling further downstream.

      We thank the reviewer for this important suggestion, which we will address in a future study.

      3) The observation that some GC B cells centralise antigen is very interesting, but there are a few aspects of this investigation that should be expanded upon. The authors show that with LFA-1:ICAM-1 interactions, GC B cells are about equally likely to organise BCR:antigen complexes into peripheral clusters and centralised clusters. It would be informative to have, in the same study (Figure 7), a comparison with GC B cells stimulated with antigen alone. The reason is that other studies investigating GC B cell synapse architecture did not quantify antigen organisation in this way, so it is difficult to make comparisons with previous work. It would also be very useful to see how the actomyosin network is organised in GC B cells exhibiting different synaptic architectures (i.e. peripheral versus central clusters), especially given the critical role of myosin IIa activity in GC B cell antigen affinity discrimination. Additionally, while it is a very interesting observation that LFA-1:ICAM-1 interactions may affect GC B cell synapse organisation, it is not clear whether this has an impact on cellular function. For instance, does antigen and actomyosin organisation in GC B cell synapses contribute to differences in signalling or traction force generation? In the introduction the authors suggest that actomyosin arcs contribute to antibody affinity maturation (line 87-88), but without functional studies to support this claim I think it is too speculative.

      We thank the reviewer for their comments and suggestions regarding our GC data. Our sole purpose in performing the experiments in Figure 7 was to see if GC B cells can also make actomyosin arcs. We did this because recent papers and reviews state that the organization and dynamics of actin at GC B cell synapses are completely different from the organization and dynamics of actin at naive B cells synapses. As such, these initial observations are meant to add to previous work on GC B cells rather than generate direct comparisons. The reviewers appear to agree that the data in Figure 7 shows convincingly that a subset of GC B cells can make actomyosin arcs that are indistinguishable in appearance from those formed by naive B cells (so the specific claim we are making does not “require additional supporting data”). Rather, the reviewers request that we expand on the data in Figure 7 in several ways, some of which we had already mentioned in the Discussion (“While additional work is required to prove that the subset of GC B cells with actomyosin arcs are the ones that centralize antigen, this seems likely given our evidence here that actomyosin arcs drive antigen centralization in naïve B cells.”, and “Future work will also be required to understand why GC B cells vary with regard to actomyosin organization and the ability to centralize antigen 18 (e.g. dark zone versus light zone GCs)”). In addition to these statements, we now end the section describing the results in Figure 7 with the following statement: “We note, however, that our conclusions regarding actomyosin arcs in GC B cells require additional supporting data that include testing the ICAM-1 dependence of actomyosin arc formation and quantitating the contributions that this contractile structure makes to GC B cell traction force, signaling, and antigen centralization.”

      With regard to the reviewers concerns indicated by their comment “In the introduction the authors suggest that actomyosin arcs contribute to antibody affinity maturation (line 87-88), but without functional studies to support this claim I think it is too speculative”, we have changed the relevant sentence to “Finally, we show that germinal center (GC) B cells can also create this actomyosin structure, suggesting that it may contribute to the functions of GC B cells as well”.

      Reviewer #2:

      The manuscript utilizes elegant imaging tools to describe the contractile actomyosin arcs, induced by integrin-ligation, and their involvement in antigen gathering in B cells. The findings are important and have the potential to make a considerable impact in the field. The main conclusions are well supported by strong data and the manuscript convincingly brings across the need of integrin-ligation to induce generation of the arc network and the role of this structure in antigen gathering. The methods and the quality of imaging are state-of-the-art and provide an important example for future studies in B cell immune synapse. Some aspects of the study would benefit from clarification and extended experimentation or analysis.

      1) In addition to cultured B cells, the work includes naïve primary B cells as well as isolated germinal center B cells. While the use of primary cells adds value to the study, in most cases the cells are activated first with LPS prior to transfection with F-Tractin constructs. Such a treatment is likely to alter the cytoskeletal features of the naïve B cells and, thus, it would be informative to provide an analysis of this effect.

      We thank the reviewer for commenting on this. To clarify, we treated primary B cells with LPS to promote cell survival during the harsh nucleofection/electroporation conditions that otherwise kill these fragile cells. Moreover, the cells were rested for 24 hours post-nucleofection in the absence of LPS to promote return to a resting state, as previously described (see(Freeman et al., 2011)). Moreover, only those primary B cells used for live cell imaging of the F-actin using the F-actin reporter F-Tractin were LPS treated. The majority of our experiments employed non-treated ex vivo B cells that were fixed, stained and imaged for quantitation. Importantly, under conditions of ICAM-1 co-stimulation, the actomyosin arcs formed by ex vivo B cells and by LPS-activated cells were indistinguishable. For example, compare the F-Tractin-expressing cell in Fig. 3A to the non-treated cells in Fig. 3D and Fig. 7A. To summarize, then, only live-cell imaging experiments that required F-Tractin to visualize F-actin dynamics were performed using LPS-activated B cells. Finally, we clarified in the Methods that we refer to all primary B cells as “naïve” B cells because they had not been previously activated by antigen at the time of antigen stimulation.

      Reviewer #3:

      The work 'A B cell actomyosin arc network couples integrin co-stimulation to mechanical force-dependent immune synapse formation' by Wang et al. describes the importance of integrin mediated B-cell co-stimulation for IS formation in B-cells by fostering the formation of myosin II A driven actin arcs that are essential in the transport of IgM clusters towards the IS center.

      The work presented here, i.e. experiments and analysis, is very thoroughly done and includes tests and controls using different labelling strategies and constructs of myosin II A, multiple cell types including primary cells and a range of chemical inhibitors to rule out artefacts.

      The authors claim that the observation of actin arcs in B-cells co-stimulated by ICAM-1 - LFA-1 interaction is important for the efficient activation of B-cells in the presence of limiting levels of anti-IgM and this is very well supported by the experiments. However, it was a bit surprising that the paper did not draw much of parallels between the observed phenomenon and the reported actin arcs in activated T-cells even though some of the authors were very much involved in such work on T-cells. If there is a good reason to believe there is no ground to draw comparisons, this would then also need to be highlighted by the authors.

      We thank the reviewer for their comments. We have now added the following two sentences to the Discussion: “It is also important to note that the contractile actomyosin arcs described here in B cells and the actomyosin arcs described previously in T cells (Murugesan et al., 2016) share much in common as regards formation, organization and dynamics (Hammer et al., 2019; Wang & Hammer, 2020). Going forward, it will be vital to define how these two immune cell types harness the same contractile synaptic structure to accomplish different goals (i.e. antibody production by B cells and target cell killing by T cells).”

      The work on establishing the drivers of actin arc formation and dynamics is well done, but it is important to note that previous work has analyzed actin arc formation in other cell types. Work by Bershadsky has already established many 'ground rules' for the formation of actin arcs and the role of integrin adhesion, formin activity and myosin II in the process (Tee YH, Shemesh T, Thiagarajan V, Hariadi RF, Anderson KL, Page C, Volkmann N, Hanein D, Sivaramakrishnan S, Kozlov MM, Bershadsky AD. 2015. Cellular chirality arising from the self-organization of the actin cytoskeleton. Nat Cell Biol 17:445-457. doi:10.1038/ncb3137). It might be very instructive if the authors could put their findings in relation to this work.

      The formation of actin arcs is also well studied in U2OS cells and the results presented here could highlight interesting general features of this process observed in very different cell types (Tojkander S, Gateva G, Husain A, Krishnan R, Lappalainen P. 2015. Generation of contractile actomyosin bundles depends on mechanosensitive actin filament assembly and disassembly. Elife 4:1-28. doi:10.7554/eLife.06126; Bur-nette DT, Shao L, Ott C, Pasapera AM, Fischer RS, Baird MA, Der Loughian C, Delanoe-Ayari H, Paszek MJ, Davidson MW, Betzig E, Lippincott-Schwartz J. 2014. A contractile and counterbalancing adhesion system controls the 3D shape of crawling cells. J Cell Biol 205:83-96. doi:10.1083/jcb.201311104).

      In this regard, the findings about the importance of myosin II A activity, integrin adhesion and mDia1 in the formation of actin arcs is not that surprising and the authors might rather highlight the important role of these newly studied structures for co-stimulation in B-cells as this is the more novel and insightful bit of the work.

      We thank the reviewer for their comments. Indeed, our prior work in T cells (Murugesan et al., 2016; Yi et al., 2012) also linked formin activity and myosin 2 contractility to the formation of actin arcs and the generation of integrin-based adhesion. We now cite the papers highlighted by the reviewer using the following sentence in the revised Discussion: “It is important to note here that several earlier studies performed using other cell types have also linked formin activity and myosin 2 contractility to the formation of actin arcs and the generation of integrin-based adhesions (Burnette et al., 2014; Tee et al., 2015; Tojkander et al., 2015).” As for highlighting the relevance of our results for the B cell field, we think we have done that by demonstrating the existence of this contractile network in B cells, and by showing that it provides mechanistic insight into how integrin co-stimulation promotes synapse formation and B cell activation when antigen is limiting. Given that many recent studies of actin cytoskeletal dynamics in B cells were performed in the absence of LFA-1 ligation, we think our findings invite a critical “reset” for the way in which future B cell studies should be approached by highlighting the need for integrin co-stimulation when examining the roles of actin and myosin in B cell activation.